DeepMainMast CPU started
rosetta_bin_linux_2021.16.61629_bundle -s

input_resize.mrc
input.fasta
Option -c: 0

Option -t: 896
Option -T: 896
Option MAX Threads -C: 8
Option Max SubThreads: 8
rosetta_bin_linux_2021.16.61629_bundle
initial CA model

input_resize.mrc
input.fasta
#CONTOUR: 0

#TIME_TRACE: 896
#TIME_Assemble: 896
#MAX_Threads: 8
rosetta_bin_linux_2021.16.61629_bundle
rosetta_bin_linux_2021.16.61629_bundle
max_jobs: 8
NODE_p0.5.pdb
NODE_p0.3.pdb
NODE_p0.4.pdb
NODE_p0.5.pdb
INFO : C-alpha Node computing Done
max_jobs: 8
PATH_p0.5Nch40.log
PATH_p0.3Nch5.log
PATH_p0.3Nch10.log
PATH_p0.3Nch20.log
PATH_p0.3Nch40.log
PATH_p0.4Nch5.log
PATH_p0.4Nch10.log
PATH_p0.4Nch20.log
PATH_p0.4Nch40.log
PATH_p0.5Nch5.log
PATH_p0.5Nch10.log
PATH_p0.5Nch20.log
PATH_p0.5Nch40.log
INFO : Path Tracing by VRP Done
max_jobs: 8
INP_p0.5Nch40Nali20.txt
INP_p0.3Nch5Nali5.txt
INP_p0.3Nch5Nali10.txt
INP_p0.3Nch5Nali20.txt
INP_p0.3Nch10Nali5.txt
INP_p0.3Nch10Nali10.txt
INP_p0.3Nch10Nali20.txt
INP_p0.3Nch20Nali5.txt
INP_p0.3Nch20Nali10.txt
INP_p0.3Nch20Nali20.txt
INP_p0.3Nch40Nali5.txt
INP_p0.3Nch40Nali10.txt
INP_p0.3Nch40Nali20.txt
INP_p0.4Nch5Nali5.txt
INP_p0.4Nch5Nali10.txt
INP_p0.4Nch5Nali20.txt
INP_p0.4Nch10Nali5.txt
INP_p0.4Nch10Nali10.txt
INP_p0.4Nch10Nali20.txt
INP_p0.4Nch20Nali5.txt
INP_p0.4Nch20Nali10.txt
INP_p0.4Nch20Nali20.txt
INP_p0.4Nch40Nali5.txt
INP_p0.4Nch40Nali10.txt
INP_p0.4Nch40Nali20.txt
INP_p0.5Nch5Nali5.txt
INP_p0.5Nch5Nali10.txt
INP_p0.5Nch5Nali20.txt
INP_p0.5Nch10Nali5.txt
INP_p0.5Nch10Nali10.txt
INP_p0.5Nch10Nali20.txt
INP_p0.5Nch20Nali5.txt
INP_p0.5Nch20Nali10.txt
INP_p0.5Nch20Nali20.txt
INP_p0.5Nch40Nali5.txt
INP_p0.5Nch40Nali10.txt
INP_p0.5Nch40Nali20.txt
INFO : generating INP file Done
max_jobs: 1
OUT_p0.5Nch40Nali20.log
OUT_p0.3Nch5Nali5.log
OUT_p0.3Nch5Nali10.log
OUT_p0.3Nch5Nali20.log
OUT_p0.3Nch10Nali5.log
OUT_p0.3Nch10Nali10.log
OUT_p0.3Nch10Nali20.log
OUT_p0.3Nch20Nali5.log
OUT_p0.3Nch20Nali10.log
OUT_p0.3Nch20Nali20.log
OUT_p0.3Nch40Nali5.log
OUT_p0.3Nch40Nali10.log
OUT_p0.3Nch40Nali20.log
OUT_p0.4Nch5Nali5.log
OUT_p0.4Nch5Nali10.log
OUT_p0.4Nch5Nali20.log
OUT_p0.4Nch10Nali5.log
OUT_p0.4Nch10Nali10.log
OUT_p0.4Nch10Nali20.log
OUT_p0.4Nch20Nali5.log
OUT_p0.4Nch20Nali10.log
OUT_p0.4Nch20Nali20.log
OUT_p0.4Nch40Nali5.log
OUT_p0.4Nch40Nali10.log
OUT_p0.4Nch40Nali20.log
OUT_p0.5Nch5Nali5.log
OUT_p0.5Nch5Nali10.log
OUT_p0.5Nch5Nali20.log
OUT_p0.5Nch10Nali5.log
OUT_p0.5Nch10Nali10.log
OUT_p0.5Nch10Nali20.log
OUT_p0.5Nch20Nali5.log
OUT_p0.5Nch20Nali10.log
OUT_p0.5Nch20Nali20.log
OUT_p0.5Nch40Nali5.log
OUT_p0.5Nch40Nali10.log
OUT_p0.5Nch40Nali20.log
INFO : Assembling Done
INFO : Combine All Models
max_jobs: 1
MTX_DMonly.txt
MTX_DMonly.txt
max_jobs: 1
COMBi_DMonly.log
COMBi_DMonly.log
INFO : Combine All Models Done
INFO : DAQ scoring for CA models
max_jobs: 8
COMBi_DMonly.daq
COMBi_DMonly.daq
INFO : DAQ scoring Done
WARNING: Use StructureBlurrer.gaussian_blur_real_space_box()to blured a map with a user defined defined cubic box
INFO : DOT scoring Done
INFO : CA modeling Done
COMBi_DMonly.pdb 2.1325782943938782
%s total different chains : {'A', 'B', 'C'}
[['A', ' CA ', 129.601, 123.821, 67.819]]
[['A', ' CA ', 131.684, 120.458, 68.483]]
[['A', ' CA ', 133.22, 120.582, 72.165]]
[['A', ' CA ', 136.707, 118.774, 71.884]]
[['A', ' CA ', 137.538, 117.526, 75.757]]
[['A', ' CA ', 141.271, 116.194, 76.008]]
[['A', ' CA ', 141.449, 114.049, 79.448]]
[['A', ' CA ', 144.979, 113.508, 80.689]]
[['A', ' CA ', 145.794, 117.064, 80.801]]
[['A', ' CA ', 149.613, 116.84, 79.485]]
[['A', ' CA ', 152.687, 117.833, 81.544]]
[['A', ' CA ', 150.93, 119.018, 84.963]]
[['A', ' CA ', 150.352, 116.895, 88.161]]
[['A', ' CA ', 147.584, 114.82, 88.696]]
[['A', ' CA ', 143.911, 114.471, 86.655]]
[['A', ' CA ', 141.856, 117.331, 84.938]]
[['A', ' CA ', 140.277, 117.332, 81.377]]
[['A', ' CA ', 139.254, 120.913, 79.948]]
[['A', ' CA ', 136.248, 120.221, 77.37]]
[['A', ' CA ', 136.178, 123.671, 75.373]]
[['A', ' CA ', 133.206, 123.831, 72.579]]
[['A', ' CA ', 134.763, 125.827, 69.851]]
[['A', ' CA ', 132.521, 127.35, 67.06]]
[['A', ' CA ', 133.032, 127.851, 61.944]]
[['A', ' CA ', 136.797, 128.341, 62.575]]
[['A', ' CA ', 137.869, 126.038, 65.861]]
[['A', ' CA ', 138.347, 129.666, 68.551]]
[['A', ' CA ', 136.775, 128.067, 71.709]]
[['A', ' CA ', 133.844, 130.716, 72.63]]
[['A', ' CA ', 133.303, 128.738, 76.86]]
[['A', ' CA ', 135.943, 125.883, 77.734]]
[['A', ' CA ', 135.709, 124.822, 81.805]]
[['A', ' CA ', 138.578, 122.893, 83.036]]
[['A', ' CA ', 137.409, 120.639, 85.849]]
[['A', ' CA ', 139.072, 118.019, 88.15]]
[['A', ' CA ', 138.799, 114.326, 87.36]]
[['A', ' CA ', 140.842, 113.147, 90.182]]
[['A', ' CA ', 139.878, 110.495, 92.706]]
[['A', ' CA ', 138.931, 112.071, 96.06]]
[['A', ' CA ', 141.521, 111.013, 98.751]]
[['A', ' CA ', 138.794, 112.387, 101.694]]
[['A', ' CA ', 142.208, 113.906, 103.487]]
[['A', ' CA ', 140.681, 116.978, 105.645]]
[['A', ' CA ', 137.342, 114.269, 107.075]]
[['A', ' CA ', 140.22, 111.176, 107.677]]
[['A', ' CA ', 142.649, 113.918, 110.074]]
[['A', ' CA ', 138.967, 115.835, 111.58]]
[['A', ' CA ', 137.946, 112.753, 114.296]]
[['A', ' CA ', 142.292, 111.89, 115.034]]
[['A', ' CA ', 144.543, 114.21, 117.445]]
[['A', ' CA ', 146.284, 117.28, 115.652]]
[['A', ' CA ', 150.304, 115.852, 115.149]]
[['A', ' CA ', 148.927, 113.067, 112.427]]
[['A', ' CA ', 146.827, 116.198, 110.296]]
[['A', ' CA ', 150.412, 118.14, 109.488]]
[['A', ' CA ', 151.87, 114.332, 107.777]]
[['A', ' CA ', 148.571, 113.046, 105.95]]
[['A', ' CA ', 147.779, 116.864, 104.881]]
[['A', ' CA ', 151.667, 116.856, 103.514]]
[['A', ' CA ', 150.814, 113.83, 101.395]]
[['A', ' CA ', 148.078, 115.919, 99.308]]
[['A', ' CA ', 150.757, 116.524, 96.806]]
[['A', ' CA ', 154.299, 115.472, 96.505]]
[['A', ' CA ', 155.317, 118.632, 94.384]]
[['A', ' CA ', 153.81, 121.142, 97.275]]
[['A', ' CA ', 154.172, 119.178, 100.81]]
[['A', ' CA ', 156.378, 121.914, 102.787]]
[['A', ' CA ', 153.654, 124.532, 101.996]]
[['A', ' CA ', 150.571, 122.316, 103.437]]
[['A', ' CA ', 152.517, 120.867, 106.562]]
[['A', ' CA ', 153.552, 124.361, 107.922]]
[['A', ' CA ', 149.817, 126.099, 106.873]]
[['A', ' CA ', 147.764, 122.669, 108.728]]
[['A', ' CA ', 150.489, 122.711, 112.152]]
[['A', ' CA ', 150.407, 127.428, 112.044]]
[['A', ' CA ', 146.344, 126.698, 111.668]]
[['A', ' CA ', 145.935, 123.715, 114.553]]
[['A', ' CA ', 149.707, 126.698, 116.716]]
[['A', ' CA ', 146.597, 129.791, 115.987]]
[['A', ' CA ', 142.859, 127.296, 117.463]]
[['A', ' CA ', 145.161, 126.078, 120.736]]
[['A', ' CA ', 147.676, 129.886, 120.449]]
[['A', ' CA ', 151.383, 128.329, 120.965]]
[['A', ' CA ', 153.546, 131.561, 119.624]]
[['A', ' CA ', 156.772, 129.21, 118.057]]
[['A', ' CA ', 160.092, 131.316, 119.245]]
[['A', ' CA ', 161.478, 133.195, 116.01]]
[['A', ' CA ', 164.629, 130.886, 114.598]]
[['A', ' CA ', 161.203, 127.482, 114.309]]
[['A', ' CA ', 158.969, 130.689, 112.108]]
[['A', ' CA ', 162.7, 132.116, 109.894]]
[['A', ' CA ', 164.243, 127.79, 109.393]]
[['A', ' CA ', 159.876, 126.694, 108.209]]
[['A', ' CA ', 159.839, 130.651, 105.739]]
[['A', ' CA ', 163.906, 129.385, 104.517]]
[['A', ' CA ', 162.481, 125.651, 103.785]]
[['A', ' CA ', 159.025, 126.897, 101.911]]
[['A', ' CA ', 161.092, 129.953, 99.973]]
[['A', ' CA ', 164.337, 127.097, 98.826]]
[['A', ' CA ', 160.911, 124.197, 98.139]]
[['A', ' CA ', 159.037, 127.623, 95.904]]
[['A', ' CA ', 162.536, 127.683, 93.678]]
[['A', ' CA ', 162.806, 123.299, 93.528]]
[['A', ' CA ', 158.591, 123.278, 92.669]]
[['A', ' CA ', 158.621, 126.22, 89.937]]
[['A', ' CA ', 162.176, 124.681, 88.485]]
[['A', ' CA ', 160.312, 120.681, 88.291]]
[['A', ' CA ', 156.964, 122.853, 86.527]]
[['A', ' CA ', 159.904, 124.932, 83.794]]
[['A', ' CA ', 161.418, 120.982, 83.085]]
[['A', ' CA ', 157.519, 119.697, 82.362]]
[['A', ' CA ', 155.953, 122.996, 80.541]]
[['A', ' CA ', 159.869, 123.786, 78.917]]
[['A', ' CA ', 159.987, 120.064, 76.768]]
[['A', ' CA ', 157.022, 122.257, 74.028]]
[['A', ' CA ', 158.873, 126.272, 74.828]]
[['A', ' CA ', 162.787, 125.084, 74.941]]
[['A', ' CA ', 163.451, 123.584, 71.15]]
[['A', ' CA ', 164.96, 119.77, 72.195]]
[['A', ' CA ', 169.396, 120.562, 71.428]]
[['A', ' CA ', 169.723, 123.321, 74.926]]
[['A', ' CA ', 166.086, 121.053, 76.719]]
[['A', ' CA ', 169.007, 118.107, 78.081]]
[['A', ' CA ', 171.61, 121.166, 79.498]]
[['A', ' CA ', 168.036, 123.607, 80.543]]
[['A', ' CA ', 166.273, 119.85, 82.792]]
[['A', ' CA ', 170.155, 119.21, 84.168]]
[['A', ' CA ', 170.662, 123.644, 85.145]]
[['A', ' CA ', 166.475, 123.258, 86.985]]
[['A', ' CA ', 167.786, 119.27, 88.727]]
[['A', ' CA ', 171.566, 121.165, 89.935]]
[['A', ' CA ', 169.066, 124.701, 91.423]]
[['A', ' CA ', 166.105, 122.014, 92.895]]
[['A', ' CA ', 169.463, 118.861, 94.339]]
[['A', ' CA ', 171.176, 122.372, 96.468]]
[['A', ' CA ', 167.499, 124.307, 97.488]]
[['A', ' CA ', 166.021, 120.222, 98.596]]
[['A', ' CA ', 169.573, 119.553, 100.74]]
[['A', ' CA ', 168.515, 123.423, 102.987]]
[['A', ' CA ', 164.214, 121.799, 103.097]]
[['A', ' CA ', 165.66, 117.857, 103.753]]
[['A', ' CA ', 168.796, 119.209, 106.542]]
[['A', ' CA ', 165.969, 121.954, 107.862]]
[['A', ' CA ', 162.704, 119.814, 107.938]]
[['A', ' CA ', 163.975, 115.891, 107.754]]
[['A', ' CA ', 163.861, 114.935, 103.739]]
[['A', ' CA ', 162.758, 117.099, 100.832]]
[['A', ' CA ', 159.746, 115.382, 99.478]]
[['A', ' CA ', 157.522, 114.929, 102.507]]
[['A', ' CA ', 158.964, 117.006, 105.366]]
[['A', ' CA ', 158.572, 115.207, 108.84]]
[['A', ' CA ', 160.583, 117.568, 111.587]]
[['A', ' CA ', 158.217, 121.234, 111.107]]
[['A', ' CA ', 155.646, 119.209, 113.573]]
[['A', ' CA ', 153.083, 122.016, 115.515]]
[['A', ' CA ', 155.001, 124.921, 117.982]]
[['A', ' CA ', 157.371, 125.13, 115.447]]
[['A', ' CA ', 160.212, 123.054, 114.52]]
[['A', ' CA ', 161.549, 119.946, 115.627]]
[['A', ' CA ', 165.212, 120.198, 115.983]]
[['A', ' CA ', 167.081, 123.643, 114.504]]
[['A', ' CA ', 170.252, 122.732, 112.185]]
[['A', ' CA ', 173.931, 123.043, 114.285]]
[['A', ' CA ', 175.815, 126.174, 112.677]]
[['A', ' CA ', 178.663, 123.413, 110.012]]
[['A', ' CA ', 174.867, 122.353, 108.024]]
[['A', ' CA ', 173.361, 126.453, 108.253]]
[['A', ' CA ', 177.126, 128.157, 106.804]]
[['A', ' CA ', 177.863, 124.559, 104.433]]
[['A', ' CA ', 173.699, 124.875, 102.676]]
[['A', ' CA ', 174.013, 129.366, 103.036]]
[['A', ' CA ', 177.788, 129.05, 100.899]]
[['A', ' CA ', 176.3, 126.083, 98.145]]
[['A', ' CA ', 172.476, 128.323, 97.737]]
[['A', ' CA ', 174.45, 132.4, 97.455]]
[['A', ' CA ', 177.603, 130.241, 94.681]]
[['A', ' CA ', 173.663, 128.324, 92.823]]
[['A', ' CA ', 171.616, 132.384, 93.14]]
[['A', ' CA ', 174.509, 133.523, 89.874]]
[['A', ' CA ', 173.311, 129.765, 87.483]]
[['A', ' CA ', 169.014, 129.893, 89.067]]
[['A', ' CA ', 169.088, 134.275, 87.952]]
[['A', ' CA ', 171.31, 133.091, 84.263]]
[['A', ' CA ', 168.273, 129.715, 83.622]]
[['A', ' CA ', 164.946, 132.198, 84.897]]
[['A', ' CA ', 166.474, 135.547, 82.317]]
[['A', ' CA ', 167.202, 132.229, 79.054]]
[['A', ' CA ', 163.531, 130.559, 80.149]]
[['A', ' CA ', 161.497, 134.37, 80.32]]
[['A', ' CA ', 164.574, 135.522, 76.626]]
[['A', ' CA ', 162.821, 131.539, 74.946]]
[['A', ' CA ', 158.414, 131.612, 76.283]]
[['A', ' CA ', 158.391, 135.845, 75.493]]
[['A', ' CA ', 160.461, 134.633, 71.397]]
[['A', ' CA ', 157.613, 131.285, 70.814]]
[['A', ' CA ', 154.981, 134.739, 70.811]]
[['A', ' CA ', 151.787, 132.793, 71.664]]
[['A', ' CA ', 149.377, 135.432, 70.219]]
[['A', ' CA ', 149.509, 138.268, 72.872]]
[['A', ' CA ', 146.244, 138.909, 74.933]]
[['A', ' CA ', 145.855, 134.801, 75.627]]
[['A', ' CA ', 144.79, 133.96, 79.183]]
[['A', ' CA ', 143.792, 137.69, 80.142]]
[['A', ' CA ', 140.545, 137.181, 82.029]]
[['A', ' CA ', 139.753, 140.39, 84.554]]
[['A', ' CA ', 138.446, 138.028, 87.848]]
[['A', ' CA ', 140.587, 139.648, 90.592]]
[['A', ' CA ', 144.097, 137.992, 91.699]]
[['A', ' CA ', 144.883, 136.157, 95.065]]
[['A', ' CA ', 147.857, 137.277, 97.463]]
[['A', ' CA ', 148.174, 137.821, 101.204]]
[['A', ' CA ', 152.6, 138.285, 101.459]]
[['A', ' CA ', 154.976, 137.958, 98.661]]
[['A', ' CA ', 156.646, 133.869, 99.932]]
[['A', ' CA ', 155.067, 133.134, 103.764]]
[['A', ' CA ', 151.731, 133.714, 104.509]]
[['A', ' CA ', 150.242, 136.194, 106.892]]
[['A', ' CA ', 146.511, 134.873, 107.72]]
[['A', ' CA ', 144.729, 138.721, 109.076]]
[['A', ' CA ', 145.042, 140.124, 104.993]]
[['A', ' CA ', 142.992, 136.361, 103.793]]
[['A', ' CA ', 139.797, 138.008, 105.789]]
[['A', ' CA ', 137.396, 134.825, 105.831]]
[['A', ' CA ', 133.642, 136.855, 105.963]]
[['A', ' CA ', 134.69, 137.961, 101.945]]
[['A', ' CA ', 135.555, 133.813, 101.733]]
[['A', ' CA ', 133.046, 131.662, 99.536]]
[['A', ' CA ', 132.131, 127.851, 99.618]]
[['A', ' CA ', 131.053, 127.033, 95.788]]
[['A', ' CA ', 130.44, 123.205, 95.042]]
[['A', ' CA ', 130.997, 122.851, 91.507]]
[['A', ' CA ', 127.277, 121.351, 90.291]]
[['A', ' CA ', 125.756, 125.331, 91.04]]
[['A', ' CA ', 129.443, 127.129, 89.055]]
[['A', ' CA ', 129.226, 124.537, 85.682]]
[['A', ' CA ', 125.763, 124.856, 83.915]]
[['A', ' CA ', 125.662, 121.398, 82.11]]
[['A', ' CA ', 124.841, 118.551, 85.581]]
[['A', ' CA ', 127.108, 115.306, 83.903]]
[['A', ' CA ', 130.951, 117.776, 83.882]]
[['A', ' CA ', 129.831, 119.408, 87.987]]
[['A', ' CA ', 128.57, 115.572, 89.347]]
[['A', ' CA ', 132.237, 113.846, 87.31]]
[['A', ' CA ', 134.925, 116.909, 88.655]]
[['A', ' CA ', 135.708, 116.503, 92.612]]
[['A', ' CA ', 136.797, 120.196, 93.314]]
[['A', ' CA ', 134.827, 122.691, 95.483]]
[['A', ' CA ', 135.493, 126.305, 93.531]]
[['A', ' CA ', 136.167, 128.514, 96.923]]
[['A', ' CA ', 135.592, 132.209, 95.13]]
[['A', ' CA ', 136.715, 135.061, 97.925]]
[['A', ' CA ', 133.705, 137.856, 97.931]]
[['A', ' CA ', 131.343, 135.507, 95.506]]
[['A', ' CA ', 133.946, 136.147, 91.925]]
[['A', ' CA ', 136.664, 133.428, 91.309]]
[['A', ' CA ', 140.187, 133.875, 91.795]]
[['A', ' CA ', 143.59, 133.215, 90.215]]
[['A', ' CA ', 145.993, 133.385, 93.402]]
[['A', ' CA ', 149.47, 132.114, 91.731]]
[['A', ' CA ', 153.038, 133.699, 92.042]]
[['A', ' CA ', 152.374, 136.231, 89.087]]
[['A', ' CA ', 149.064, 137.769, 91.369]]
