ComplexModeler is a computational tool combines DiffModeler(seq) and CryoREAD to automatically build full protein-DNA/RNA complex structure from cryo-EM maps at 0-10A resolution (5-10 may work but DNA/RNA region will be bad).
If encounter problems, please contact Daisuke Kihara (dkihara@purdue.edu), or Han Zhu (zhu773@purdue.edu).
Example EMD- Input Map file:20031.mrc
Input Sequence:20031.fasta
Contour level:0.03
Resolution:4.3
Result Example:Result Example
Please simply click "Schedule Job" when you filled all input fields.
Density Histogram (|ρ|)
0.00
Contour: 0.00
0.00
Contour level for input map, suggested [author_contour]. Please do not input 0, you must provide a contour to remove the outside very noisy regions.
Please make sure your contour level is lower than your focused region. This is absolute density threshold, not standard deviation.
Resolution information is needed for refinement in our refinement pipeline
Please use a sequence file with fasta format. Each chain must have a ID line (begin with a carat (">")) and a SEQUENCE line.
For ID line, please only include the chain id without any other information. If multiple chains include the identical sequences, please use comma "," to split different chains.
Example Sequence ID line
>A,B,C,D
MATPAGRRASETERLLTPNPGYGTQVGTSPAPTTPTEEEDLRR
>E,F
VVTFREENTIAFRHLFLLGYSDGSDDTFAAYTQEQLYQ
which indicates 6 chains with A,B,C,D share the identical sequences and E,F share another identical sequences.
Here the protein sequence is required (can be partial) and DNA/RNA sequence is optional
0/500
This note will help you distinguish jobs later.