[['A', ' CA ', 151.454, 137.672, 95.011]]
[['A', ' CA ', 154.209, 139.868, 92.147]]
[['A', ' CA ', 151.307, 142.24, 90.601]]
[['A', ' CA ', 149.87, 143.087, 94.735]]
[['A', ' CA ', 153.211, 143.193, 97.296]]
[['A', ' CA ', 156.373, 143.808, 94.398]]
[['A', ' CA ', 154.057, 146.017, 91.364]]
[['A', ' CA ', 154.448, 143.527, 87.723]]
[['A', ' CA ', 150.879, 145.181, 86.185]]
[['A', ' CA ', 151.782, 142.781, 82.49]]
[['A', ' CA ', 148.48, 140.239, 82.919]]
[['A', ' CA ', 148.287, 137.01, 79.722]]
[['A', ' CA ', 149.937, 133.232, 80.202]]
[['A', ' CA ', 153.897, 134.282, 78.797]]
[['A', ' CA ', 153.715, 137.321, 82.12]]
[['A', ' CA ', 152.19, 134.17, 84.729]]
[['A', ' CA ', 155.225, 131.588, 83.257]]
[['A', ' CA ', 158.222, 134.609, 83.349]]
[['A', ' CA ', 156.606, 136.159, 87.099]]
[['A', ' CA ', 157.364, 131.892, 88.702]]
[['A', ' CA ', 161.167, 131.888, 87.023]]
[['A', ' CA ', 161.719, 136.066, 88.481]]
[['A', ' CA ', 159.578, 135.304, 92.225]]
[['A', ' CA ', 162.062, 131.477, 92.477]]
[['A', ' CA ', 165.511, 134.753, 92.412]]
[['A', ' CA ', 163.203, 136.896, 95.367]]
[['A', ' CA ', 162.512, 133.219, 97.794]]
[['A', ' CA ', 166.379, 131.736, 97.201]]
[['A', ' CA ', 168.157, 135.65, 98.226]]
[['A', ' CA ', 165.045, 136.001, 101.631]]
[['A', ' CA ', 166.404, 131.909, 102.531]]
[['A', ' CA ', 170.222, 132.907, 101.995]]
[['A', ' CA ', 169.554, 136.732, 104.134]]
[['A', ' CA ', 167.251, 134.3, 107.159]]
[['A', ' CA ', 170.237, 131.192, 107.124]]
[['A', ' CA ', 173.188, 134.263, 107.682]]
[['A', ' CA ', 170.299, 136.443, 110.722]]
[['A', ' CA ', 168.618, 132.577, 112.415]]
[['A', ' CA ', 171.013, 132.091, 115.719]]
[['A', ' CA ', 170.9, 127.854, 115.572]]
[['A', ' CA ', 171.536, 126.799, 119.339]]
[['A', ' CA ', 168.144, 129.472, 121.119]]
[['A', ' CA ', 165.08, 126.373, 121.012]]
[['A', ' CA ', 162.912, 126.114, 117.93]]
[['A', ' CA ', 159.878, 124.11, 119.285]]
[['A', ' CA ', 157.028, 125.169, 121.64]]
[['A', ' CA ', 155.713, 123.959, 124.905]]
[['A', ' CA ', 151.906, 123.074, 124.791]]
[['A', ' CA ', 147.965, 122.649, 125.719]]
[['A', ' CA ', 147.088, 120.867, 122.518]]
[['A', ' CA ', 143.507, 119.858, 123.587]]
[['A', ' CA ', 142.245, 123.486, 121.894]]
[['A', ' CA ', 138.811, 125.039, 123.371]]
[['A', ' CA ', 137.809, 124.889, 119.566]]
[['A', ' CA ', 138.086, 128.594, 118.191]]
[['A', ' CA ', 139.087, 127.442, 114.471]]
[['A', ' CA ', 143.136, 128.732, 113.637]]
[['A', ' CA ', 143.11, 129.478, 109.438]]
[['A', ' CA ', 147.251, 129.772, 108.909]]
[['A', ' CA ', 147.572, 130.245, 104.696]]
[['A', ' CA ', 151.33, 130.284, 103.734]]
[['A', ' CA ', 151.663, 130.957, 99.756]]
[['A', ' CA ', 152.921, 127.636, 98.387]]
[['A', ' CA ', 154.884, 127.871, 94.819]]
[['A', ' CA ', 151.306, 128.205, 92.972]]
[['A', ' CA ', 149.282, 130.401, 95.413]]
[['A', ' CA ', 147.859, 130.883, 98.977]]
[['A', ' CA ', 146.995, 127.472, 100.62]]
[['A', ' CA ', 145.148, 128.684, 103.579]]
[['A', ' CA ', 143.601, 125.273, 105.62]]
[['A', ' CA ', 141.77, 126.558, 108.954]]
[['A', ' CA ', 140.818, 123.51, 111.319]]
[['A', ' CA ', 139.48, 124.192, 115.135]]
[['A', ' CA ', 140.639, 120.959, 117.62]]
[['A', ' CA ', 138.608, 121.254, 120.857]]
[['A', ' CA ', 139.087, 118.096, 123.273]]
[['A', ' CA ', 143.041, 116.762, 122.213]]
[['A', ' CA ', 141.653, 115.675, 118.068]]
[['A', ' CA ', 140.577, 118.343, 115.468]]
[['A', ' CA ', 136.562, 118.19, 115.005]]
[['A', ' CA ', 136.631, 120.189, 111.253]]
[['A', ' CA ', 140.128, 121.026, 109.265]]
[['A', ' CA ', 139.099, 122.055, 105.55]]
[['A', ' CA ', 142.192, 123.26, 103.514]]
[['A', ' CA ', 141.603, 125.124, 99.99]]
[['A', ' CA ', 144.963, 124.998, 98.488]]
[['A', ' CA ', 145.808, 127.543, 95.868]]
[['A', ' CA ', 145.082, 125.29, 92.438]]
[['A', ' CA ', 141.414, 124.777, 93.617]]
[['A', ' CA ', 140.608, 128.677, 93.256]]
[['A', ' CA ', 142.587, 129.071, 89.661]]
[['A', ' CA ', 140.72, 125.726, 88.524]]
[['A', ' CA ', 137.182, 127.396, 87.723]]
[['A', ' CA ', 139.195, 131.051, 86.099]]
[['A', ' CA ', 141.859, 128.598, 83.677]]
[['A', ' CA ', 138.714, 126.797, 81.884]]
[['A', ' CA ', 136.589, 129.97, 81.083]]
[['A', ' CA ', 140.625, 132.422, 80.142]]
[['A', ' CA ', 141.289, 129.463, 77.019]]
[['A', ' CA ', 137.411, 130.996, 75.351]]
[['A', ' CA ', 138.238, 133.893, 72.426]]
[['A', ' CA ', 141.609, 132.181, 70.567]]
[['A', ' CA ', 142.1, 128.596, 68.586]]
[['A', ' CA ', 141.434, 125.608, 71.285]]
[['A', ' CA ', 145.694, 124.017, 70.651]]
[['A', ' CA ', 146.975, 127.419, 73.051]]
[['A', ' CA ', 143.637, 127.141, 75.341]]
[['A', ' CA ', 145.689, 123.819, 76.898]]
[['A', ' CA ', 149.432, 125.96, 77.376]]
[['A', ' CA ', 147.235, 129.288, 79.378]]
[['A', ' CA ', 145.855, 126.18, 81.997]]
[['A', ' CA ', 149.963, 124.507, 82.001]]
[['A', ' CA ', 151.237, 128.383, 82.676]]
[['A', ' CA ', 149.088, 128.393, 85.944]]
[['A', ' CA ', 151.146, 125.187, 86.833]]
[['A', ' CA ', 148.13, 123.253, 88.069]]
[['A', ' CA ', 148.825, 120.735, 90.822]]
[['A', ' CA ', 145.446, 118.726, 90.69]]
[['A', ' CA ', 146.109, 116.306, 93.604]]
[['A', ' CA ', 146.035, 119.543, 95.859]]
[['A', ' CA ', 142.914, 120.99, 94.047]]
[['A', ' CA ', 140.847, 117.736, 94.761]]
[['A', ' CA ', 142.148, 119.148, 99.634]]
[['A', ' CA ', 129.601, 123.821, 67.819]] AA_SCO= 1.7819999999999996 CA_SCO= -0.032499999999999994
[['A', ' CA ', 131.684, 120.458, 68.483]] AA_SCO= 1.887272727272727 CA_SCO= -0.028363636363636358
[['A', ' CA ', 133.22, 120.582, 72.165]] AA_SCO= 1.9474999999999998 CA_SCO= -0.02466666666666666
[['A', ' CA ', 136.707, 118.774, 71.884]] AA_SCO= 1.7792307692307692 CA_SCO= -0.03915384615384614
[['A', ' CA ', 137.538, 117.526, 75.757]] AA_SCO= 1.8478571428571426 CA_SCO= -0.05921428571428571
[['A', ' CA ', 141.271, 116.194, 76.008]] AA_SCO= 1.924 CA_SCO= -0.05706666666666667
[['A', ' CA ', 141.449, 114.049, 79.448]] AA_SCO= 1.851875 CA_SCO= -0.055125
[['A', ' CA ', 144.979, 113.508, 80.689]] AA_SCO= 1.8523529411764705 CA_SCO= -0.049823529411764704
[['A', ' CA ', 145.794, 117.064, 80.801]] AA_SCO= 1.8999999999999997 CA_SCO= -0.0445
[['A', ' CA ', 149.613, 116.84, 79.485]] AA_SCO= 1.933157894736842 CA_SCO= -0.03889473684210526
[['A', ' CA ', 152.687, 117.833, 81.544]] AA_SCO= 2.121578947368421 CA_SCO= -0.004684210526315791
[['A', ' CA ', 150.93, 119.018, 84.963]] AA_SCO= 2.192105263157895 CA_SCO= -0.004052631578947372
[['A', ' CA ', 150.352, 116.895, 88.161]] AA_SCO= 2.121052631578947 CA_SCO= -0.008684210526315789
[['A', ' CA ', 147.584, 114.82, 88.696]] AA_SCO= 2.0752631578947365 CA_SCO= -0.014315789473684214
[['A', ' CA ', 143.911, 114.471, 86.655]] AA_SCO= 2.0426315789473684 CA_SCO= -0.05057894736842106
[['A', ' CA ', 141.856, 117.331, 84.938]] AA_SCO= 1.9789473684210528 CA_SCO= -0.05673684210526316
[['A', ' CA ', 140.277, 117.332, 81.377]] AA_SCO= 2.053157894736842 CA_SCO= -0.04978947368421052
[['A', ' CA ', 139.254, 120.913, 79.948]] AA_SCO= 1.9836842105263157 CA_SCO= -0.06568421052631578
[['A', ' CA ', 136.248, 120.221, 77.37]] AA_SCO= 2.0194736842105256 CA_SCO= -0.06405263157894736
[['A', ' CA ', 136.178, 123.671, 75.373]] AA_SCO= 1.9989473684210524 CA_SCO= -0.061842105263157886
[['A', ' CA ', 133.206, 123.831, 72.579]] AA_SCO= 1.963157894736842 CA_SCO= -0.06263157894736843
[['A', ' CA ', 134.763, 125.827, 69.851]] AA_SCO= 1.8831578947368421 CA_SCO= -0.060578947368421045
[['A', ' CA ', 132.521, 127.35, 67.06]] AA_SCO= 2.0531578947368425 CA_SCO= -0.046210526315789466
[['A', ' CA ', 133.032, 127.851, 61.944]] AA_SCO= 2.093684210526316 CA_SCO= -0.02799999999999999
[['A', ' CA ', 136.797, 128.341, 62.575]] AA_SCO= 2.121578947368421 CA_SCO= -0.026052631578947362
[['A', ' CA ', 137.869, 126.038, 65.861]] AA_SCO= 2.132631578947368 CA_SCO= -0.02373684210526315
[['A', ' CA ', 138.347, 129.666, 68.551]] AA_SCO= 2.161052631578947 CA_SCO= -0.02663157894736841
[['A', ' CA ', 136.775, 128.067, 71.709]] AA_SCO= 2.1352631578947365 CA_SCO= -0.02699999999999999
[['A', ' CA ', 133.844, 130.716, 72.63]] AA_SCO= 2.173684210526315 CA_SCO= -0.033368421052631575
[['A', ' CA ', 133.303, 128.738, 76.86]] AA_SCO= 2.0989473684210522 CA_SCO= -0.03394736842105263
[['A', ' CA ', 135.943, 125.883, 77.734]] AA_SCO= 2.1347368421052626 CA_SCO= -0.033999999999999975
[['A', ' CA ', 135.709, 124.822, 81.805]] AA_SCO= 2.167368421052631 CA_SCO= -0.03321052631578946
[['A', ' CA ', 138.578, 122.893, 83.036]] AA_SCO= 2.231052631578947 CA_SCO= -0.027789473684210517
[['A', ' CA ', 137.409, 120.639, 85.849]] AA_SCO= 2.2405263157894733 CA_SCO= 0.010105263157894735
[['A', ' CA ', 139.072, 118.019, 88.15]] AA_SCO= 2.30578947368421 CA_SCO= 0.016684210526315787
[['A', ' CA ', 138.799, 114.326, 87.36]] AA_SCO= 2.36 CA_SCO= 0.015315789473684213
[['A', ' CA ', 140.842, 113.147, 90.182]] AA_SCO= 2.3905263157894736 CA_SCO= 0.03210526315789474
[['A', ' CA ', 139.878, 110.495, 92.706]] AA_SCO= 2.3636842105263156 CA_SCO= 0.03210526315789474
[['A', ' CA ', 138.931, 112.071, 96.06]] AA_SCO= 2.36 CA_SCO= 0.03163157894736842
[['A', ' CA ', 141.521, 111.013, 98.751]] AA_SCO= 2.3905263157894736 CA_SCO= 0.035
[['A', ' CA ', 138.794, 112.387, 101.694]] AA_SCO= 2.450526315789473 CA_SCO= 0.027631578947368427
[['A', ' CA ', 142.208, 113.906, 103.487]] AA_SCO= 2.4510526315789476 CA_SCO= 0.024684210526315784
[['A', ' CA ', 140.681, 116.978, 105.645]] AA_SCO= 2.378421052631579 CA_SCO= 0.026578947368421053
[['A', ' CA ', 137.342, 114.269, 107.075]] AA_SCO= 2.202105263157895 CA_SCO= 0.029315789473684208
[['A', ' CA ', 140.22, 111.176, 107.677]] AA_SCO= 2.267894736842105 CA_SCO= 0.031473684210526306
[['A', ' CA ', 142.649, 113.918, 110.074]] AA_SCO= 2.2989473684210524 CA_SCO= 0.03205263157894736
[['A', ' CA ', 138.967, 115.835, 111.58]] AA_SCO= 2.303684210526316 CA_SCO= 0.033210526315789475
[['A', ' CA ', 137.946, 112.753, 114.296]] AA_SCO= 2.2794736842105263 CA_SCO= 0.03905263157894737
[['A', ' CA ', 142.292, 111.89, 115.034]] AA_SCO= 2.2315789473684213 CA_SCO= 0.03952631578947369
[['A', ' CA ', 144.543, 114.21, 117.445]] AA_SCO= 2.2142105263157896 CA_SCO= 0.0366842105263158
[['A', ' CA ', 146.284, 117.28, 115.652]] AA_SCO= 2.237894736842105 CA_SCO= 0.039157894736842114
[['A', ' CA ', 150.304, 115.852, 115.149]] AA_SCO= 2.2694736842105265 CA_SCO= 0.03415789473684211
[['A', ' CA ', 148.927, 113.067, 112.427]] AA_SCO= 2.4 CA_SCO= 0.03373684210526316
[['A', ' CA ', 146.827, 116.198, 110.296]] AA_SCO= 2.4026315789473687 CA_SCO= -0.0032105263157894705
[['A', ' CA ', 150.412, 118.14, 109.488]] AA_SCO= 2.2910526315789475 CA_SCO= -0.012631578947368424
[['A', ' CA ', 151.87, 114.332, 107.777]] AA_SCO= 2.33578947368421 CA_SCO= -0.014631578947368423
[['A', ' CA ', 148.571, 113.046, 105.95]] AA_SCO= 2.3789473684210525 CA_SCO= -0.01684210526315789
[['A', ' CA ', 147.779, 116.864, 104.881]] AA_SCO= 2.3989473684210525 CA_SCO= -0.017842105263157892
[['A', ' CA ', 151.667, 116.856, 103.514]] AA_SCO= 2.3684210526315788 CA_SCO= -0.01889473684210526
[['A', ' CA ', 150.814, 113.83, 101.395]] AA_SCO= 2.44578947368421 CA_SCO= -0.011736842105263157
[['A', ' CA ', 148.078, 115.919, 99.308]] AA_SCO= 2.4142105263157894 CA_SCO= -0.008684210526315789
[['A', ' CA ', 150.757, 116.524, 96.806]] AA_SCO= 2.4257894736842105 CA_SCO= -0.008947368421052634
[['A', ' CA ', 154.299, 115.472, 96.505]] AA_SCO= 2.5100000000000002 CA_SCO= -0.021
[['A', ' CA ', 155.317, 118.632, 94.384]] AA_SCO= 2.3747368421052633 CA_SCO= -0.020842105263157898
[['A', ' CA ', 153.81, 121.142, 97.275]] AA_SCO= 2.352105263157895 CA_SCO= -0.01705263157894737
[['A', ' CA ', 154.172, 119.178, 100.81]] AA_SCO= 2.3647368421052635 CA_SCO= -0.01710526315789473
[['A', ' CA ', 156.378, 121.914, 102.787]] AA_SCO= 2.3184210526315794 CA_SCO= -0.02126315789473684
[['A', ' CA ', 153.654, 124.532, 101.996]] AA_SCO= 2.3826315789473687 CA_SCO= -0.023526315789473676
[['A', ' CA ', 150.571, 122.316, 103.437]] AA_SCO= 2.2721052631578944 CA_SCO= -0.02831578947368421
[['A', ' CA ', 152.517, 120.867, 106.562]] AA_SCO= 2.245263157894737 CA_SCO= -0.030210526315789465
[['A', ' CA ', 153.552, 124.361, 107.922]] AA_SCO= 2.222105263157894 CA_SCO= -0.0258421052631579
[['A', ' CA ', 149.817, 126.099, 106.873]] AA_SCO= 2.127894736842105 CA_SCO= -0.027315789473684206
[['A', ' CA ', 147.764, 122.669, 108.728]] AA_SCO= 2.117368421052632 CA_SCO= 0.009473684210526315
[['A', ' CA ', 150.489, 122.711, 112.152]] AA_SCO= 2.0357894736842104 CA_SCO= 0.020578947368421047
[['A', ' CA ', 150.407, 127.428, 112.044]] AA_SCO= 1.928947368421053 CA_SCO= 0.020105263157894734
[['A', ' CA ', 146.344, 126.698, 111.668]] AA_SCO= 1.8615789473684212 CA_SCO= 0.02221052631578947
[['A', ' CA ', 145.935, 123.715, 114.553]] AA_SCO= 1.9563157894736842 CA_SCO= 0.024052631578947364
[['A', ' CA ', 149.707, 126.698, 116.716]] AA_SCO= 1.9142105263157894 CA_SCO= 0.023210526315789473
[['A', ' CA ', 146.597, 129.791, 115.987]] AA_SCO= 1.8463157894736841 CA_SCO= 0.02368421052631579
[['A', ' CA ', 142.859, 127.296, 117.463]] AA_SCO= 1.8594736842105262 CA_SCO= 0.021157894736842108
[['A', ' CA ', 145.161, 126.078, 120.736]] AA_SCO= 1.891578947368421 CA_SCO= 0.02142105263157895
[['A', ' CA ', 147.676, 129.886, 120.449]] AA_SCO= 1.9236842105263157 CA_SCO= 0.03347368421052632
[['A', ' CA ', 151.383, 128.329, 120.965]] AA_SCO= 2.0857894736842106 CA_SCO= 0.03347368421052632
[['A', ' CA ', 153.546, 131.561, 119.624]] AA_SCO= 2.1010526315789475 CA_SCO= 0.03063157894736842
[['A', ' CA ', 156.772, 129.21, 118.057]] AA_SCO= 1.8842105263157893 CA_SCO= 0.03057894736842105
[['A', ' CA ', 160.092, 131.316, 119.245]] AA_SCO= 1.888421052631579 CA_SCO= 0.03526315789473685
[['A', ' CA ', 161.478, 133.195, 116.01]] AA_SCO= 1.767368421052632 CA_SCO= 0.03331578947368421
[['A', ' CA ', 164.629, 130.886, 114.598]] AA_SCO= 1.8694736842105264 CA_SCO= 0.04100000000000001
[['A', ' CA ', 161.203, 127.482, 114.309]] AA_SCO= 1.8631578947368421 CA_SCO= 0.04263157894736844
[['A', ' CA ', 158.969, 130.689, 112.108]] AA_SCO= 1.9078947368421053 CA_SCO= 0.04336842105263159
[['A', ' CA ', 162.7, 132.116, 109.894]] AA_SCO= 1.734736842105263 CA_SCO= 0.045052631578947386
[['A', ' CA ', 164.243, 127.79, 109.393]] AA_SCO= 1.784736842105263 CA_SCO= 0.045105263157894745
[['A', ' CA ', 159.876, 126.694, 108.209]] AA_SCO= 1.7721052631578944 CA_SCO= 0.04273684210526316
[['A', ' CA ', 159.839, 130.651, 105.739]] AA_SCO= 1.8531578947368417 CA_SCO= 0.04436842105263159
[['A', ' CA ', 163.906, 129.385, 104.517]] AA_SCO= 1.8668421052631574 CA_SCO= 0.04326315789473686
[['A', ' CA ', 162.481, 125.651, 103.785]] AA_SCO= 1.7999999999999998 CA_SCO= 0.041263157894736856
[['A', ' CA ', 159.025, 126.897, 101.911]] AA_SCO= 1.8378947368421052 CA_SCO= 0.03400000000000001
[['A', ' CA ', 161.092, 129.953, 99.973]] AA_SCO= 1.8563157894736844 CA_SCO= 0.03373684210526317
[['A', ' CA ', 164.337, 127.097, 98.826]] AA_SCO= 1.8363157894736846 CA_SCO= 0.03626315789473686
[['A', ' CA ', 160.911, 124.197, 98.139]] AA_SCO= 1.8368421052631583 CA_SCO= 0.036105263157894744
[['A', ' CA ', 159.037, 127.623, 95.904]] AA_SCO= 1.8710526315789475 CA_SCO= 0.036105263157894744
[['A', ' CA ', 162.536, 127.683, 93.678]] AA_SCO= 1.8689473684210525 CA_SCO= 0.036105263157894744
[['A', ' CA ', 162.806, 123.299, 93.528]] AA_SCO= 1.8289473684210527 CA_SCO= 0.038526315789473686
[['A', ' CA ', 158.591, 123.278, 92.669]] AA_SCO= 2.0352631578947364 CA_SCO= 0.03789473684210527
[['A', ' CA ', 158.621, 126.22, 89.937]] AA_SCO= 2.0794736842105257 CA_SCO= 0.03773684210526316
[['A', ' CA ', 162.176, 124.681, 88.485]] AA_SCO= 2.1763157894736844 CA_SCO= 0.03715789473684211
[['A', ' CA ', 160.312, 120.681, 88.291]] AA_SCO= 2.1947368421052627 CA_SCO= 0.03426315789473684
[['A', ' CA ', 156.964, 122.853, 86.527]] AA_SCO= 2.0989473684210527 CA_SCO= 0.03331578947368421
[['A', ' CA ', 159.904, 124.932, 83.794]] AA_SCO= 2.139473684210526 CA_SCO= 0.033210526315789475
[['A', ' CA ', 161.418, 120.982, 83.085]] AA_SCO= 2.2815789473684216 CA_SCO= 0.03368421052631578
[['A', ' CA ', 157.519, 119.697, 82.362]] AA_SCO= 2.2068421052631577 CA_SCO= 0.029578947368421055
[['A', ' CA ', 155.953, 122.996, 80.541]] AA_SCO= 2.1910526315789474 CA_SCO= 0.031947368421052634
[['A', ' CA ', 159.869, 123.786, 78.917]] AA_SCO= 2.0826315789473684 CA_SCO= 0.03278947368421053
[['A', ' CA ', 159.987, 120.064, 76.768]] AA_SCO= 1.934736842105263 CA_SCO= 0.033947368421052636
[['A', ' CA ', 157.022, 122.257, 74.028]] AA_SCO= 1.9373684210526316 CA_SCO= 0.025947368421052632
[['A', ' CA ', 158.873, 126.272, 74.828]] AA_SCO= 1.9421052631578946 CA_SCO= 0.035
[['A', ' CA ', 162.787, 125.084, 74.941]] AA_SCO= 1.934736842105263 CA_SCO= 0.03536842105263158
[['A', ' CA ', 163.451, 123.584, 71.15]] AA_SCO= 1.8726315789473684 CA_SCO= 0.028999999999999998
[['A', ' CA ', 164.96, 119.77, 72.195]] AA_SCO= 1.8173684210526317 CA_SCO= 0.019842105263157894
[['A', ' CA ', 169.396, 120.562, 71.428]] AA_SCO= 1.7542105263157894 CA_SCO= 0.019842105263157894
[['A', ' CA ', 169.723, 123.321, 74.926]] AA_SCO= 1.736315789473684 CA_SCO= 0.019842105263157897
[['A', ' CA ', 166.086, 121.053, 76.719]] AA_SCO= 1.7584210526315787 CA_SCO= 0.019052631578947366
[['A', ' CA ', 169.007, 118.107, 78.081]] AA_SCO= 1.771052631578947 CA_SCO= 0.019736842105263157
[['A', ' CA ', 171.61, 121.166, 79.498]] AA_SCO= 1.777368421052631 CA_SCO= 0.019894736842105264
[['A', ' CA ', 168.036, 123.607, 80.543]] AA_SCO= 1.7989473684210522 CA_SCO= 0.024473684210526314
[['A', ' CA ', 166.273, 119.85, 82.792]] AA_SCO= 1.6205263157894734 CA_SCO= 0.026473684210526316
[['A', ' CA ', 170.155, 119.21, 84.168]] AA_SCO= 1.7221052631578946 CA_SCO= 0.029052631578947365
[['A', ' CA ', 170.662, 123.644, 85.145]] AA_SCO= 1.7099999999999997 CA_SCO= 0.029263157894736845
[['A', ' CA ', 166.475, 123.258, 86.985]] AA_SCO= 1.7999999999999998 CA_SCO= 0.029263157894736838
[['A', ' CA ', 167.786, 119.27, 88.727]] AA_SCO= 1.8168421052631576 CA_SCO= 0.03347368421052632
[['A', ' CA ', 171.566, 121.165, 89.935]] AA_SCO= 1.9789473684210523 CA_SCO= 0.03321052631578948
[['A', ' CA ', 169.066, 124.701, 91.423]] AA_SCO= 2.021578947368421 CA_SCO= 0.033210526315789475
[['A', ' CA ', 166.105, 122.014, 92.895]] AA_SCO= 2.2457894736842103 CA_SCO= 0.03326315789473685
[['A', ' CA ', 169.463, 118.861, 94.339]] AA_SCO= 2.269473684210526 CA_SCO= 0.043263157894736844
[['A', ' CA ', 171.176, 122.372, 96.468]] AA_SCO= 2.2563157894736845 CA_SCO= 0.04321052631578947
[['A', ' CA ', 167.499, 124.307, 97.488]] AA_SCO= 2.254210526315789 CA_SCO= 0.03421052631578948
[['A', ' CA ', 166.021, 120.222, 98.596]] AA_SCO= 2.2642105263157895 CA_SCO= 0.036368421052631585
[['A', ' CA ', 169.573, 119.553, 100.74]] AA_SCO= 2.290526315789474 CA_SCO= 0.031000000000000003
[['A', ' CA ', 168.515, 123.423, 102.987]] AA_SCO= 2.3057894736842104 CA_SCO= 0.02573684210526316
[['A', ' CA ', 164.214, 121.799, 103.097]] AA_SCO= 2.377368421052631 CA_SCO= 0.02457894736842106
[['A', ' CA ', 165.66, 117.857, 103.753]] AA_SCO= 2.409473684210526 CA_SCO= 0.021105263157894745
[['A', ' CA ', 168.796, 119.209, 106.542]] AA_SCO= 2.3973684210526316 CA_SCO= 0.01915789473684211
[['A', ' CA ', 165.969, 121.954, 107.862]] AA_SCO= 2.3099999999999996 CA_SCO= 0.011157894736842108
[['A', ' CA ', 162.704, 119.814, 107.938]] AA_SCO= 2.3094736842105266 CA_SCO= 0.011473684210526315
[['A', ' CA ', 163.975, 115.891, 107.754]] AA_SCO= 2.4794736842105265 CA_SCO= 0.01236842105263158
[['A', ' CA ', 163.861, 114.935, 103.739]] AA_SCO= 2.488421052631579 CA_SCO= 0.01
[['A', ' CA ', 162.758, 117.099, 100.832]] AA_SCO= 2.460526315789474 CA_SCO= -0.024842105263157895
[['A', ' CA ', 159.746, 115.382, 99.478]] AA_SCO= 2.437894736842105 CA_SCO= -0.04184210526315789
[['A', ' CA ', 157.522, 114.929, 102.507]] AA_SCO= 2.4557894736842103 CA_SCO= -0.04663157894736842
[['A', ' CA ', 158.964, 117.006, 105.366]] AA_SCO= 2.401578947368421 CA_SCO= -0.053947368421052626
[['A', ' CA ', 158.572, 115.207, 108.84]] AA_SCO= 2.3957894736842102 CA_SCO= -0.056368421052631575
[['A', ' CA ', 160.583, 117.568, 111.587]] AA_SCO= 2.369473684210526 CA_SCO= -0.056842105263157895
[['A', ' CA ', 158.217, 121.234, 111.107]] AA_SCO= 2.372105263157895 CA_SCO= -0.05863157894736842
[['A', ' CA ', 155.646, 119.209, 113.573]] AA_SCO= 2.3721052631578954 CA_SCO= -0.0584736842105263
[['A', ' CA ', 153.083, 122.016, 115.515]] AA_SCO= 2.3442105263157895 CA_SCO= -0.05394736842105261
[['A', ' CA ', 155.001, 124.921, 117.982]] AA_SCO= 2.3926315789473684 CA_SCO= -0.060578947368421045
[['A', ' CA ', 157.371, 125.13, 115.447]] AA_SCO= 2.381052631578948 CA_SCO= -0.04647368421052631
[['A', ' CA ', 160.212, 123.054, 114.52]] AA_SCO= 2.4231578947368426 CA_SCO= -0.041421052631578935
[['A', ' CA ', 161.549, 119.946, 115.627]] AA_SCO= 2.3452631578947374 CA_SCO= -0.040263157894736834
[['A', ' CA ', 165.212, 120.198, 115.983]] AA_SCO= 2.345789473684211 CA_SCO= -0.03810526315789473
[['A', ' CA ', 167.081, 123.643, 114.504]] AA_SCO= 2.36421052631579 CA_SCO= -0.036105263157894724
[['A', ' CA ', 170.252, 122.732, 112.185]] AA_SCO= 2.470526315789474 CA_SCO= -0.028105263157894727
[['A', ' CA ', 173.931, 123.043, 114.285]] AA_SCO= 2.4563157894736847 CA_SCO= -0.028105263157894727
[['A', ' CA ', 175.815, 126.174, 112.677]] AA_SCO= 2.432105263157895 CA_SCO= -0.028105263157894717
[['A', ' CA ', 178.663, 123.413, 110.012]] AA_SCO= 2.4394736842105265 CA_SCO= -0.025684210526315768
[['A', ' CA ', 174.867, 122.353, 108.024]] AA_SCO= 2.4547368421052633 CA_SCO= 0.009210526315789473
[['A', ' CA ', 173.361, 126.453, 108.253]] AA_SCO= 2.464736842105263 CA_SCO= 0.02636842105263158
[['A', ' CA ', 177.126, 128.157, 106.804]] AA_SCO= 2.4715789473684207 CA_SCO= 0.03115789473684211
[['A', ' CA ', 177.863, 124.559, 104.433]] AA_SCO= 2.537894736842105 CA_SCO= 0.03873684210526317
[['A', ' CA ', 173.699, 124.875, 102.676]] AA_SCO= 2.5936842105263156 CA_SCO= 0.041157894736842116
[['A', ' CA ', 174.013, 129.366, 103.036]] AA_SCO= 2.560526315789473 CA_SCO= 0.041157894736842116
[['A', ' CA ', 177.788, 129.05, 100.899]] AA_SCO= 2.5599999999999996 CA_SCO= 0.04294736842105264
[['A', ' CA ', 176.3, 126.083, 98.145]] AA_SCO= 2.6089473684210525 CA_SCO= 0.04294736842105264
[['A', ' CA ', 172.476, 128.323, 97.737]] AA_SCO= 2.5873684210526315 CA_SCO= 0.04400000000000001
[['A', ' CA ', 174.45, 132.4, 97.455]] AA_SCO= 2.6573684210526314 CA_SCO= 0.054631578947368434
[['A', ' CA ', 177.603, 130.241, 94.681]] AA_SCO= 2.6731578947368417 CA_SCO= 0.05510526315789475
[['A', ' CA ', 173.663, 128.324, 92.823]] AA_SCO= 2.642631578947368 CA_SCO= 0.05515789473684211
[['A', ' CA ', 171.616, 132.384, 93.14]] AA_SCO= 2.532631578947368 CA_SCO= 0.055105263157894734
[['A', ' CA ', 174.509, 133.523, 89.874]] AA_SCO= 2.528947368421053 CA_SCO= 0.057578947368421056
[['A', ' CA ', 173.311, 129.765, 87.483]] AA_SCO= 2.527894736842106 CA_SCO= 0.05668421052631579
[['A', ' CA ', 169.014, 129.893, 89.067]] AA_SCO= 2.491052631578947 CA_SCO= 0.056
[['A', ' CA ', 169.088, 134.275, 87.952]] AA_SCO= 2.426842105263159 CA_SCO= 0.05310526315789473
[['A', ' CA ', 171.31, 133.091, 84.263]] AA_SCO= 2.442105263157895 CA_SCO= 0.05294736842105263
[['A', ' CA ', 168.273, 129.715, 83.622]] AA_SCO= 2.4289473684210527 CA_SCO= 0.05263157894736842
[['A', ' CA ', 164.946, 132.198, 84.897]] AA_SCO= 2.353157894736842 CA_SCO= 0.052000000000000005
[['A', ' CA ', 166.474, 135.547, 82.317]] AA_SCO= 2.3136842105263153 CA_SCO= 0.05157894736842106
[['A', ' CA ', 167.202, 132.229, 79.054]] AA_SCO= 2.2994736842105263 CA_SCO= 0.03310526315789475
[['A', ' CA ', 163.531, 130.559, 80.149]] AA_SCO= 2.296315789473684 CA_SCO= 0.029842105263157902
[['A', ' CA ', 161.497, 134.37, 80.32]] AA_SCO= 2.3310526315789475 CA_SCO= 0.02889473684210527
[['A', ' CA ', 164.574, 135.522, 76.626]] AA_SCO= 2.2368421052631584 CA_SCO= 0.02494736842105264
[['A', ' CA ', 162.821, 131.539, 74.946]] AA_SCO= 2.22421052631579 CA_SCO= 0.011947368421052639
[['A', ' CA ', 158.414, 131.612, 76.283]] AA_SCO= 2.1984210526315793 CA_SCO= 0.010210526315789479
[['A', ' CA ', 158.391, 135.845, 75.493]] AA_SCO= 2.2563157894736845 CA_SCO= 0.009052631578947373
[['A', ' CA ', 160.461, 134.633, 71.397]] AA_SCO= 2.2042105263157894 CA_SCO= -0.004947368421052628
[['A', ' CA ', 157.613, 131.285, 70.814]] AA_SCO= 2.090526315789474 CA_SCO= -0.006052631578947367
[['A', ' CA ', 154.981, 134.739, 70.811]] AA_SCO= 2.0526315789473686 CA_SCO= -0.006052631578947369
[['A', ' CA ', 151.787, 132.793, 71.664]] AA_SCO= 2.116842105263158 CA_SCO= -0.005999999999999998
[['A', ' CA ', 149.377, 135.432, 70.219]] AA_SCO= 2.039473684210526 CA_SCO= -0.005999999999999999
[['A', ' CA ', 149.509, 138.268, 72.872]] AA_SCO= 2.0173684210526317 CA_SCO= -0.005157894736842107
[['A', ' CA ', 146.244, 138.909, 74.933]] AA_SCO= 2.023684210526316 CA_SCO= -0.004578947368421054
[['A', ' CA ', 145.855, 134.801, 75.627]] AA_SCO= 2.0784210526315796 CA_SCO= -0.0063684210526315805
[['A', ' CA ', 144.79, 133.96, 79.183]] AA_SCO= 1.9610526315789476 CA_SCO= -0.03215789473684211
[['A', ' CA ', 143.792, 137.69, 80.142]] AA_SCO= 2.0078947368421054 CA_SCO= -0.03526315789473684
[['A', ' CA ', 140.545, 137.181, 82.029]] AA_SCO= 2.024736842105263 CA_SCO= -0.036421052631578944
[['A', ' CA ', 139.753, 140.39, 84.554]] AA_SCO= 2.033684210526316 CA_SCO= -0.03826315789473684
[['A', ' CA ', 138.446, 138.028, 87.848]] AA_SCO= 2.0763157894736843 CA_SCO= -0.02521052631578947
[['A', ' CA ', 140.587, 139.648, 90.592]] AA_SCO= 2.08 CA_SCO= -0.034999999999999996
[['A', ' CA ', 144.097, 137.992, 91.699]] AA_SCO= 1.9463157894736844 CA_SCO= -0.0438421052631579
[['A', ' CA ', 144.883, 136.157, 95.065]] AA_SCO= 2.076315789473684 CA_SCO= -0.0428421052631579
[['A', ' CA ', 147.857, 137.277, 97.463]] AA_SCO= 1.9789473684210528 CA_SCO= -0.03431578947368421
[['A', ' CA ', 148.174, 137.821, 101.204]] AA_SCO= 1.9826315789473685 CA_SCO= -0.03689473684210526
[['A', ' CA ', 152.6, 138.285, 101.459]] AA_SCO= 2.024736842105263 CA_SCO= -0.032736842105263154
[['A', ' CA ', 154.976, 137.958, 98.661]] AA_SCO= 2.0178947368421047 CA_SCO= -0.019210526315789477
[['A', ' CA ', 156.646, 133.869, 99.932]] AA_SCO= 2.130526315789473 CA_SCO= -0.021263157894736845
[['A', ' CA ', 155.067, 133.134, 103.764]] AA_SCO= 1.987368421052631 CA_SCO= -0.024736842105263158
[['A', ' CA ', 151.731, 133.714, 104.509]] AA_SCO= 2.0852631578947367 CA_SCO= -0.027
[['A', ' CA ', 150.242, 136.194, 106.892]] AA_SCO= 2.187894736842105 CA_SCO= -0.02763157894736841
[['A', ' CA ', 146.511, 134.873, 107.72]] AA_SCO= 2.11578947368421 CA_SCO= -0.03157894736842105
[['A', ' CA ', 144.729, 138.721, 109.076]] AA_SCO= 1.9889473684210521 CA_SCO= -0.034052631578947355
[['A', ' CA ', 145.042, 140.124, 104.993]] AA_SCO= 1.9573684210526314 CA_SCO= -0.029473684210526308
[['A', ' CA ', 142.992, 136.361, 103.793]] AA_SCO= 1.916315789473684 CA_SCO= -0.008052631578947372
[['A', ' CA ', 139.797, 138.008, 105.789]] AA_SCO= 1.892631578947368 CA_SCO= -0.010842105263157898
[['A', ' CA ', 137.396, 134.825, 105.831]] AA_SCO= 1.9026315789473685 CA_SCO= -0.009105263157894738
[['A', ' CA ', 133.642, 136.855, 105.963]] AA_SCO= 1.8194736842105264 CA_SCO= -0.007000000000000004
[['A', ' CA ', 134.69, 137.961, 101.945]] AA_SCO= 1.9184210526315788 CA_SCO= -0.002789473684210529
[['A', ' CA ', 135.555, 133.813, 101.733]] AA_SCO= 1.9505263157894734 CA_SCO= 0.009947368421052632
[['A', ' CA ', 133.046, 131.662, 99.536]] AA_SCO= 2.0273684210526315 CA_SCO= 0.0037894736842105266
[['A', ' CA ', 132.131, 127.851, 99.618]] AA_SCO= 1.9652631578947366 CA_SCO= -0.0012105263157894733
[['A', ' CA ', 131.053, 127.033, 95.788]] AA_SCO= 2.0763157894736843 CA_SCO= -0.004684210526315788
[['A', ' CA ', 130.44, 123.205, 95.042]] AA_SCO= 2.076842105263158 CA_SCO= -0.0007894736842105266
[['A', ' CA ', 130.997, 122.851, 91.507]] AA_SCO= 2.0242105263157897 CA_SCO= -0.004105263157894737
[['A', ' CA ', 127.277, 121.351, 90.291]] AA_SCO= 2.0105263157894733 CA_SCO= -0.003578947368421053
[['A', ' CA ', 125.756, 125.331, 91.04]] AA_SCO= 1.8326315789473684 CA_SCO= -0.0004736842105263162
[['A', ' CA ', 129.443, 127.129, 89.055]] AA_SCO= 2.0594736842105266 CA_SCO= 0.0030000000000000005
[['A', ' CA ', 129.226, 124.537, 85.682]] AA_SCO= 2.0015789473684213 CA_SCO= 0.005157894736842104
[['A', ' CA ', 125.763, 124.856, 83.915]] AA_SCO= 1.7847368421052634 CA_SCO= -0.0010526315789473708
[['A', ' CA ', 125.662, 121.398, 82.11]] AA_SCO= 1.763684210526316 CA_SCO= 0.0026315789473684193
[['A', ' CA ', 124.841, 118.551, 85.581]] AA_SCO= 1.8584210526315794 CA_SCO= 0.005105263157894734
[['A', ' CA ', 127.108, 115.306, 83.903]] AA_SCO= 1.8847368421052633 CA_SCO= 0.00489473684210526
[['A', ' CA ', 130.951, 117.776, 83.882]] AA_SCO= 2.071578947368421 CA_SCO= 0.009210526315789471
[['A', ' CA ', 129.831, 119.408, 87.987]] AA_SCO= 2.0005263157894735 CA_SCO= 0.015421052631578943
[['A', ' CA ', 128.57, 115.572, 89.347]] AA_SCO= 2.015263157894737 CA_SCO= 0.015368421052631575
[['A', ' CA ', 132.237, 113.846, 87.31]] AA_SCO= 2.090526315789474 CA_SCO= 0.011473684210526315
[['A', ' CA ', 134.925, 116.909, 88.655]] AA_SCO= 1.9615789473684213 CA_SCO= 0.007842105263157892
[['A', ' CA ', 135.708, 116.503, 92.612]] AA_SCO= 1.9452631578947368 CA_SCO= 0.0037894736842105266
[['A', ' CA ', 136.797, 120.196, 93.314]] AA_SCO= 1.9763157894736845 CA_SCO= 0.012999999999999998
[['A', ' CA ', 134.827, 122.691, 95.483]] AA_SCO= 2.012631578947369 CA_SCO= 0.021210526315789468
[['A', ' CA ', 135.493, 126.305, 93.531]] AA_SCO= 2.0005263157894735 CA_SCO= 0.02226315789473683
[['A', ' CA ', 136.167, 128.514, 96.923]] AA_SCO= 1.9805263157894735 CA_SCO= 0.01447368421052631
[['A', ' CA ', 135.592, 132.209, 95.13]] AA_SCO= 1.9826315789473685 CA_SCO= 0.0026842105263157785
[['A', ' CA ', 136.715, 135.061, 97.925]] AA_SCO= 2.04 CA_SCO= -0.004368421052631585
[['A', ' CA ', 133.705, 137.856, 97.931]] AA_SCO= 2.2573684210526315 CA_SCO= -0.007894736842105267
[['A', ' CA ', 131.343, 135.507, 95.506]] AA_SCO= 2.215263157894737 CA_SCO= -0.008578947368421061
[['A', ' CA ', 133.946, 136.147, 91.925]] AA_SCO= 2.273157894736842 CA_SCO= -0.008578947368421054
[['A', ' CA ', 136.664, 133.428, 91.309]] AA_SCO= 2.4878947368421045 CA_SCO= -0.002368421052631586
[['A', ' CA ', 140.187, 133.875, 91.795]] AA_SCO= 2.597368421052631 CA_SCO= -0.0020526315789473697
[['A', ' CA ', 143.59, 133.215, 90.215]] AA_SCO= 2.603157894736842 CA_SCO= -0.0018947368421052678
[['A', ' CA ', 145.993, 133.385, 93.402]] AA_SCO= 2.657894736842105 CA_SCO= -0.001578947368421057
[['A', ' CA ', 149.47, 132.114, 91.731]] AA_SCO= 2.562105263157895 CA_SCO= -0.0021052631578947407
[['A', ' CA ', 153.038, 133.699, 92.042]] AA_SCO= 2.5505263157894738 CA_SCO= -0.013684210526315794
[['A', ' CA ', 152.374, 136.231, 89.087]] AA_SCO= 2.616842105263158 CA_SCO= -0.02521052631578948
[['A', ' CA ', 149.064, 137.769, 91.369]] AA_SCO= 2.6357894736842105 CA_SCO= -0.021421052631578952
[['A', ' CA ', 151.454, 137.672, 95.011]] AA_SCO= 2.5842105263157897 CA_SCO= -0.02347368421052632
[['A', ' CA ', 154.209, 139.868, 92.147]] AA_SCO= 2.5752631578947374 CA_SCO= -0.02010526315789474
[['A', ' CA ', 151.307, 142.24, 90.601]] AA_SCO= 2.5721052631578947 CA_SCO= -0.0168421052631579
[['A', ' CA ', 149.87, 143.087, 94.735]] AA_SCO= 2.580526315789474 CA_SCO= -0.02305263157894737
[['A', ' CA ', 153.211, 143.193, 97.296]] AA_SCO= 2.538421052631579 CA_SCO= -0.016315789473684218
[['A', ' CA ', 156.373, 143.808, 94.398]] AA_SCO= 2.552105263157895 CA_SCO= -0.00810526315789474
[['A', ' CA ', 154.057, 146.017, 91.364]] AA_SCO= 2.5731578947368416 CA_SCO= 0.0021052631578947364
[['A', ' CA ', 154.448, 143.527, 87.723]] AA_SCO= 2.441052631578947 CA_SCO= 0.006315789473684209
[['A', ' CA ', 150.879, 145.181, 86.185]] AA_SCO= 2.406842105263158 CA_SCO= 0.009894736842105262
[['A', ' CA ', 151.782, 142.781, 82.49]] AA_SCO= 2.407368421052632 CA_SCO= 0.010736842105263156
[['A', ' CA ', 148.48, 140.239, 82.919]] AA_SCO= 2.4073684210526314 CA_SCO= 0.01026315789473684
[['A', ' CA ', 148.287, 137.01, 79.722]] AA_SCO= 2.349473684210526 CA_SCO= 0.010894736842105261
[['A', ' CA ', 149.937, 133.232, 80.202]] AA_SCO= 2.3499999999999996 CA_SCO= 0.01089473684210526
[['A', ' CA ', 153.897, 134.282, 78.797]] AA_SCO= 2.3521052631578945 CA_SCO= 0.01084210526315789
[['A', ' CA ', 153.715, 137.321, 82.12]] AA_SCO= 2.361052631578947 CA_SCO= 0.006052631578947365
[['A', ' CA ', 152.19, 134.17, 84.729]] AA_SCO= 2.406315789473684 CA_SCO= 0.006789473684210525
[['A', ' CA ', 155.225, 131.588, 83.257]] AA_SCO= 2.4126315789473685 CA_SCO= 0.01836842105263158
[['A', ' CA ', 158.222, 134.609, 83.349]] AA_SCO= 2.3652631578947365 CA_SCO= 0.029842105263157892
[['A', ' CA ', 156.606, 136.159, 87.099]] AA_SCO= 2.374736842105263 CA_SCO= 0.03010526315789474
[['A', ' CA ', 157.364, 131.892, 88.702]] AA_SCO= 2.3578947368421055 CA_SCO= 0.037052631578947365
[['A', ' CA ', 161.167, 131.888, 87.023]] AA_SCO= 2.375263157894737 CA_SCO= 0.03810526315789473
[['A', ' CA ', 161.719, 136.066, 88.481]] AA_SCO= 2.358421052631579 CA_SCO= 0.04052631578947369
[['A', ' CA ', 159.578, 135.304, 92.225]] AA_SCO= 2.3578947368421055 CA_SCO= 0.04689473684210527
[['A', ' CA ', 162.062, 131.477, 92.477]] AA_SCO= 2.4084210526315797 CA_SCO= 0.04705263157894737
[['A', ' CA ', 165.511, 134.753, 92.412]] AA_SCO= 2.426315789473685 CA_SCO= 0.04705263157894737
[['A', ' CA ', 163.203, 136.896, 95.367]] AA_SCO= 2.407368421052632 CA_SCO= 0.047578947368421054
[['A', ' CA ', 162.512, 133.219, 97.794]] AA_SCO= 2.5068421052631575 CA_SCO= 0.050368421052631576
[['A', ' CA ', 166.379, 131.736, 97.201]] AA_SCO= 2.4721052631578946 CA_SCO= 0.04994736842105263
[['A', ' CA ', 168.157, 135.65, 98.226]] AA_SCO= 2.4878947368421045 CA_SCO= 0.04873684210526317
[['A', ' CA ', 165.045, 136.001, 101.631]] AA_SCO= 2.4326315789473685 CA_SCO= 0.04873684210526317
[['A', ' CA ', 166.404, 131.909, 102.531]] AA_SCO= 2.416842105263158 CA_SCO= 0.04605263157894738
[['A', ' CA ', 170.222, 132.907, 101.995]] AA_SCO= 2.3447368421052635 CA_SCO= 0.04205263157894738
[['A', ' CA ', 169.554, 136.732, 104.134]] AA_SCO= 2.3515789473684214 CA_SCO= 0.04194736842105264
[['A', ' CA ', 167.251, 134.3, 107.159]] AA_SCO= 2.3552631578947367 CA_SCO= 0.045894736842105266
[['A', ' CA ', 170.237, 131.192, 107.124]] AA_SCO= 2.3168421052631585 CA_SCO= 0.04331578947368422
[['A', ' CA ', 173.188, 134.263, 107.682]] AA_SCO= 2.3852631578947374 CA_SCO= 0.042421052631578963
[['A', ' CA ', 170.299, 136.443, 110.722]] AA_SCO= 2.3710526315789475 CA_SCO= 0.03347368421052633
[['A', ' CA ', 168.618, 132.577, 112.415]] AA_SCO= 2.3026315789473686 CA_SCO= -0.0054736842105263086
[['A', ' CA ', 171.013, 132.091, 115.719]] AA_SCO= 2.356315789473684 CA_SCO= -0.03578947368421053
[['A', ' CA ', 170.9, 127.854, 115.572]] AA_SCO= 2.279473684210526 CA_SCO= -0.06757894736842107
[['A', ' CA ', 171.536, 126.799, 119.339]] AA_SCO= 2.1605263157894736 CA_SCO= -0.07842105263157895
[['A', ' CA ', 168.144, 129.472, 121.119]] AA_SCO= 2.1873684210526307 CA_SCO= -0.08273684210526315
[['A', ' CA ', 165.08, 126.373, 121.012]] AA_SCO= 2.1926315789473687 CA_SCO= -0.08447368421052633
[['A', ' CA ', 162.912, 126.114, 117.93]] AA_SCO= 2.0694736842105264 CA_SCO= -0.10163157894736842
[['A', ' CA ', 159.878, 124.11, 119.285]] AA_SCO= 1.953157894736842 CA_SCO= -0.11226315789473684
[['A', ' CA ', 157.028, 125.169, 121.64]] AA_SCO= 1.958421052631579 CA_SCO= -0.11584210526315787
[['A', ' CA ', 155.713, 123.959, 124.905]] AA_SCO= 1.9778947368421047 CA_SCO= -0.11873684210526314
[['A', ' CA ', 151.906, 123.074, 124.791]] AA_SCO= 1.9789473684210528 CA_SCO= -0.11842105263157894
[['A', ' CA ', 147.965, 122.649, 125.719]] AA_SCO= 1.9573684210526319 CA_SCO= -0.11810526315789473
[['A', ' CA ', 147.088, 120.867, 122.518]] AA_SCO= 1.9731578947368422 CA_SCO= -0.12773684210526315
[['A', ' CA ', 143.507, 119.858, 123.587]] AA_SCO= 2.021052631578948 CA_SCO= -0.124
[['A', ' CA ', 142.245, 123.486, 121.894]] AA_SCO= 1.885789473684211 CA_SCO= -0.12394736842105263
[['A', ' CA ', 138.811, 125.039, 123.371]] AA_SCO= 1.8189473684210526 CA_SCO= -0.1238421052631579
[['A', ' CA ', 137.809, 124.889, 119.566]] AA_SCO= 1.838421052631579 CA_SCO= -0.12394736842105263
[['A', ' CA ', 138.086, 128.594, 118.191]] AA_SCO= 1.8547368421052628 CA_SCO= -0.13831578947368425
[['A', ' CA ', 139.087, 127.442, 114.471]] AA_SCO= 1.859473684210526 CA_SCO= -0.13047368421052633
[['A', ' CA ', 143.136, 128.732, 113.637]] AA_SCO= 1.9294736842105262 CA_SCO= -0.09594736842105264
[['A', ' CA ', 143.11, 129.478, 109.438]] AA_SCO= 1.9357894736842103 CA_SCO= -0.06610526315789475
[['A', ' CA ', 147.251, 129.772, 108.909]] AA_SCO= 1.933157894736842 CA_SCO= -0.035157894736842096
[['A', ' CA ', 147.572, 130.245, 104.696]] AA_SCO= 2.059473684210526 CA_SCO= -0.023947368421052627
[['A', ' CA ', 151.33, 130.284, 103.734]] AA_SCO= 2.007894736842105 CA_SCO= -0.020894736842105268
[['A', ' CA ', 151.663, 130.957, 99.756]] AA_SCO= 2.0373684210526317 CA_SCO= -0.019842105263157894
[['A', ' CA ', 152.921, 127.636, 98.387]] AA_SCO= 2.1426315789473684 CA_SCO= -0.0026842105263157924
[['A', ' CA ', 154.884, 127.871, 94.819]] AA_SCO= 2.1873684210526316 CA_SCO= 0.01268421052631579
[['A', ' CA ', 151.306, 128.205, 92.972]] AA_SCO= 2.18 CA_SCO= 0.016473684210526317
[['A', ' CA ', 149.282, 130.401, 95.413]] AA_SCO= 2.0421052631578944 CA_SCO= 0.018526315789473682
[['A', ' CA ', 147.859, 130.883, 98.977]] AA_SCO= 2.0294736842105263 CA_SCO= 0.01794736842105263
[['A', ' CA ', 146.995, 127.472, 100.62]] AA_SCO= 2.0805263157894736 CA_SCO= 0.018210526315789476
[['A', ' CA ', 145.148, 128.684, 103.579]] AA_SCO= 1.9589473684210532 CA_SCO= 0.03042105263157895
[['A', ' CA ', 143.601, 125.273, 105.62]] AA_SCO= 1.9831578947368425 CA_SCO= 0.029105263157894738
[['A', ' CA ', 141.77, 126.558, 108.954]] AA_SCO= 2.0084210526315793 CA_SCO= 0.027842105263157897
[['A', ' CA ', 140.818, 123.51, 111.319]] AA_SCO= 2.0826315789473693 CA_SCO= 0.028578947368421054
[['A', ' CA ', 139.48, 124.192, 115.135]] AA_SCO= 2.0752631578947374 CA_SCO= 0.030263157894736846
[['A', ' CA ', 140.639, 120.959, 117.62]] AA_SCO= 2.0368421052631587 CA_SCO= 0.04363157894736844
[['A', ' CA ', 138.608, 121.254, 120.857]] AA_SCO= 2.0468421052631585 CA_SCO= 0.04405263157894738
[['A', ' CA ', 139.087, 118.096, 123.273]] AA_SCO= 2.0236842105263158 CA_SCO= 0.04563157894736843
[['A', ' CA ', 143.041, 116.762, 122.213]] AA_SCO= 1.9763157894736845 CA_SCO= 0.044210526315789485
[['A', ' CA ', 141.653, 115.675, 118.068]] AA_SCO= 1.9494736842105262 CA_SCO= 0.04326315789473686
[['A', ' CA ', 140.577, 118.343, 115.468]] AA_SCO= 1.9431578947368422 CA_SCO= 0.04289473684210527
[['A', ' CA ', 136.562, 118.19, 115.005]] AA_SCO= 1.9731578947368422 CA_SCO= 0.0418421052631579
[['A', ' CA ', 136.631, 120.189, 111.253]] AA_SCO= 2.075789473684211 CA_SCO= 0.04110526315789475
[['A', ' CA ', 140.128, 121.026, 109.265]] AA_SCO= 2.1157894736842104 CA_SCO= 0.04110526315789474
[['A', ' CA ', 139.099, 122.055, 105.55]] AA_SCO= 2.150526315789474 CA_SCO= 0.03978947368421054
[['A', ' CA ', 142.192, 123.26, 103.514]] AA_SCO= 2.1889473684210525 CA_SCO= 0.037105263157894745
[['A', ' CA ', 141.603, 125.124, 99.99]] AA_SCO= 2.3410526315789477 CA_SCO= 0.03631578947368422
[['A', ' CA ', 144.963, 124.998, 98.488]] AA_SCO= 2.365263157894737 CA_SCO= 0.03489473684210527
[['A', ' CA ', 145.808, 127.543, 95.868]] AA_SCO= 2.365263157894737 CA_SCO= 0.034315789473684216
[['A', ' CA ', 145.082, 125.29, 92.438]] AA_SCO= 2.500526315789474 CA_SCO= 0.0338421052631579
[['A', ' CA ', 141.414, 124.777, 93.617]] AA_SCO= 2.491578947368421 CA_SCO= 0.035473684210526324
[['A', ' CA ', 140.608, 128.677, 93.256]] AA_SCO= 2.551052631578948 CA_SCO= 0.035631578947368424
[['A', ' CA ', 142.587, 129.071, 89.661]] AA_SCO= 2.503684210526316 CA_SCO= 0.035526315789473684
[['A', ' CA ', 140.72, 125.726, 88.524]] AA_SCO= 2.4115789473684215 CA_SCO= 0.03531578947368422
[['A', ' CA ', 137.182, 127.396, 87.723]] AA_SCO= 2.4373684210526316 CA_SCO= 0.03694736842105264
[['A', ' CA ', 139.195, 131.051, 86.099]] AA_SCO= 2.460000000000001 CA_SCO= 0.034473684210526316
[['A', ' CA ', 141.859, 128.598, 83.677]] AA_SCO= 2.506842105263158 CA_SCO= 0.03531578947368421
[['A', ' CA ', 138.714, 126.797, 81.884]] AA_SCO= 2.5284210526315793 CA_SCO= 0.03689473684210527
[['A', ' CA ', 136.589, 129.97, 81.083]] AA_SCO= 2.653684210526316 CA_SCO= 0.037842105263157906
[['A', ' CA ', 140.625, 132.422, 80.142]] AA_SCO= 2.652631578947368 CA_SCO= 0.03878947368421053
[['A', ' CA ', 141.289, 129.463, 77.019]] AA_SCO= 2.668421052631579 CA_SCO= 0.040000000000000015
[['A', ' CA ', 137.411, 130.996, 75.351]] AA_SCO= 2.571578947368421 CA_SCO= 0.04047368421052632
[['A', ' CA ', 138.238, 133.893, 72.426]] AA_SCO= 2.53421052631579 CA_SCO= 0.040157894736842115
[['A', ' CA ', 141.609, 132.181, 70.567]] AA_SCO= 2.5531578947368416 CA_SCO= 0.040789473684210535
[['A', ' CA ', 142.1, 128.596, 68.586]] AA_SCO= 2.5489473684210524 CA_SCO= 0.04136842105263159
[['A', ' CA ', 141.434, 125.608, 71.285]] AA_SCO= 2.541578947368421 CA_SCO= 0.04352631578947369
[['A', ' CA ', 145.694, 124.017, 70.651]] AA_SCO= 2.563684210526316 CA_SCO= 0.04631578947368423
[['A', ' CA ', 146.975, 127.419, 73.051]] AA_SCO= 2.412631578947368 CA_SCO= 0.037210526315789486
[['A', ' CA ', 143.637, 127.141, 75.341]] AA_SCO= 2.4105263157894736 CA_SCO= 0.03721052631578949
[['A', ' CA ', 145.689, 123.819, 76.898]] AA_SCO= 2.444210526315789 CA_SCO= 0.036947368421052645
[['A', ' CA ', 149.432, 125.96, 77.376]] AA_SCO= 2.483684210526316 CA_SCO= 0.03368421052631579
[['A', ' CA ', 147.235, 129.288, 79.378]] AA_SCO= 2.4236842105263157 CA_SCO= 0.021842105263157892
[['A', ' CA ', 145.855, 126.18, 81.997]] AA_SCO= 2.488947368421053 CA_SCO= 0.019052631578947366
[['A', ' CA ', 149.963, 124.507, 82.001]] AA_SCO= 2.466315789473684 CA_SCO= 0.018368421052631576
[['A', ' CA ', 151.237, 128.383, 82.676]] AA_SCO= 2.437894736842105 CA_SCO= 0.021263157894736838
[['A', ' CA ', 149.088, 128.393, 85.944]] AA_SCO= 2.1652631578947363 CA_SCO= 0.013736842105263153
[['A', ' CA ', 151.146, 125.187, 86.833]] AA_SCO= 2.1722222222222225 CA_SCO= 0.01133333333333333
[['A', ' CA ', 148.13, 123.253, 88.069]] AA_SCO= 2.0923529411764705 CA_SCO= 0.009235294117647057
[['A', ' CA ', 148.825, 120.735, 90.822]] AA_SCO= 2.0725000000000002 CA_SCO= 0.0060624999999999984
[['A', ' CA ', 145.446, 118.726, 90.69]] AA_SCO= 2.02 CA_SCO= 0.0037999999999999996
[['A', ' CA ', 146.109, 116.306, 93.604]] AA_SCO= 1.9285714285714284 CA_SCO= 0.0009285714285714274
[['A', ' CA ', 146.035, 119.543, 95.859]] AA_SCO= 1.8869230769230767 CA_SCO= -0.0033076923076923084
[['A', ' CA ', 142.914, 120.99, 94.047]] AA_SCO= 1.854166666666667 CA_SCO= -0.007583333333333335
[['A', ' CA ', 140.847, 117.736, 94.761]] AA_SCO= 1.729090909090909 CA_SCO= -0.010272727272727274
[['A', ' CA ', 142.148, 119.148, 99.634]] AA_SCO= 1.6600000000000001 CA_SCO= -0.0175
[['B', ' CA ', 142.641, 116.11, 98.037]]
[['B', ' CA ', 163.485, 99.773, 77.396]]
[['B', ' CA ', 160.14, 101.961, 77.421]]
[['B', ' CA ', 158.236, 102.261, 80.99]]
[['B', ' CA ', 155.048, 104.762, 81.342]]
[['B', ' CA ', 154.371, 106.351, 85.121]]
[['B', ' CA ', 150.55, 106.094, 84.923]]
[['B', ' CA ', 149.356, 107.777, 88.171]]
[['B', ' CA ', 146.189, 106.365, 89.625]]
[['B', ' CA ', 145.653, 108.416, 92.841]]
[['B', ' CA ', 150.551, 112.144, 95.132]]
[['B', ' CA ', 152.697, 113.033, 92.721]]
[['B', ' CA ', 155.995, 112.896, 95.212]]
[['B', ' CA ', 157.073, 109.253, 93.496]]
[['B', ' CA ', 157.543, 110.412, 89.529]]
[['B', ' CA ', 159.567, 114.093, 91.098]]
[['B', ' CA ', 161.811, 111.346, 93.637]]
[['B', ' CA ', 162.787, 109.241, 89.834]]
[['B', ' CA ', 163.732, 113.264, 88.17]]
[['B', ' CA ', 165.642, 114.24, 91.828]]
[['B', ' CA ', 168.619, 111.129, 90.872]]
[['B', ' CA ', 169.599, 115.094, 89.038]]
[['B', ' CA ', 173.493, 114.311, 87.791]]
[['B', ' CA ', 172.191, 110.91, 84.917]]
[['B', ' CA ', 167.819, 112.017, 84.853]]
[['B', ' CA ', 168.191, 114.367, 81.366]]
[['B', ' CA ', 170.767, 110.874, 79.858]]
[['B', ' CA ', 168.005, 108.142, 81.875]]
[['B', ' CA ', 164.577, 109.739, 80.198]]
[['B', ' CA ', 166.372, 110.585, 76.297]]
[['B', ' CA ', 169.592, 108.02, 75.895]]
[['B', ' CA ', 169.16, 104.772, 78.083]]
[['B', ' CA ', 164.965, 104.087, 79.198]]
[['B', ' CA ', 162.145, 106.705, 76.979]]
[['B', ' CA ', 158.95, 106.771, 79.254]]
[['B', ' CA ', 155.82, 107.147, 76.331]]
[['B', ' CA ', 152.598, 107.479, 78.169]]
[['B', ' CA ', 153.067, 109.294, 81.789]]
[['B', ' CA ', 150.734, 112.272, 80.619]]
[['B', ' CA ', 152.578, 114.204, 83.687]]
[['B', ' CA ', 156.538, 114.224, 81.794]]
[['B', ' CA ', 155.389, 113.522, 77.4]]
[['B', ' CA ', 151.452, 114.515, 75.982]]
[['B', ' CA ', 149.867, 110.673, 73.635]]
[['B', ' CA ', 146.848, 109.218, 75.742]]
[['B', ' CA ', 145.674, 105.818, 74.574]]
[['B', ' CA ', 148.404, 103.71, 75.862]]
[['B', ' CA ', 151.135, 102.364, 73.661]]
[['B', ' CA ', 152.736, 98.886, 74.741]]
[['B', ' CA ', 155.508, 99.835, 77.184]]
[['B', ' CA ', 157.533, 96.607, 78.88]]
[['B', ' CA ', 157.625, 97.949, 83.062]]
[['B', ' CA ', 154.798, 100.694, 83.492]]
[['B', ' CA ', 155.432, 101.578, 87.266]]
[['B', ' CA ', 151.852, 102.939, 88.493]]
[['B', ' CA ', 151.954, 105.57, 91.354]]
[['B', ' CA ', 149.467, 105.286, 94.016]]
[['B', ' CA ', 145.917, 104.117, 94.931]]
[['B', ' CA ', 143.105, 102.296, 93.726]]
[['B', ' CA ', 139.896, 103.977, 94.732]]
[['B', ' CA ', 137.438, 101.157, 93.263]]
[['B', ' CA ', 133.684, 103.478, 93.234]]
[['B', ' CA ', 135.405, 105.971, 90.152]]
[['B', ' CA ', 135.507, 103.295, 87.114]]
[['B', ' CA ', 138.745, 105.665, 84.638]]
[['B', ' CA ', 141.813, 104.371, 87.356]]
[['B', ' CA ', 140.408, 100.586, 87.701]]
[['B', ' CA ', 139.484, 100.286, 83.407]]
[['B', ' CA ', 143.27, 102.309, 82.598]]
[['B', ' CA ', 145.328, 99.676, 85.429]]
[['B', ' CA ', 143.022, 96.056, 83.645]]
[['B', ' CA ', 144.361, 97.868, 79.544]]
[['B', ' CA ', 148.29, 98.713, 81.422]]
[['B', ' CA ', 148.113, 94.761, 82.989]]
[['B', ' CA ', 147.065, 93.671, 79.405]]
[['B', ' CA ', 149.87, 96.149, 77.219]]
[['B', ' CA ', 153.058, 97.135, 80.373]]
[['B', ' CA ', 154.67, 93.508, 80.608]]
[['B', ' CA ', 155.61, 93.91, 84.22]]
[['B', ' CA ', 153.836, 96.819, 86.014]]
[['B', ' CA ', 155.811, 97.31, 89.474]]
[['B', ' CA ', 153.822, 100.069, 91.594]]
[['B', ' CA ', 156.18, 102.478, 92.911]]
[['B', ' CA ', 155.605, 103.999, 96.0]]
[['B', ' CA ', 153.854, 102.948, 98.753]]
[['B', ' CA ', 150.552, 103.972, 97.715]]
[['B', ' CA ', 150.029, 101.306, 94.879]]
[['B', ' CA ', 151.901, 98.447, 96.69]]
[['B', ' CA ', 150.195, 98.682, 100.608]]
[['B', ' CA ', 148.034, 101.417, 100.814]]
[['B', ' CA ', 149.922, 104.231, 102.651]]
[['B', ' CA ', 147.776, 106.859, 103.935]]
[['B', ' CA ', 144.897, 106.167, 101.609]]
[['B', ' CA ', 143.777, 103.139, 103.813]]
[['B', ' CA ', 142.877, 105.656, 106.91]]
[['B', ' CA ', 140.208, 107.828, 104.098]]
[['B', ' CA ', 136.652, 107.029, 105.491]]
[['B', ' CA ', 134.615, 108.575, 102.362]]
[['B', ' CA ', 132.515, 111.879, 102.76]]
[['B', ' CA ', 134.736, 115.008, 101.741]]
[['B', ' CA ', 133.624, 117.645, 99.145]]
[['B', ' CA ', 133.929, 117.128, 95.513]]
[['B', ' CA ', 132.752, 113.741, 95.228]]
[['B', ' CA ', 131.865, 112.62, 98.994]]
[['B', ' CA ', 131.105, 108.307, 98.082]]
[['B', ' CA ', 135.145, 107.378, 96.586]]
[['B', ' CA ', 135.968, 106.28, 100.67]]
[['B', ' CA ', 137.46, 102.739, 99.36]]
[['B', ' CA ', 141.087, 103.09, 97.763]]
[['B', ' CA ', 143.19, 99.538, 98.241]]
[['B', ' CA ', 146.981, 99.815, 96.847]]
[['B', ' CA ', 146.521, 98.288, 92.792]]
[['B', ' CA ', 148.036, 94.611, 93.414]]
[['B', ' CA ', 144.369, 93.218, 95.157]]
[['B', ' CA ', 142.56, 94.064, 91.181]]
[['B', ' CA ', 145.831, 93.735, 88.634]]
[['B', ' CA ', 148.815, 91.053, 89.51]]
[['B', ' CA ', 151.947, 92.772, 90.34]]
[['B', ' CA ', 155.206, 91.502, 89.028]]
[['B', ' CA ', 157.628, 93.891, 91.375]]
[['B', ' CA ', 155.829, 96.268, 94.605]]
[['B', ' CA ', 158.951, 99.189, 94.978]]
[['B', ' CA ', 157.771, 100.762, 98.517]]
[['B', ' CA ', 158.562, 104.13, 100.001]]
[['B', ' CA ', 156.831, 107.821, 101.575]]
[['B', ' CA ', 158.779, 109.169, 98.821]]
[['B', ' CA ', 160.521, 106.028, 96.779]]
[['B', ' CA ', 163.981, 107.327, 97.888]]
[['B', ' CA ', 165.173, 108.717, 93.944]]
[['B', ' CA ', 168.854, 106.17, 93.926]]
[['B', ' CA ', 166.697, 102.505, 94.35]]
[['B', ' CA ', 163.927, 103.558, 91.522]]
[['B', ' CA ', 167.238, 104.972, 89.043]]
[['B', ' CA ', 169.764, 101.557, 90.458]]
[['B', ' CA ', 166.15, 98.805, 90.2]]
[['B', ' CA ', 164.945, 100.784, 86.399]]
[['B', ' CA ', 169.146, 100.599, 85.023]]
[['B', ' CA ', 169.304, 96.654, 86.578]]
[['B', ' CA ', 165.469, 95.744, 84.403]]
[['B', ' CA ', 167.593, 98.051, 81.03]]
[['B', ' CA ', 171.308, 95.887, 81.74]]
[['B', ' CA ', 167.186, 92.364, 83.2]]
[['B', ' CA ', 169.991, 91.646, 86.889]]
[['B', ' CA ', 166.333, 90.592, 88.147]]
[['B', ' CA ', 168.602, 88.56, 91.414]]
[['B', ' CA ', 168.967, 92.593, 93.225]]
[['B', ' CA ', 164.882, 93.161, 92.014]]
[['B', ' CA ', 163.895, 89.114, 93.119]]
[['B', ' CA ', 163.869, 90.802, 97.232]]
[['B', ' CA ', 161.148, 93.981, 95.488]]
[['B', ' CA ', 159.191, 91.071, 92.99]]
[['B', ' CA ', 158.773, 88.614, 96.822]]
[['B', ' CA ', 157.372, 92.356, 98.664]]
[['B', ' CA ', 154.691, 92.924, 95.263]]
[['B', ' CA ', 152.716, 89.862, 97.817]]
[['B', ' CA ', 152.743, 92.23, 101.217]]
[['B', ' CA ', 150.151, 95.003, 100.352]]
[['B', ' CA ', 148.956, 96.106, 103.959]]
[['B', ' CA ', 152.252, 97.478, 105.572]]
[['B', ' CA ', 151.839, 99.467, 109.127]]
[['B', ' CA ', 155.016, 99.519, 112.368]]
[['B', ' CA ', 153.114, 96.734, 114.92]]
[['B', ' CA ', 153.862, 94.131, 111.073]]
[['B', ' CA ', 158.015, 94.858, 112.897]]
[['B', ' CA ', 156.2, 93.719, 116.825]]
[['B', ' CA ', 154.002, 90.851, 115.106]]
[['B', ' CA ', 156.167, 89.58, 111.975]]
[['B', ' CA ', 160.072, 90.163, 113.513]]
[['B', ' CA ', 160.558, 91.438, 117.805]]
[['B', ' CA ', 157.188, 88.965, 119.066]]
[['B', ' CA ', 158.611, 85.604, 116.868]]
[['B', ' CA ', 162.109, 86.837, 119.188]]
[['B', ' CA ', 164.095, 87.954, 115.864]]
[['B', ' CA ', 164.646, 92.155, 116.902]]
[['B', ' CA ', 167.997, 92.786, 117.742]]
[['B', ' CA ', 167.89, 96.765, 118.95]]
[['B', ' CA ', 168.909, 98.108, 115.79]]
[['B', ' CA ', 167.184, 101.22, 115.124]]
[['B', ' CA ', 167.088, 100.422, 110.789]]
[['B', ' CA ', 163.316, 100.535, 111.166]]
[['B', ' CA ', 163.357, 104.284, 113.369]]
[['B', ' CA ', 166.514, 105.526, 110.651]]
[['B', ' CA ', 163.991, 104.477, 107.441]]
[['B', ' CA ', 160.629, 105.727, 108.976]]
[['B', ' CA ', 160.288, 108.722, 106.684]]
[['B', ' CA ', 157.093, 110.364, 108.733]]
[['B', ' CA ', 159.509, 110.067, 112.025]]
[['B', ' CA ', 156.872, 108.154, 114.099]]
[['B', ' CA ', 158.704, 104.966, 115.549]]
[['B', ' CA ', 161.828, 106.04, 117.794]]
[['B', ' CA ', 163.379, 102.895, 119.566]]
[['B', ' CA ', 163.078, 103.217, 123.638]]
[['B', ' CA ', 164.978, 100.581, 125.69]]
[['B', ' CA ', 166.768, 99.135, 122.277]]
[['B', ' CA ', 163.312, 97.417, 120.375]]
[['B', ' CA ', 161.478, 100.367, 118.271]]
[['B', ' CA ', 157.85, 101.999, 119.851]]
[['B', ' CA ', 156.078, 103.602, 116.891]]
[['B', ' CA ', 153.562, 106.636, 117.896]]
[['B', ' CA ', 150.911, 105.105, 115.444]]
[['B', ' CA ', 148.968, 109.074, 114.637]]
[['B', ' CA ', 152.501, 110.121, 112.343]]
[['B', ' CA ', 152.198, 106.069, 110.954]]
[['B', ' CA ', 151.332, 106.431, 107.323]]
[['B', ' CA ', 150.851, 102.812, 106.496]]
[['B', ' CA ', 153.865, 102.336, 103.951]]
[['B', ' CA ', 155.567, 98.96, 105.536]]
[['B', ' CA ', 159.371, 100.668, 104.457]]
[['B', ' CA ', 160.579, 100.293, 108.216]]
[['B', ' CA ', 159.889, 96.474, 108.084]]
[['B', ' CA ', 161.472, 95.957, 104.337]]
[['B', ' CA ', 164.8, 97.831, 105.729]]
[['B', ' CA ', 164.365, 95.561, 109.601]]
[['B', ' CA ', 167.691, 93.486, 108.6]]
[['B', ' CA ', 165.777, 90.444, 110.499]]
[['B', ' CA ', 162.708, 90.543, 107.728]]
[['B', ' CA ', 164.681, 89.25, 104.709]]
[['B', ' CA ', 168.726, 89.594, 104.369]]
[['B', ' CA ', 170.02, 89.84, 100.732]]
[['B', ' CA ', 173.786, 88.37, 101.79]]
[['B', ' CA ', 175.635, 87.701, 98.39]]
[['B', ' CA ', 174.142, 91.21, 96.277]]
[['B', ' CA ', 175.597, 93.269, 99.542]]
[['B', ' CA ', 179.053, 91.328, 99.676]]
[['B', ' CA ', 179.063, 91.322, 95.466]]
[['B', ' CA ', 178.719, 95.821, 95.636]]
[['B', ' CA ', 181.125, 96.218, 98.69]]
[['B', ' CA ', 142.641, 116.11, 98.037]] AA_SCO= -1.2433333333333334 CA_SCO= 0.007333333333333331
[['B', ' CA ', 163.485, 99.773, 77.396]] AA_SCO= -0.9445454545454548 CA_SCO= -0.011818181818181821
[['B', ' CA ', 160.14, 101.961, 77.421]] AA_SCO= -0.6975000000000002 CA_SCO= -0.008750000000000003
[['B', ' CA ', 158.236, 102.261, 80.99]] AA_SCO= -0.4438461538461541 CA_SCO= -0.007769230769230772
[['B', ' CA ', 155.048, 104.762, 81.342]] AA_SCO= -0.3385714285714288 CA_SCO= -0.028142857142857143
[['B', ' CA ', 154.371, 106.351, 85.121]] AA_SCO= -0.15533333333333352 CA_SCO= -0.023600000000000003
[['B', ' CA ', 150.55, 106.094, 84.923]] AA_SCO= -0.03437500000000017 CA_SCO= -0.018250000000000002
[['B', ' CA ', 149.356, 107.777, 88.171]] AA_SCO= 0.10588235294117632 CA_SCO= -0.014352941176470591
[['B', ' CA ', 146.189, 106.365, 89.625]] AA_SCO= 0.23888888888888873 CA_SCO= -0.018333333333333337
[['B', ' CA ', 145.653, 108.416, 92.841]] AA_SCO= 0.5327777777777778 CA_SCO= -0.013888888888888892
[['B', ' CA ', 150.551, 112.144, 95.132]] AA_SCO= 0.6273684210526316 CA_SCO= -0.009894736842105267
[['B', ' CA ', 152.697, 113.033, 92.721]] AA_SCO= 0.8326315789473685 CA_SCO= -0.009368421052631578
[['B', ' CA ', 155.995, 112.896, 95.212]] AA_SCO= 0.9347368421052632 CA_SCO= -0.006473684210526315
[['B', ' CA ', 157.073, 109.253, 93.496]] AA_SCO= 1.1426315789473684 CA_SCO= -0.011263157894736843
[['B', ' CA ', 157.543, 110.412, 89.529]] AA_SCO= 1.1742105263157894 CA_SCO= -0.016473684210526317
[['B', ' CA ', 159.567, 114.093, 91.098]] AA_SCO= 1.335263157894737 CA_SCO= -0.01942105263157895
[['B', ' CA ', 161.811, 111.346, 93.637]] AA_SCO= 1.541578947368421 CA_SCO= -0.02121052631578947
[['B', ' CA ', 162.787, 109.241, 89.834]] AA_SCO= 1.6463157894736842 CA_SCO= -0.02299999999999999
[['B', ' CA ', 163.732, 113.264, 88.17]] AA_SCO= 1.7221052631578944 CA_SCO= -0.01357894736842105
[['B', ' CA ', 165.642, 114.24, 91.828]] AA_SCO= 1.9984210526315789 CA_SCO= -0.00894736842105263
[['B', ' CA ', 168.619, 111.129, 90.872]] AA_SCO= 1.8494736842105268 CA_SCO= -0.008789473684210526
[['B', ' CA ', 169.599, 115.094, 89.038]] AA_SCO= 1.882105263157895 CA_SCO= -0.01026315789473684
[['B', ' CA ', 173.493, 114.311, 87.791]] AA_SCO= 1.793157894736842 CA_SCO= -0.0075263157894736865
[['B', ' CA ', 172.191, 110.91, 84.917]] AA_SCO= 1.874736842105263 CA_SCO= 0.010421052631578947
[['B', ' CA ', 167.819, 112.017, 84.853]] AA_SCO= 1.8499999999999999 CA_SCO= 0.011473684210526316
[['B', ' CA ', 168.191, 114.367, 81.366]] AA_SCO= 1.9015789473684208 CA_SCO= 0.011473684210526316
[['B', ' CA ', 170.767, 110.874, 79.858]] AA_SCO= 1.8989473684210525 CA_SCO= 0.0074736842105263155
[['B', ' CA ', 168.005, 108.142, 81.875]] AA_SCO= 1.9621052631578948 CA_SCO= 0.006578947368421052
[['B', ' CA ', 164.577, 109.739, 80.198]] AA_SCO= 2.0231578947368423 CA_SCO= -0.006052631578947368
[['B', ' CA ', 166.372, 110.585, 76.297]] AA_SCO= 2.058947368421053 CA_SCO= -0.006210526315789474
[['B', ' CA ', 169.592, 108.02, 75.895]] AA_SCO= 2.0726315789473686 CA_SCO= -0.006421052631578948
[['B', ' CA ', 169.16, 104.772, 78.083]] AA_SCO= 2.0278947368421054 CA_SCO= -0.005263157894736844
[['B', ' CA ', 164.965, 104.087, 79.198]] AA_SCO= 2.075789473684211 CA_SCO= -0.0007368421052631586
[['B', ' CA ', 162.145, 106.705, 76.979]] AA_SCO= 2.1678947368421055 CA_SCO= 0.0013684210526315793
[['B', ' CA ', 158.95, 106.771, 79.254]] AA_SCO= 2.048421052631579 CA_SCO= 0.004105263157894737
[['B', ' CA ', 155.82, 107.147, 76.331]] AA_SCO= 2.0084210526315793 CA_SCO= -0.01457894736842105
[['B', ' CA ', 152.598, 107.479, 78.169]] AA_SCO= 2.005789473684211 CA_SCO= -0.02089473684210526
[['B', ' CA ', 153.067, 109.294, 81.789]] AA_SCO= 2.187894736842105 CA_SCO= -0.021842105263157895
[['B', ' CA ', 150.734, 112.272, 80.619]] AA_SCO= 2.238947368421053 CA_SCO= -0.03226315789473684
[['B', ' CA ', 152.578, 114.204, 83.687]] AA_SCO= 2.265263157894737 CA_SCO= -0.02236842105263158
[['B', ' CA ', 156.538, 114.224, 81.794]] AA_SCO= 2.307894736842105 CA_SCO= -0.020157894736842107
[['B', ' CA ', 155.389, 113.522, 77.4]] AA_SCO= 2.30421052631579 CA_SCO= -0.019842105263157894
[['B', ' CA ', 151.452, 114.515, 75.982]] AA_SCO= 2.2436842105263164 CA_SCO= -0.019157894736842106
[['B', ' CA ', 149.867, 110.673, 73.635]] AA_SCO= 2.2478947368421056 CA_SCO= -0.025421052631578945
[['B', ' CA ', 146.848, 109.218, 75.742]] AA_SCO= 2.2463157894736847 CA_SCO= -0.02594736842105263
[['B', ' CA ', 145.674, 105.818, 74.574]] AA_SCO= 2.2557894736842106 CA_SCO= -0.021263157894736838
[['B', ' CA ', 148.404, 103.71, 75.862]] AA_SCO= 2.1384210526315783 CA_SCO= -0.014315789473684205
[['B', ' CA ', 151.135, 102.364, 73.661]] AA_SCO= 2.151578947368421 CA_SCO= -0.01436842105263158
[['B', ' CA ', 152.736, 98.886, 74.741]] AA_SCO= 2.081578947368421 CA_SCO= -0.0148421052631579
[['B', ' CA ', 155.508, 99.835, 77.184]] AA_SCO= 2.083684210526316 CA_SCO= -0.014947368421052633
[['B', ' CA ', 157.533, 96.607, 78.88]] AA_SCO= 2.0731578947368416 CA_SCO= -0.01663157894736842
[['B', ' CA ', 157.625, 97.949, 83.062]] AA_SCO= 2.101578947368421 CA_SCO= -0.024894736842105258
[['B', ' CA ', 154.798, 100.694, 83.492]] AA_SCO= 2.015263157894737 CA_SCO= -0.02152631578947368
[['B', ' CA ', 155.432, 101.578, 87.266]] AA_SCO= 2.127894736842105 CA_SCO= -0.01842105263157894
[['B', ' CA ', 151.852, 102.939, 88.493]] AA_SCO= 2.0521052631578947 CA_SCO= 0.002052631578947369
[['B', ' CA ', 151.954, 105.57, 91.354]] AA_SCO= 2.1436842105263154 CA_SCO= 0.010736842105263157
[['B', ' CA ', 149.467, 105.286, 94.016]] AA_SCO= 2.096315789473684 CA_SCO= 0.013789473684210527
[['B', ' CA ', 145.917, 104.117, 94.931]] AA_SCO= 2.063684210526316 CA_SCO= 0.023894736842105264
[['B', ' CA ', 143.105, 102.296, 93.726]] AA_SCO= 2.0810526315789475 CA_SCO= 0.025421052631578945
[['B', ' CA ', 139.896, 103.977, 94.732]] AA_SCO= 2.0278947368421054 CA_SCO= 0.02431578947368421
[['B', ' CA ', 137.438, 101.157, 93.263]] AA_SCO= 2.127894736842105 CA_SCO= 0.02431578947368421
[['B', ' CA ', 133.684, 103.478, 93.234]] AA_SCO= 2.1894736842105265 CA_SCO= 0.023736842105263157
[['B', ' CA ', 135.405, 105.971, 90.152]] AA_SCO= 2.217368421052632 CA_SCO= 0.027631578947368424
[['B', ' CA ', 135.507, 103.295, 87.114]] AA_SCO= 2.2115789473684213 CA_SCO= 0.028157894736842107
[['B', ' CA ', 138.745, 105.665, 84.638]] AA_SCO= 2.222631578947368 CA_SCO= 0.028210526315789474
[['B', ' CA ', 141.813, 104.371, 87.356]] AA_SCO= 2.2642105263157895 CA_SCO= 0.024684210526315784
[['B', ' CA ', 140.408, 100.586, 87.701]] AA_SCO= 2.2657894736842104 CA_SCO= 0.03631578947368421
[['B', ' CA ', 139.484, 100.286, 83.407]] AA_SCO= 2.297368421052632 CA_SCO= 0.03505263157894737
[['B', ' CA ', 143.27, 102.309, 82.598]] AA_SCO= 2.3115789473684214 CA_SCO= 0.025684210526315795
[['B', ' CA ', 145.328, 99.676, 85.429]] AA_SCO= 2.314736842105264 CA_SCO= 0.02363157894736842
[['B', ' CA ', 143.022, 96.056, 83.645]] AA_SCO= 2.320526315789474 CA_SCO= 0.032157894736842114
[['B', ' CA ', 144.361, 97.868, 79.544]] AA_SCO= 2.403684210526316 CA_SCO= 0.03263157894736843
[['B', ' CA ', 148.29, 98.713, 81.422]] AA_SCO= 2.3747368421052633 CA_SCO= 0.02721052631578947
[['B', ' CA ', 148.113, 94.761, 82.989]] AA_SCO= 2.4831578947368422 CA_SCO= 0.015684210526315787
[['B', ' CA ', 147.065, 93.671, 79.405]] AA_SCO= 2.4615789473684213 CA_SCO= -0.009315789473684208
[['B', ' CA ', 149.87, 96.149, 77.219]] AA_SCO= 2.394736842105263 CA_SCO= -0.016157894736842104
[['B', ' CA ', 153.058, 97.135, 80.373]] AA_SCO= 2.4042105263157887 CA_SCO= -0.021999999999999995
[['B', ' CA ', 154.67, 93.508, 80.608]] AA_SCO= 2.426315789473684 CA_SCO= -0.023157894736842103
[['B', ' CA ', 155.61, 93.91, 84.22]] AA_SCO= 2.4247368421052626 CA_SCO= -0.021368421052631578
[['B', ' CA ', 153.836, 96.819, 86.014]] AA_SCO= 2.3584210526315785 CA_SCO= -0.03821052631578947
[['B', ' CA ', 155.811, 97.31, 89.474]] AA_SCO= 2.2847368421052634 CA_SCO= -0.04473684210526315
[['B', ' CA ', 153.822, 100.069, 91.594]] AA_SCO= 2.352105263157895 CA_SCO= -0.043526315789473684
[['B', ' CA ', 156.18, 102.478, 92.911]] AA_SCO= 2.3342105263157897 CA_SCO= -0.04378947368421051
[['B', ' CA ', 155.605, 103.999, 96.0]] AA_SCO= 2.2042105263157894 CA_SCO= -0.043842105263157884
[['B', ' CA ', 153.854, 102.948, 98.753]] AA_SCO= 2.2394736842105263 CA_SCO= -0.03857894736842103
[['B', ' CA ', 150.552, 103.972, 97.715]] AA_SCO= 2.281052631578947 CA_SCO= -0.037368421052631565
[['B', ' CA ', 150.029, 101.306, 94.879]] AA_SCO= 2.2926315789473684 CA_SCO= -0.03789473684210525
[['B', ' CA ', 151.901, 98.447, 96.69]] AA_SCO= 2.3021052631578947 CA_SCO= -0.028052631578947353
[['B', ' CA ', 150.195, 98.682, 100.608]] AA_SCO= 2.2984210526315794 CA_SCO= -0.0284736842105263
[['B', ' CA ', 148.034, 101.417, 100.814]] AA_SCO= 2.305789473684211 CA_SCO= -0.028789473684210504
[['B', ' CA ', 149.922, 104.231, 102.651]] AA_SCO= 2.337368421052632 CA_SCO= -0.03068421052631577
[['B', ' CA ', 147.776, 106.859, 103.935]] AA_SCO= 2.3610526315789473 CA_SCO= -0.03347368421052629
[['B', ' CA ', 144.897, 106.167, 101.609]] AA_SCO= 2.3610526315789473 CA_SCO= -0.02357894736842104
[['B', ' CA ', 143.777, 103.139, 103.813]] AA_SCO= 2.3426315789473677 CA_SCO= -0.0008421052631578962
[['B', ' CA ', 142.877, 105.656, 106.91]] AA_SCO= 2.4315789473684206 CA_SCO= 0.0008421052631578937
[['B', ' CA ', 140.208, 107.828, 104.098]] AA_SCO= 2.3473684210526318 CA_SCO= 0.005842105263157896
[['B', ' CA ', 136.652, 107.029, 105.491]] AA_SCO= 2.328421052631579 CA_SCO= 0.006999999999999999
[['B', ' CA ', 134.615, 108.575, 102.362]] AA_SCO= 2.2510526315789474 CA_SCO= -0.007315789473684213
[['B', ' CA ', 132.515, 111.879, 102.76]] AA_SCO= 2.3010526315789477 CA_SCO= 0.008526315789473686
[['B', ' CA ', 134.736, 115.008, 101.741]] AA_SCO= 2.398947368421053 CA_SCO= 0.015684210526315794
[['B', ' CA ', 133.624, 117.645, 99.145]] AA_SCO= 2.310526315789474 CA_SCO= 0.01578947368421053
[['B', ' CA ', 133.929, 117.128, 95.513]] AA_SCO= 2.3552631578947367 CA_SCO= 0.012736842105263163
[['B', ' CA ', 132.752, 113.741, 95.228]] AA_SCO= 2.478421052631579 CA_SCO= 0.012631578947368424
[['B', ' CA ', 131.865, 112.62, 98.994]] AA_SCO= 2.428947368421053 CA_SCO= 0.012263157894736842
[['B', ' CA ', 131.105, 108.307, 98.082]] AA_SCO= 2.328421052631579 CA_SCO= -0.0019473684210526319
[['B', ' CA ', 135.145, 107.378, 96.586]] AA_SCO= 2.3326315789473684 CA_SCO= -0.005157894736842106
[['B', ' CA ', 135.968, 106.28, 100.67]] AA_SCO= 2.31 CA_SCO= -0.008210526315789474
[['B', ' CA ', 137.46, 102.739, 99.36]] AA_SCO= 2.261052631578947 CA_SCO= -0.006263157894736843
[['B', ' CA ', 141.087, 103.09, 97.763]] AA_SCO= 2.2415789473684207 CA_SCO= -0.008052631578947367
[['B', ' CA ', 143.19, 99.538, 98.241]] AA_SCO= 2.1915789473684213 CA_SCO= -0.020736842105263154
[['B', ' CA ', 146.981, 99.815, 96.847]] AA_SCO= 2.1294736842105264 CA_SCO= -0.015
[['B', ' CA ', 146.521, 98.288, 92.792]] AA_SCO= 2.0205263157894735 CA_SCO= -0.013947368421052632
[['B', ' CA ', 148.036, 94.611, 93.414]] AA_SCO= 1.993684210526316 CA_SCO= -0.012368421052631579
[['B', ' CA ', 144.369, 93.218, 95.157]] AA_SCO= 1.9494736842105258 CA_SCO= -0.010842105263157896
[['B', ' CA ', 142.56, 94.064, 91.181]] AA_SCO= 2.015263157894737 CA_SCO= -0.04889473684210527
[['B', ' CA ', 145.831, 93.735, 88.634]] AA_SCO= 2.0642105263157897 CA_SCO= -0.093
[['B', ' CA ', 148.815, 91.053, 89.51]] AA_SCO= 2.1094736842105264 CA_SCO= -0.0868421052631579
[['B', ' CA ', 151.947, 92.772, 90.34]] AA_SCO= 2.105263157894737 CA_SCO= -0.09810526315789474
[['B', ' CA ', 155.206, 91.502, 89.028]] AA_SCO= 2.0773684210526313 CA_SCO= -0.09810526315789474
[['B', ' CA ', 157.628, 93.891, 91.375]] AA_SCO= 2.1257894736842107 CA_SCO= -0.09715789473684211
[['B', ' CA ', 155.829, 96.268, 94.605]] AA_SCO= 2.0821052631578945 CA_SCO= -0.09389473684210528
[['B', ' CA ', 158.951, 99.189, 94.978]] AA_SCO= 2.0794736842105257 CA_SCO= -0.09978947368421053
[['B', ' CA ', 157.771, 100.762, 98.517]] AA_SCO= 2.1152631578947365 CA_SCO= -0.09947368421052634
[['B', ' CA ', 158.562, 104.13, 100.001]] AA_SCO= 2.1478947368421055 CA_SCO= -0.0853157894736842
[['B', ' CA ', 156.831, 107.821, 101.575]] AA_SCO= 2.1294736842105264 CA_SCO= -0.08005263157894738
[['B', ' CA ', 158.779, 109.169, 98.821]] AA_SCO= 2.0447368421052636 CA_SCO= -0.0766842105263158
[['B', ' CA ', 160.521, 106.028, 96.779]] AA_SCO= 2.0978947368421057 CA_SCO= -0.0743684210526316
[['B', ' CA ', 163.981, 107.327, 97.888]] AA_SCO= 2.0015789473684213 CA_SCO= -0.07189473684210528
[['B', ' CA ', 165.173, 108.717, 93.944]] AA_SCO= 2.018947368421053 CA_SCO= -0.05731578947368421
[['B', ' CA ', 168.854, 106.17, 93.926]] AA_SCO= 2.0910526315789477 CA_SCO= -0.05484210526315789
[['B', ' CA ', 166.697, 102.505, 94.35]] AA_SCO= 2.125263157894737 CA_SCO= -0.05463157894736842
[['B', ' CA ', 163.927, 103.558, 91.522]] AA_SCO= 2.157368421052632 CA_SCO= -0.06221052631578948
[['B', ' CA ', 167.238, 104.972, 89.043]] AA_SCO= 2.1152631578947365 CA_SCO= -0.08089473684210527
[['B', ' CA ', 169.764, 101.557, 90.458]] AA_SCO= 2.0915789473684208 CA_SCO= -0.04410526315789473
[['B', ' CA ', 166.15, 98.805, 90.2]] AA_SCO= 1.9121052631578948 CA_SCO= -0.00310526315789474
[['B', ' CA ', 164.945, 100.784, 86.399]] AA_SCO= 1.9357894736842105 CA_SCO= 0.004210526315789475
[['B', ' CA ', 169.146, 100.599, 85.023]] AA_SCO= 1.9505263157894739 CA_SCO= 0.016000000000000007
[['B', ' CA ', 169.304, 96.654, 86.578]] AA_SCO= 1.956842105263158 CA_SCO= 0.015105263157894745
[['B', ' CA ', 165.469, 95.744, 84.403]] AA_SCO= 1.851578947368421 CA_SCO= 0.015052631578947373
[['B', ' CA ', 167.593, 98.051, 81.03]] AA_SCO= 1.6268421052631576 CA_SCO= 0.014684210526315791
[['B', ' CA ', 171.308, 95.887, 81.74]] AA_SCO= 1.677894736842105 CA_SCO= 0.014157894736842109
[['B', ' CA ', 167.186, 92.364, 83.2]] AA_SCO= 1.545263157894737 CA_SCO= 0.014210526315789474
[['B', ' CA ', 169.991, 91.646, 86.889]] AA_SCO= 1.4889473684210526 CA_SCO= 0.014263157894736837
[['B', ' CA ', 166.333, 90.592, 88.147]] AA_SCO= 1.5099999999999998 CA_SCO= 0.014157894736842105
[['B', ' CA ', 168.602, 88.56, 91.414]] AA_SCO= 1.5710526315789473 CA_SCO= 0.010473684210526314
[['B', ' CA ', 168.967, 92.593, 93.225]] AA_SCO= 1.584736842105263 CA_SCO= 0.006684210526315786
[['B', ' CA ', 164.882, 93.161, 92.014]] AA_SCO= 1.6521052631578943 CA_SCO= 0.002999999999999998
[['B', ' CA ', 163.895, 89.114, 93.119]] AA_SCO= 1.5321052631578944 CA_SCO= 0.0008421052631578933
[['B', ' CA ', 163.869, 90.802, 97.232]] AA_SCO= 1.4110526315789471 CA_SCO= 0.0007368421052631564
[['B', ' CA ', 161.148, 93.981, 95.488]] AA_SCO= 1.4957894736842103 CA_SCO= 0.0008421052631578937
[['B', ' CA ', 159.191, 91.071, 92.99]] AA_SCO= 1.4605263157894737 CA_SCO= 0.006421052631578945
[['B', ' CA ', 158.773, 88.614, 96.822]] AA_SCO= 1.5226315789473686 CA_SCO= 0.02736842105263158
[['B', ' CA ', 157.372, 92.356, 98.664]] AA_SCO= 1.3026315789473686 CA_SCO= 0.029736842105263155
[['B', ' CA ', 154.691, 92.924, 95.263]] AA_SCO= 1.4600000000000002 CA_SCO= 0.031210526315789473
[['B', ' CA ', 152.716, 89.862, 97.817]] AA_SCO= 1.4857894736842108 CA_SCO= 0.032578947368421055
[['B', ' CA ', 152.743, 92.23, 101.217]] AA_SCO= 1.4878947368421054 CA_SCO= 0.022631578947368423
[['B', ' CA ', 150.151, 95.003, 100.352]] AA_SCO= 1.2942105263157897 CA_SCO= 0.021684210526315785
[['B', ' CA ', 148.956, 96.106, 103.959]] AA_SCO= 1.3736842105263158 CA_SCO= 0.021947368421052632
[['B', ' CA ', 152.252, 97.478, 105.572]] AA_SCO= 1.6005263157894738 CA_SCO= 0.022368421052631583
[['B', ' CA ', 151.839, 99.467, 109.127]] AA_SCO= 1.5526315789473686 CA_SCO= 0.028526315789473688
[['B', ' CA ', 155.016, 99.519, 112.368]] AA_SCO= 1.7057894736842107 CA_SCO= 0.028526315789473688
[['B', ' CA ', 153.114, 96.734, 114.92]] AA_SCO= 1.7326315789473685 CA_SCO= 0.028105263157894737
[['B', ' CA ', 153.862, 94.131, 111.073]] AA_SCO= 1.724736842105263 CA_SCO= 0.026052631578947365
[['B', ' CA ', 158.015, 94.858, 112.897]] AA_SCO= 1.7668421052631575 CA_SCO= 0.026526315789473686
[['B', ' CA ', 156.2, 93.719, 116.825]] AA_SCO= 1.8094736842105263 CA_SCO= 0.029105263157894738
[['B', ' CA ', 154.002, 90.851, 115.106]] AA_SCO= 1.6857894736842105 CA_SCO= 0.01642105263157895
[['B', ' CA ', 156.167, 89.58, 111.975]] AA_SCO= 1.8010526315789472 CA_SCO= 0.013052631578947371
[['B', ' CA ', 160.072, 90.163, 113.513]] AA_SCO= 1.9621052631578948 CA_SCO= -0.007105263157894737
[['B', ' CA ', 160.558, 91.438, 117.805]] AA_SCO= 1.9700000000000004 CA_SCO= -0.013894736842105264
[['B', ' CA ', 157.188, 88.965, 119.066]] AA_SCO= 1.9926315789473688 CA_SCO= -0.023210526315789477
[['B', ' CA ', 158.611, 85.604, 116.868]] AA_SCO= 2.068947368421053 CA_SCO= -0.04273684210526316
[['B', ' CA ', 162.109, 86.837, 119.188]] AA_SCO= 2.311052631578948 CA_SCO= -0.04273684210526316
[['B', ' CA ', 164.095, 87.954, 115.864]] AA_SCO= 2.3163157894736845 CA_SCO= -0.04078947368421053
[['B', ' CA ', 164.646, 92.155, 116.902]] AA_SCO= 2.284736842105263 CA_SCO= -0.05352631578947368
[['B', ' CA ', 167.997, 92.786, 117.742]] AA_SCO= 2.3547368421052637 CA_SCO= -0.04631578947368421
[['B', ' CA ', 167.89, 96.765, 118.95]] AA_SCO= 2.5515789473684216 CA_SCO= -0.045052631578947365
[['B', ' CA ', 168.909, 98.108, 115.79]] AA_SCO= 2.540526315789474 CA_SCO= -0.04526315789473684
[['B', ' CA ', 167.184, 101.22, 115.124]] AA_SCO= 2.5726315789473686 CA_SCO= -0.04610526315789474
[['B', ' CA ', 167.088, 100.422, 110.789]] AA_SCO= 2.564736842105263 CA_SCO= -0.04568421052631579
[['B', ' CA ', 163.316, 100.535, 111.166]] AA_SCO= 2.544736842105263 CA_SCO= -0.045684210526315785
[['B', ' CA ', 163.357, 104.284, 113.369]] AA_SCO= 2.5394736842105265 CA_SCO= -0.04547368421052631
[['B', ' CA ', 166.514, 105.526, 110.651]] AA_SCO= 2.599473684210526 CA_SCO= -0.04294736842105262
[['B', ' CA ', 163.991, 104.477, 107.441]] AA_SCO= 2.553684210526316 CA_SCO= -0.040210526315789454
[['B', ' CA ', 160.629, 105.727, 108.976]] AA_SCO= 2.5031578947368422 CA_SCO= -0.042947368421052616
[['B', ' CA ', 160.288, 108.722, 106.684]] AA_SCO= 2.676842105263158 CA_SCO= -0.03321052631578946
[['B', ' CA ', 157.093, 110.364, 108.733]] AA_SCO= 2.7052631578947364 CA_SCO= -0.03668421052631577
[['B', ' CA ', 159.509, 110.067, 112.025]] AA_SCO= 2.671578947368421 CA_SCO= -0.020789473684210517
[['B', ' CA ', 156.872, 108.154, 114.099]] AA_SCO= 2.65578947368421 CA_SCO= -0.014000000000000004
[['B', ' CA ', 158.704, 104.966, 115.549]] AA_SCO= 2.632631578947368 CA_SCO= -0.0026842105263157924
[['B', ' CA ', 161.828, 106.04, 117.794]] AA_SCO= 2.578421052631579 CA_SCO= 0.017894736842105265
[['B', ' CA ', 163.379, 102.895, 119.566]] AA_SCO= 2.5342105263157895 CA_SCO= 0.01642105263157895
[['B', ' CA ', 163.078, 103.217, 123.638]] AA_SCO= 2.468947368421053 CA_SCO= 0.016578947368421054
[['B', ' CA ', 164.978, 100.581, 125.69]] AA_SCO= 2.5173684210526317 CA_SCO= 0.027105263157894736
[['B', ' CA ', 166.768, 99.135, 122.277]] AA_SCO= 2.503684210526316 CA_SCO= 0.029947368421052636
[['B', ' CA ', 163.312, 97.417, 120.375]] AA_SCO= 2.3205263157894738 CA_SCO= 0.01936842105263158
[['B', ' CA ', 161.478, 100.367, 118.271]] AA_SCO= 2.3247368421052634 CA_SCO= 0.018052631578947365
[['B', ' CA ', 157.85, 101.999, 119.851]] AA_SCO= 2.357894736842105 CA_SCO= 0.01021052631578947
[['B', ' CA ', 156.078, 103.602, 116.891]] AA_SCO= 2.365263157894737 CA_SCO= 0.009842105263157895
[['B', ' CA ', 153.562, 106.636, 117.896]] AA_SCO= 2.261578947368421 CA_SCO= 0.009789473684210527
[['B', ' CA ', 150.911, 105.105, 115.444]] AA_SCO= 2.362631578947368 CA_SCO= 0.008210526315789472
[['B', ' CA ', 148.968, 109.074, 114.637]] AA_SCO= 2.3415789473684208 CA_SCO= 0.008000000000000002
[['B', ' CA ', 152.501, 110.121, 112.343]] AA_SCO= 2.374736842105263 CA_SCO= 0.006947368421052632
[['B', ' CA ', 152.198, 106.069, 110.954]] AA_SCO= 2.3278947368421052 CA_SCO= 0.010105263157894737
[['B', ' CA ', 151.332, 106.431, 107.323]] AA_SCO= 2.3968421052631577 CA_SCO= -0.021684210526315792
[['B', ' CA ', 150.851, 102.812, 106.496]] AA_SCO= 2.301578947368421 CA_SCO= -0.01531578947368421
[['B', ' CA ', 153.865, 102.336, 103.951]] AA_SCO= 2.3236842105263156 CA_SCO= -0.013052631578947366
[['B', ' CA ', 155.567, 98.96, 105.536]] AA_SCO= 2.317894736842105 CA_SCO= -0.015368421052631578
[['B', ' CA ', 159.371, 100.668, 104.457]] AA_SCO= 2.4921052631578946 CA_SCO= -0.01505263157894737
[['B', ' CA ', 160.579, 100.293, 108.216]] AA_SCO= 2.5973684210526318 CA_SCO= -0.015263157894736841
[['B', ' CA ', 159.889, 96.474, 108.084]] AA_SCO= 2.6310526315789473 CA_SCO= -0.014315789473684212
[['B', ' CA ', 161.472, 95.957, 104.337]] AA_SCO= 2.673157894736842 CA_SCO= -0.022210526315789476
[['B', ' CA ', 164.8, 97.831, 105.729]] AA_SCO= 2.627894736842105 CA_SCO= -0.022894736842105266
[['B', ' CA ', 164.365, 95.561, 109.601]] AA_SCO= 2.5415789473684214 CA_SCO= -0.02584210526315789
[['B', ' CA ', 167.691, 93.486, 108.6]] AA_SCO= 2.7078947368421056 CA_SCO= -0.014789473684210524
[['B', ' CA ', 165.777, 90.444, 110.499]] AA_SCO= 2.7094736842105265 CA_SCO= -0.019894736842105264
[['B', ' CA ', 162.708, 90.543, 107.728]] AA_SCO= 2.6631578947368424 CA_SCO= -0.01542105263157895
[['B', ' CA ', 164.681, 89.25, 104.709]] AA_SCO= 2.6136842105263156 CA_SCO= -0.020842105263157898
[['B', ' CA ', 168.726, 89.594, 104.369]] AA_SCO= 2.677368421052632 CA_SCO= -0.053947368421052626
[['B', ' CA ', 170.02, 89.84, 100.732]] AA_SCO= 2.631666666666667 CA_SCO= -0.058499999999999996
[['B', ' CA ', 173.786, 88.37, 101.79]] AA_SCO= 2.597058823529412 CA_SCO= -0.0653529411764706
[['B', ' CA ', 175.635, 87.701, 98.39]] AA_SCO= 2.60375 CA_SCO= -0.0715
[['B', ' CA ', 174.142, 91.21, 96.277]] AA_SCO= 2.6700000000000004 CA_SCO= -0.07933333333333333
[['B', ' CA ', 175.597, 93.269, 99.542]] AA_SCO= 2.572857142857143 CA_SCO= -0.037285714285714276
[['B', ' CA ', 179.053, 91.328, 99.676]] AA_SCO= 2.689230769230769 CA_SCO= -0.04107692307692307
[['B', ' CA ', 179.063, 91.322, 95.466]] AA_SCO= 2.644166666666667 CA_SCO= -0.04633333333333333
[['B', ' CA ', 178.719, 95.821, 95.636]] AA_SCO= 2.6927272727272733 CA_SCO= -0.051727272727272726
[['B', ' CA ', 181.125, 96.218, 98.69]] AA_SCO= 2.4519999999999995 CA_SCO= -0.0621
[['C', ' CA ', 183.25, 93.267, 98.5]]
[['C', ' CA ', 186.92, 85.122, 109.817]]
[['C', ' CA ', 184.821, 87.092, 106.785]]
[['C', ' CA ', 186.619, 89.677, 104.007]]
[['C', ' CA ', 190.341, 89.986, 104.925]]
[['C', ' CA ', 192.645, 93.127, 104.01]]
[['C', ' CA ', 194.999, 92.651, 107.099]]
[['C', ' CA ', 194.148, 91.695, 110.919]]
[['C', ' CA ', 197.015, 93.145, 113.566]]
[['C', ' CA ', 196.225, 93.922, 117.149]]
[['C', ' CA ', 197.568, 97.963, 117.78]]
[['C', ' CA ', 195.917, 100.127, 120.922]]
[['C', ' CA ', 196.117, 104.109, 119.873]]
[['C', ' CA ', 198.9, 105.976, 121.557]]
[['C', ' CA ', 197.651, 109.198, 122.907]]
[['C', ' CA ', 197.79, 107.383, 126.58]]
[['C', ' CA ', 194.472, 109.923, 128.093]]
[['C', ' CA ', 191.765, 107.825, 125.203]]
[['C', ' CA ', 193.913, 103.938, 126.196]]
[['C', ' CA ', 193.164, 104.847, 130.583]]
[['C', ' CA ', 188.744, 105.943, 129.697]]
[['C', ' CA ', 188.179, 103.37, 126.051]]
[['C', ' CA ', 188.026, 99.145, 126.869]]
[['C', ' CA ', 191.007, 97.412, 124.998]]
[['C', ' CA ', 193.47, 100.023, 123.356]]
[['C', ' CA ', 190.734, 102.824, 122.187]]
[['C', ' CA ', 191.449, 102.189, 118.403]]
[['C', ' CA ', 187.477, 102.77, 117.133]]
[['C', ' CA ', 187.313, 106.479, 119.299]]
[['C', ' CA ', 191.737, 107.006, 118.048]]
[['C', ' CA ', 190.694, 105.95, 113.952]]
[['C', ' CA ', 186.973, 107.871, 114.228]]
[['C', ' CA ', 188.04, 111.24, 116.443]]
[['C', ' CA ', 192.015, 111.3, 114.041]]
[['C', ' CA ', 189.42, 110.406, 110.349]]
[['C', ' CA ', 186.95, 113.591, 111.966]]
[['C', ' CA ', 190.281, 116.173, 113.095]]
[['C', ' CA ', 192.334, 115.362, 109.357]]
[['C', ' CA ', 187.973, 115.978, 107.878]]
[['C', ' CA ', 187.2, 112.105, 105.52]]
[['C', ' CA ', 183.743, 111.598, 108.35]]
[['C', ' CA ', 183.24, 115.675, 109.679]]
[['C', ' CA ', 180.792, 113.871, 113.013]]
[['C', ' CA ', 180.292, 109.643, 113.418]]
[['C', ' CA ', 177.187, 108.549, 115.914]]
[['C', ' CA ', 178.831, 106.123, 118.673]]
[['C', ' CA ', 176.476, 105.376, 121.685]]
[['C', ' CA ', 177.809, 107.682, 124.802]]
[['C', ' CA ', 176.144, 109.844, 127.22]]
[['C', ' CA ', 172.643, 107.774, 128.623]]
[['C', ' CA ', 170.013, 109.111, 131.083]]
[['C', ' CA ', 170.003, 106.25, 133.96]]
[['C', ' CA ', 174.117, 105.23, 133.964]]
[['C', ' CA ', 174.94, 102.135, 131.886]]
[['C', ' CA ', 172.06, 102.399, 129.079]]
[['C', ' CA ', 174.287, 104.393, 126.505]]
[['C', ' CA ', 171.584, 106.456, 123.931]]
[['C', ' CA ', 173.763, 106.7, 120.685]]
[['C', ' CA ', 174.195, 110.83, 120.042]]
[['C', ' CA ', 176.575, 111.714, 116.729]]
[['C', ' CA ', 179.55, 113.743, 118.36]]
[['C', ' CA ', 181.12, 115.64, 115.494]]
[['C', ' CA ', 184.332, 117.169, 117.822]]
[['C', ' CA ', 186.6, 114.031, 118.775]]
[['C', ' CA ', 186.517, 115.372, 123.521]]
[['C', ' CA ', 181.924, 114.011, 122.87]]
[['C', ' CA ', 183.419, 110.505, 121.139]]
[['C', ' CA ', 186.667, 110.09, 123.924]]
[['C', ' CA ', 183.462, 110.718, 127.027]]
[['C', ' CA ', 180.725, 108.057, 124.615]]
[['C', ' CA ', 184.924, 105.368, 124.632]]
[['C', ' CA ', 184.194, 102.659, 127.452]]
[['C', ' CA ', 181.752, 99.235, 125.776]]
[['C', ' CA ', 178.363, 99.147, 127.899]]
[['C', ' CA ', 176.992, 95.729, 126.108]]
[['C', ' CA ', 172.704, 96.447, 126.965]]
[['C', ' CA ', 171.631, 97.746, 123.348]]
[['C', ' CA ', 172.015, 101.134, 122.064]]
[['C', ' CA ', 170.361, 100.954, 118.723]]
[['C', ' CA ', 172.817, 103.939, 117.086]]
[['C', ' CA ', 171.856, 103.345, 113.351]]
[['C', ' CA ', 168.572, 105.41, 113.759]]
[['C', ' CA ', 170.266, 109.156, 114.746]]
[['C', ' CA ', 172.892, 108.549, 111.31]]
[['C', ' CA ', 169.395, 110.032, 108.907]]
[['C', ' CA ', 168.768, 113.306, 111.647]]
[['C', ' CA ', 173.131, 113.707, 112.087]]
[['C', ' CA ', 173.7, 113.637, 107.812]]
[['C', ' CA ', 170.463, 116.081, 107.149]]
[['C', ' CA ', 169.657, 118.821, 110.358]]
[['C', ' CA ', 173.215, 118.585, 112.123]]
[['C', ' CA ', 174.303, 118.795, 107.663]]
[['C', ' CA ', 177.507, 116.248, 108.04]]
[['C', ' CA ', 177.282, 114.628, 104.365]]
[['C', ' CA ', 180.224, 111.804, 104.976]]
[['C', ' CA ', 179.57, 110.303, 108.63]]
[['C', ' CA ', 181.639, 108.218, 111.042]]
[['C', ' CA ', 180.025, 104.821, 112.232]]
[['C', ' CA ', 181.081, 102.454, 115.106]]
[['C', ' CA ', 178.708, 99.604, 114.811]]
[['C', ' CA ', 178.041, 96.1, 116.457]]
[['C', ' CA ', 177.795, 93.321, 113.745]]
[['C', ' CA ', 173.708, 93.36, 113.754]]
[['C', ' CA ', 173.822, 97.184, 113.066]]
[['C', ' CA ', 176.576, 96.966, 110.15]]
[['C', ' CA ', 173.95, 94.436, 108.44]]
[['C', ' CA ', 171.009, 97.016, 108.528]]
[['C', ' CA ', 173.338, 100.007, 107.349]]
[['C', ' CA ', 174.967, 97.941, 104.571]]
[['C', ' CA ', 171.347, 96.639, 103.615]]
[['C', ' CA ', 170.113, 100.23, 103.619]]
[['C', ' CA ', 172.983, 101.205, 101.414]]
[['C', ' CA ', 172.645, 98.346, 98.711]]
[['C', ' CA ', 168.58, 98.356, 98.784]]
[['C', ' CA ', 167.905, 102.068, 99.821]]
[['C', ' CA ', 163.863, 102.863, 99.86]]
[['C', ' CA ', 163.046, 104.825, 101.136]]
[['C', ' CA ', 166.003, 106.318, 103.109]]
[['C', ' CA ', 166.92, 109.224, 100.752]]
[['C', ' CA ', 170.78, 110.046, 99.942]]
[['C', ' CA ', 172.334, 108.952, 103.681]]
[['C', ' CA ', 173.701, 105.219, 101.844]]
[['C', ' CA ', 176.921, 107.111, 100.079]]
[['C', ' CA ', 177.775, 109.933, 102.989]]
[['C', ' CA ', 178.614, 106.519, 105.563]]
[['C', ' CA ', 182.592, 106.292, 104.31]]
[['C', ' CA ', 183.975, 104.24, 107.636]]
[['C', ' CA ', 181.708, 102.123, 109.824]]
[['C', ' CA ', 183.931, 100.596, 112.26]]
[['C', ' CA ', 181.851, 97.386, 113.412]]
[['C', ' CA ', 182.798, 96.127, 116.912]]
[['C', ' CA ', 182.802, 92.233, 117.838]]
[['C', ' CA ', 179.561, 91.105, 119.454]]
[['C', ' CA ', 178.974, 87.65, 120.898]]
[['C', ' CA ', 175.622, 88.704, 122.553]]
[['C', ' CA ', 174.533, 92.066, 124.074]]
[['C', ' CA ', 171.933, 91.359, 127.267]]
[['C', ' CA ', 169.089, 94.246, 127.418]]
[['C', ' CA ', 169.968, 96.599, 130.318]]
[['C', ' CA ', 167.502, 95.266, 133.704]]
[['C', ' CA ', 169.346, 91.237, 133.307]]
[['C', ' CA ', 173.284, 93.23, 133.162]]
[['C', ' CA ', 172.13, 95.665, 136.439]]
[['C', ' CA ', 170.353, 91.303, 138.076]]
[['C', ' CA ', 174.239, 89.929, 137.21]]
[['C', ' CA ', 176.265, 93.469, 138.679]]
[['C', ' CA ', 173.691, 94.715, 141.59]]
[['C', ' CA ', 171.967, 90.908, 142.863]]
[['C', ' CA ', 174.535, 87.9, 141.666]]
[['C', ' CA ', 178.083, 89.853, 141.852]]
[['C', ' CA ', 176.27, 92.391, 145.128]]
[['C', ' CA ', 177.585, 96.382, 144.312]]
[['C', ' CA ', 174.44, 98.58, 141.818]]
[['C', ' CA ', 175.996, 100.076, 138.049]]
[['C', ' CA ', 176.904, 104.021, 139.287]]
[['C', ' CA ', 179.955, 102.215, 141.782]]
[['C', ' CA ', 180.883, 100.062, 138.363]]
[['C', ' CA ', 183.864, 101.78, 136.835]]
[['C', ' CA ', 184.087, 99.592, 133.342]]
[['C', ' CA ', 182.708, 95.98, 132.776]]
[['C', ' CA ', 184.402, 93.432, 129.724]]
[['C', ' CA ', 182.936, 89.788, 129.407]]
[['C', ' CA ', 186.314, 88.172, 127.738]]
[['C', ' CA ', 188.014, 84.982, 128.654]]
[['C', ' CA ', 185.638, 82.664, 129.814]]
[['C', ' CA ', 183.972, 85.515, 132.914]]
[['C', ' CA ', 182.249, 89.299, 132.472]]
[['C', ' CA ', 184.591, 90.964, 135.278]]
[['C', ' CA ', 182.869, 94.613, 136.026]]
[['C', ' CA ', 185.823, 96.477, 138.106]]
[['C', ' CA ', 183.826, 99.196, 140.724]]
[['C', ' CA ', 186.874, 101.825, 142.25]]
[['C', ' CA ', 188.626, 99.174, 144.913]]
[['C', ' CA ', 187.907, 95.369, 143.751]]
[['C', ' CA ', 187.657, 93.372, 140.769]]
[['C', ' CA ', 184.368, 91.723, 140.736]]
[['C', ' CA ', 183.881, 89.033, 137.757]]
[['C', ' CA ', 180.759, 86.36, 137.85]]
[['C', ' CA ', 181.789, 83.419, 135.383]]
[['C', ' CA ', 179.685, 83.961, 132.059]]
[['C', ' CA ', 177.446, 80.004, 131.822]]
[['C', ' CA ', 174.932, 82.475, 134.963]]
[['C', ' CA ', 174.655, 85.342, 131.499]]
[['C', ' CA ', 173.446, 82.109, 128.844]]
[['C', ' CA ', 169.501, 82.795, 128.822]]
[['C', ' CA ', 169.168, 86.441, 129.973]]
[['C', ' CA ', 170.961, 88.173, 126.559]]
[['C', ' CA ', 168.577, 88.995, 123.784]]
[['C', ' CA ', 166.045, 86.858, 121.885]]
[['C', ' CA ', 167.467, 87.365, 117.949]]
[['C', ' CA ', 171.101, 87.145, 119.294]]
[['C', ' CA ', 170.772, 83.149, 119.007]]
[['C', ' CA ', 170.01, 83.334, 115.388]]
[['C', ' CA ', 173.035, 85.698, 114.599]]
[['C', ' CA ', 176.08, 84.052, 112.877]]
[['C', ' CA ', 178.802, 87.013, 112.795]]
[['C', ' CA ', 180.959, 87.854, 115.713]]
[['C', ' CA ', 183.673, 89.978, 113.872]]
[['C', ' CA ', 181.867, 92.63, 111.985]]
[['C', ' CA ', 182.593, 91.032, 108.481]]
[['C', ' CA ', 180.391, 93.416, 106.351]]
[['C', ' CA ', 181.707, 96.925, 107.87]]
[['C', ' CA ', 185.215, 98.213, 106.549]]
[['C', ' CA ', 187.861, 97.623, 109.779]]
[['C', ' CA ', 185.94, 95.503, 112.672]]
[['C', ' CA ', 188.4, 95.555, 115.784]]
[['C', ' CA ', 187.15, 94.122, 119.475]]
[['C', ' CA ', 190.042, 92.69, 122.306]]
[['C', ' CA ', 190.062, 88.695, 122.023]]
[['C', ' CA ', 193.753, 88.019, 120.055]]
[['C', ' CA ', 195.113, 91.066, 121.706]]
[['C', ' CA ', 196.928, 90.82, 125.024]]
[['C', ' CA ', 195.443, 93.821, 128.033]]
[['C', ' CA ', 195.025, 97.389, 126.607]]
[['C', ' CA ', 195.702, 96.346, 122.794]]
[['C', ' CA ', 192.401, 94.915, 120.983]]
[['C', ' CA ', 192.787, 93.185, 117.552]]
[['C', ' CA ', 191.009, 95.157, 114.484]]
[['C', ' CA ', 190.991, 92.778, 110.784]]
[['C', ' CA ', 190.012, 95.911, 108.411]]
[['C', ' CA ', 188.194, 94.108, 105.454]]
[['C', ' CA ', 187.221, 96.526, 102.23]]
[['C', ' CA ', 190.217, 98.722, 101.015]]
[['C', ' CA ', 188.68, 102.663, 102.401]]
[['C', ' CA ', 188.919, 100.898, 106.43]]
[['C', ' CA ', 192.912, 99.264, 105.385]]
[['C', ' CA ', 193.839, 103.139, 103.637]]
[['C', ' CA ', 192.197, 105.539, 106.73]]
[['C', ' CA ', 193.62, 102.965, 109.734]]
[['C', ' CA ', 197.185, 101.798, 107.929]]
[['C', ' CA ', 197.736, 106.078, 106.676]]
[['C', ' CA ', 196.694, 107.041, 111.104]]
[['C', ' CA ', 199.06, 103.412, 112.355]]
[['C', ' CA ', 202.089, 105.047, 109.406]]
[['C', ' CA ', 201.035, 109.221, 111.118]]
[['C', ' CA ', 202.391, 107.121, 114.293]]
[['C', ' CA ', 198.937, 107.83, 116.968]]
[['C', ' CA ', 198.247, 103.574, 117.238]]
[['C', ' CA ', 201.562, 101.055, 117.401]]
[['C', ' CA ', 199.708, 97.732, 115.843]]
[['C', ' CA ', 202.343, 94.583, 116.074]]
[['C', ' CA ', 200.196, 92.029, 113.201]]
[['C', ' CA ', 198.237, 89.263, 115.588]]
[['C', ' CA ', 200.556, 85.519, 114.683]]
[['C', ' CA ', 203.665, 87.048, 117.709]]
[['C', ' CA ', 200.697, 87.993, 120.636]]
[['C', ' CA ', 199.829, 84.841, 122.696]]
[['C', ' CA ', 196.025, 84.311, 122.895]]
[['C', ' CA ', 196.845, 83.515, 119.318]]
[['C', ' CA ', 193.856, 84.986, 116.124]]
[['C', ' CA ', 193.303, 80.712, 116.525]]
[['C', ' CA ', 190.75, 81.306, 119.904]]
[['C', ' CA ', 188.777, 84.53, 117.753]]
[['C', ' CA ', 188.151, 82.002, 114.494]]
[['C', ' CA ', 187.053, 78.412, 117.505]]
[['C', ' CA ', 184.629, 81.646, 119.358]]
[['C', ' CA ', 183.567, 83.12, 115.54]]
[['C', ' CA ', 182.861, 79.097, 114.186]]
[['C', ' CA ', 181.025, 78.043, 117.73]]
[['C', ' CA ', 178.743, 81.657, 117.207]]
[['C', ' CA ', 177.945, 80.286, 113.692]]
[['C', ' CA ', 177.186, 76.61, 114.069]]
[['C', ' CA ', 174.83, 77.258, 118.103]]
[['C', ' CA ', 172.985, 80.224, 115.677]]
[['C', ' CA ', 172.637, 77.717, 112.514]]
[['C', ' CA ', 171.244, 74.484, 114.747]]
[['C', ' CA ', 168.634, 77.278, 116.48]]
[['C', ' CA ', 167.78, 79.091, 112.696]]
[['C', ' CA ', 167.105, 75.23, 111.188]]
[['C', ' CA ', 165.012, 74.094, 114.879]]
[['C', ' CA ', 162.815, 77.856, 114.748]]
[['C', ' CA ', 162.17, 76.817, 110.558]]
[['C', ' CA ', 160.974, 72.738, 111.721]]
[['C', ' CA ', 158.421, 74.425, 114.752]]
[['C', ' CA ', 157.233, 76.515, 111.106]]
[['C', ' CA ', 157.656, 80.474, 112.486]]
[['C', ' CA ', 159.512, 82.548, 109.617]]
[['C', ' CA ', 163.141, 83.142, 110.27]]
[['C', ' CA ', 164.838, 86.035, 107.813]]
[['C', ' CA ', 167.824, 84.045, 105.805]]
[['C', ' CA ', 183.25, 93.267, 98.5]] AA_SCO= 1.415 CA_SCO= -0.0928
[['C', ' CA ', 186.92, 85.122, 109.817]] AA_SCO= 1.497272727272727 CA_SCO= -0.07872727272727272
[['C', ' CA ', 184.821, 87.092, 106.785]] AA_SCO= 1.6258333333333332 CA_SCO= -0.06716666666666665
[['C', ' CA ', 186.619, 89.677, 104.007]] AA_SCO= 1.5953846153846152 CA_SCO= -0.062076923076923064
[['C', ' CA ', 190.341, 89.986, 104.925]] AA_SCO= 1.5849999999999997 CA_SCO= -0.05542857142857142
[['C', ' CA ', 192.645, 93.127, 104.01]] AA_SCO= 1.5779999999999998 CA_SCO= -0.062133333333333325
[['C', ' CA ', 194.999, 92.651, 107.099]] AA_SCO= 1.59375 CA_SCO= -0.05524999999999999
[['C', ' CA ', 194.148, 91.695, 110.919]] AA_SCO= 1.5870588235294119 CA_SCO= -0.05552941176470587
[['C', ' CA ', 197.015, 93.145, 113.566]] AA_SCO= 1.623888888888889 CA_SCO= -0.05005555555555554
[['C', ' CA ', 196.225, 93.922, 117.149]] AA_SCO= 1.565263157894737 CA_SCO= -0.04415789473684209
[['C', ' CA ', 197.568, 97.963, 117.78]] AA_SCO= 1.7947368421052636 CA_SCO= -0.0034210526315789505
[['C', ' CA ', 195.917, 100.127, 120.922]] AA_SCO= 1.613684210526316 CA_SCO= 0.0007894736842105241
[['C', ' CA ', 196.117, 104.109, 119.873]] AA_SCO= 1.5357894736842106 CA_SCO= 0.014210526315789474
[['C', ' CA ', 198.9, 105.976, 121.557]] AA_SCO= 1.760526315789474 CA_SCO= 0.014947368421052633
[['C', ' CA ', 197.651, 109.198, 122.907]] AA_SCO= 1.5810526315789475 CA_SCO= 0.008473684210526316
[['C', ' CA ', 197.79, 107.383, 126.58]] AA_SCO= 1.59 CA_SCO= -0.0034736842105263146
[['C', ' CA ', 194.472, 109.923, 128.093]] AA_SCO= 1.623684210526316 CA_SCO= -0.0009473684210526306
[['C', ' CA ', 191.765, 107.825, 125.203]] AA_SCO= 1.6363157894736844 CA_SCO= -0.0009473684210526306
[['C', ' CA ', 193.913, 103.938, 126.196]] AA_SCO= 1.6494736842105264 CA_SCO= -0.0003157894736842108
[['C', ' CA ', 193.164, 104.847, 130.583]] AA_SCO= 1.7468421052631582 CA_SCO= -0.0007894736842105252
[['C', ' CA ', 188.744, 105.943, 129.697]] AA_SCO= 1.7657894736842108 CA_SCO= -0.0008947368421052639
[['C', ' CA ', 188.179, 103.37, 126.051]] AA_SCO= 1.732105263157895 CA_SCO= -0.0007894736842105285
[['C', ' CA ', 188.026, 99.145, 126.869]] AA_SCO= 1.8110526315789472 CA_SCO= 0.002526315789473682
[['C', ' CA ', 191.007, 97.412, 124.998]] AA_SCO= 1.8573684210526316 CA_SCO= -5.2631578947369013e-05
[['C', ' CA ', 193.47, 100.023, 123.356]] AA_SCO= 1.9694736842105265 CA_SCO= 0.011421052631578948
[['C', ' CA ', 190.734, 102.824, 122.187]] AA_SCO= 2.0 CA_SCO= 0.012052631578947367
[['C', ' CA ', 191.449, 102.189, 118.403]] AA_SCO= 2.066315789473684 CA_SCO= 0.018473684210526316
[['C', ' CA ', 187.477, 102.77, 117.133]] AA_SCO= 2.0142105263157895 CA_SCO= 0.019157894736842106
[['C', ' CA ', 187.313, 106.479, 119.299]] AA_SCO= 2.1031578947368423 CA_SCO= 0.017894736842105262
[['C', ' CA ', 191.737, 107.006, 118.048]] AA_SCO= 2.1242105263157893 CA_SCO= 0.01426315789473684
[['C', ' CA ', 190.694, 105.95, 113.952]] AA_SCO= 2.343157894736842 CA_SCO= 0.007526315789473684
[['C', ' CA ', 186.973, 107.871, 114.228]] AA_SCO= 2.2673684210526317 CA_SCO= 0.009894736842105263
[['C', ' CA ', 188.04, 111.24, 116.443]] AA_SCO= 2.0989473684210522 CA_SCO= 0.009473684210526318
[['C', ' CA ', 192.015, 111.3, 114.041]] AA_SCO= 2.2321052631578944 CA_SCO= 0.017
[['C', ' CA ', 189.42, 110.406, 110.349]] AA_SCO= 2.2073684210526316 CA_SCO= 0.02173684210526316
[['C', ' CA ', 186.95, 113.591, 111.966]] AA_SCO= 2.2047368421052638 CA_SCO= 0.02310526315789474
[['C', ' CA ', 190.281, 116.173, 113.095]] AA_SCO= 2.208947368421053 CA_SCO= 0.024842105263157898
[['C', ' CA ', 192.334, 115.362, 109.357]] AA_SCO= 2.2010526315789485 CA_SCO= 0.02478947368421052
[['C', ' CA ', 187.973, 115.978, 107.878]] AA_SCO= 2.225789473684211 CA_SCO= 0.020052631578947367
[['C', ' CA ', 187.2, 112.105, 105.52]] AA_SCO= 2.1668421052631586 CA_SCO= 0.004736842105263155
[['C', ' CA ', 183.743, 111.598, 108.35]] AA_SCO= 2.1715789473684217 CA_SCO= -0.007789473684210532
[['C', ' CA ', 183.24, 115.675, 109.679]] AA_SCO= 2.07421052631579 CA_SCO= -0.02131578947368422
[['C', ' CA ', 180.792, 113.871, 113.013]] AA_SCO= 2.0815789473684214 CA_SCO= -0.019000000000000006
[['C', ' CA ', 180.292, 109.643, 113.418]] AA_SCO= 1.9752631578947368 CA_SCO= -0.019
[['C', ' CA ', 177.187, 108.549, 115.914]] AA_SCO= 1.8942105263157896 CA_SCO= -0.020000000000000007
[['C', ' CA ', 178.831, 106.123, 118.673]] AA_SCO= 1.8847368421052628 CA_SCO= -0.02021052631578947
[['C', ' CA ', 176.476, 105.376, 121.685]] AA_SCO= 1.992631578947368 CA_SCO= -0.022421052631578942
[['C', ' CA ', 177.809, 107.682, 124.802]] AA_SCO= 2.0136842105263155 CA_SCO= -0.02163157894736842
[['C', ' CA ', 176.144, 109.844, 127.22]] AA_SCO= 2.0426315789473684 CA_SCO= -0.01805263157894737
[['C', ' CA ', 172.643, 107.774, 128.623]] AA_SCO= 2.082631578947368 CA_SCO= -0.011263157894736838
[['C', ' CA ', 170.013, 109.111, 131.083]] AA_SCO= 2.2236842105263155 CA_SCO= -0.010684210526315784
[['C', ' CA ', 170.003, 106.25, 133.96]] AA_SCO= 2.354736842105263 CA_SCO= -0.011263157894736838
[['C', ' CA ', 174.117, 105.23, 133.964]] AA_SCO= 2.2936842105263158 CA_SCO= -0.014842105263157887
[['C', ' CA ', 174.94, 102.135, 131.886]] AA_SCO= 2.2821052631578946 CA_SCO= -0.003210526315789472
[['C', ' CA ', 172.06, 102.399, 129.079]] AA_SCO= 2.274736842105263 CA_SCO= 0.0001578947368421076
[['C', ' CA ', 174.287, 104.393, 126.505]] AA_SCO= 2.168421052631578 CA_SCO= 0.0006842105263157853
[['C', ' CA ', 171.584, 106.456, 123.931]] AA_SCO= 2.1484210526315786 CA_SCO= 0.0007368421052631593
[['C', ' CA ', 173.763, 106.7, 120.685]] AA_SCO= 2.1405263157894736 CA_SCO= 0.007526315789473682
[['C', ' CA ', 174.195, 110.83, 120.042]] AA_SCO= 2.195263157894737 CA_SCO= 0.022789473684210526
[['C', ' CA ', 176.575, 111.714, 116.729]] AA_SCO= 2.1684210526315786 CA_SCO= 0.031947368421052634
[['C', ' CA ', 179.55, 113.743, 118.36]] AA_SCO= 2.208421052631579 CA_SCO= 0.029578947368421055
[['C', ' CA ', 181.12, 115.64, 115.494]] AA_SCO= 2.16421052631579 CA_SCO= 0.010947368421052633
[['C', ' CA ', 184.332, 117.169, 117.822]] AA_SCO= 2.222105263157894 CA_SCO= -0.0006315789473684231
[['C', ' CA ', 186.6, 114.031, 118.775]] AA_SCO= 2.1836842105263155 CA_SCO= -0.007421052631578957
[['C', ' CA ', 186.517, 115.372, 123.521]] AA_SCO= 2.171578947368421 CA_SCO= -0.013105263157894736
[['C', ' CA ', 181.924, 114.011, 122.87]] AA_SCO= 2.1452631578947368 CA_SCO= -0.012
[['C', ' CA ', 183.419, 110.505, 121.139]] AA_SCO= 2.1378947368421053 CA_SCO= -0.012263157894736844
[['C', ' CA ', 186.667, 110.09, 123.924]] AA_SCO= 2.093157894736842 CA_SCO= -0.013578947368421058
[['C', ' CA ', 183.462, 110.718, 127.027]] AA_SCO= 2.0373684210526313 CA_SCO= -0.01642105263157895
[['C', ' CA ', 180.725, 108.057, 124.615]] AA_SCO= 2.0368421052631582 CA_SCO= -0.022105263157894735
[['C', ' CA ', 184.924, 105.368, 124.632]] AA_SCO= 2.0668421052631576 CA_SCO= -0.022894736842105263
[['C', ' CA ', 184.194, 102.659, 127.452]] AA_SCO= 2.1073684210526316 CA_SCO= -0.01931578947368421
[['C', ' CA ', 181.752, 99.235, 125.776]] AA_SCO= 2.0921052631578947 CA_SCO= -0.019684210526315783
[['C', ' CA ', 178.363, 99.147, 127.899]] AA_SCO= 2.0205263157894735 CA_SCO= -0.02221052631578947
[['C', ' CA ', 176.992, 95.729, 126.108]] AA_SCO= 2.1378947368421053 CA_SCO= -0.022315789473684206
[['C', ' CA ', 172.704, 96.447, 126.965]] AA_SCO= 2.151578947368421 CA_SCO= -0.02342105263157894
[['C', ' CA ', 171.631, 97.746, 123.348]] AA_SCO= 1.9257894736842103 CA_SCO= -0.023421052631578936
[['C', ' CA ', 172.015, 101.134, 122.064]] AA_SCO= 1.9163157894736844 CA_SCO= -0.023526315789473673
[['C', ' CA ', 170.361, 100.954, 118.723]] AA_SCO= 1.9457894736842107 CA_SCO= -0.026052631578947355
[['C', ' CA ', 172.817, 103.939, 117.086]] AA_SCO= 2.004736842105263 CA_SCO= -0.014105263157894735
[['C', ' CA ', 171.856, 103.345, 113.351]] AA_SCO= 2.0747368421052634 CA_SCO= 0.00010526315789473511
[['C', ' CA ', 168.572, 105.41, 113.759]] AA_SCO= 2.1194736842105266 CA_SCO= 0.008578947368421054
[['C', ' CA ', 170.266, 109.156, 114.746]] AA_SCO= 2.2310526315789474 CA_SCO= -0.011999999999999997
[['C', ' CA ', 172.892, 108.549, 111.31]] AA_SCO= 2.1752631578947366 CA_SCO= -0.007684210526315789
[['C', ' CA ', 169.395, 110.032, 108.907]] AA_SCO= 2.0810526315789475 CA_SCO= -0.01626315789473684
[['C', ' CA ', 168.768, 113.306, 111.647]] AA_SCO= 2.1 CA_SCO= -0.01626315789473684
[['C', ' CA ', 173.131, 113.707, 112.087]] AA_SCO= 2.099473684210526 CA_SCO= -0.016999999999999994
[['C', ' CA ', 173.7, 113.637, 107.812]] AA_SCO= 2.121052631578947 CA_SCO= -0.017578947368421048
[['C', ' CA ', 170.463, 116.081, 107.149]] AA_SCO= 2.003157894736842 CA_SCO= -0.015789473684210527
[['C', ' CA ', 169.657, 118.821, 110.358]] AA_SCO= 1.9636842105263153 CA_SCO= -0.017947368421052632
[['C', ' CA ', 173.215, 118.585, 112.123]] AA_SCO= 1.9563157894736836 CA_SCO= -0.019473684210526313
[['C', ' CA ', 174.303, 118.795, 107.663]] AA_SCO= 1.8831578947368417 CA_SCO= -0.02152631578947368
[['C', ' CA ', 177.507, 116.248, 108.04]] AA_SCO= 1.931052631578947 CA_SCO= -0.023684210526315787
[['C', ' CA ', 177.282, 114.628, 104.365]] AA_SCO= 1.9815789473684209 CA_SCO= -0.026631578947368423
[['C', ' CA ', 180.224, 111.804, 104.976]] AA_SCO= 1.9305263157894736 CA_SCO= -0.02552631578947368
[['C', ' CA ', 179.57, 110.303, 108.63]] AA_SCO= 2.1589473684210523 CA_SCO= -0.025789473684210522
[['C', ' CA ', 181.639, 108.218, 111.042]] AA_SCO= 2.0294736842105268 CA_SCO= -0.028842105263157884
[['C', ' CA ', 180.025, 104.821, 112.232]] AA_SCO= 2.018421052631579 CA_SCO= -0.02305263157894736
[['C', ' CA ', 181.081, 102.454, 115.106]] AA_SCO= 2.007894736842106 CA_SCO= -0.01989473684210526
[['C', ' CA ', 178.708, 99.604, 114.811]] AA_SCO= 2.007894736842106 CA_SCO= -0.013631578947368418
[['C', ' CA ', 178.041, 96.1, 116.457]] AA_SCO= 1.956842105263158 CA_SCO= -0.02057894736842105
[['C', ' CA ', 177.795, 93.321, 113.745]] AA_SCO= 1.7957894736842104 CA_SCO= 0.00663157894736842
[['C', ' CA ', 173.708, 93.36, 113.754]] AA_SCO= 1.7578947368421052 CA_SCO= 0.005157894736842105
[['C', ' CA ', 173.822, 97.184, 113.066]] AA_SCO= 1.8168421052631576 CA_SCO= 0.014789473684210528
[['C', ' CA ', 176.576, 96.966, 110.15]] AA_SCO= 1.8599999999999999 CA_SCO= 0.01542105263157895
[['C', ' CA ', 173.95, 94.436, 108.44]] AA_SCO= 1.9015789473684208 CA_SCO= 0.014894736842105264
[['C', ' CA ', 171.009, 97.016, 108.528]] AA_SCO= 1.9257894736842107 CA_SCO= 0.009894736842105265
[['C', ' CA ', 173.338, 100.007, 107.349]] AA_SCO= 2.063684210526316 CA_SCO= -0.015578947368421048
[['C', ' CA ', 174.967, 97.941, 104.571]] AA_SCO= 2.082105263157895 CA_SCO= -0.01273684210526316
[['C', ' CA ', 171.347, 96.639, 103.615]] AA_SCO= 2.1078947368421055 CA_SCO= -0.012684210526315787
[['C', ' CA ', 170.113, 100.23, 103.619]] AA_SCO= 2.173684210526316 CA_SCO= -0.025789473684210522
[['C', ' CA ', 172.983, 101.205, 101.414]] AA_SCO= 2.155263157894737 CA_SCO= -0.022894736842105256
[['C', ' CA ', 172.645, 98.346, 98.711]] AA_SCO= 2.0684210526315794 CA_SCO= -0.025789473684210525
[['C', ' CA ', 168.58, 98.356, 98.784]] AA_SCO= 2.121578947368421 CA_SCO= -0.04331578947368422
[['C', ' CA ', 167.905, 102.068, 99.821]] AA_SCO= 2.14421052631579 CA_SCO= -0.0501578947368421
[['C', ' CA ', 163.863, 102.863, 99.86]] AA_SCO= 2.261578947368421 CA_SCO= -0.050736842105263164
[['C', ' CA ', 163.046, 104.825, 101.136]] AA_SCO= 2.2794736842105263 CA_SCO= -0.05136842105263158
[['C', ' CA ', 166.003, 106.318, 103.109]] AA_SCO= 2.238947368421053 CA_SCO= -0.05252631578947369
[['C', ' CA ', 166.92, 109.224, 100.752]] AA_SCO= 2.1931578947368413 CA_SCO= -0.05257894736842104
[['C', ' CA ', 170.78, 110.046, 99.942]] AA_SCO= 2.187368421052631 CA_SCO= -0.05289473684210526
[['C', ' CA ', 172.334, 108.952, 103.681]] AA_SCO= 2.3678947368421057 CA_SCO= -0.052000000000000005
[['C', ' CA ', 173.701, 105.219, 101.844]] AA_SCO= 2.4768421052631577 CA_SCO= -0.04926315789473684
[['C', ' CA ', 176.921, 107.111, 100.079]] AA_SCO= 2.451052631578947 CA_SCO= -0.049052631578947375
[['C', ' CA ', 177.775, 109.933, 102.989]] AA_SCO= 2.456315789473684 CA_SCO= -0.04963157894736841
[['C', ' CA ', 178.614, 106.519, 105.563]] AA_SCO= 2.2900000000000005 CA_SCO= -0.052894736842105244
[['C', ' CA ', 182.592, 106.292, 104.31]] AA_SCO= 2.066842105263158 CA_SCO= -0.0518421052631579
[['C', ' CA ', 183.975, 104.24, 107.636]] AA_SCO= 1.9073684210526316 CA_SCO= -0.02889473684210526
[['C', ' CA ', 181.708, 102.123, 109.824]] AA_SCO= 1.9563157894736842 CA_SCO= -0.028736842105263147
[['C', ' CA ', 183.931, 100.596, 112.26]] AA_SCO= 1.9615789473684213 CA_SCO= -0.02852631578947368
[['C', ' CA ', 181.851, 97.386, 113.412]] AA_SCO= 2.0663157894736837 CA_SCO= -0.01568421052631579
[['C', ' CA ', 182.798, 96.127, 116.912]] AA_SCO= 2.0784210526315787 CA_SCO= -0.013578947368421057
[['C', ' CA ', 182.802, 92.233, 117.838]] AA_SCO= 2.0926315789473677 CA_SCO= -0.009263157894736848
[['C', ' CA ', 179.561, 91.105, 119.454]] AA_SCO= 2.1052631578947367 CA_SCO= 0.008157894736842105
[['C', ' CA ', 178.974, 87.65, 120.898]] AA_SCO= 2.068421052631579 CA_SCO= 0.015105263157894736
[['C', ' CA ', 175.622, 88.704, 122.553]] AA_SCO= 1.9321052631578948 CA_SCO= 0.018578947368421053
[['C', ' CA ', 174.533, 92.066, 124.074]] AA_SCO= 1.971578947368421 CA_SCO= 0.01931578947368421
[['C', ' CA ', 171.933, 91.359, 127.267]] AA_SCO= 2.008947368421053 CA_SCO= 0.02121052631578947
[['C', ' CA ', 169.089, 94.246, 127.418]] AA_SCO= 1.8131578947368419 CA_SCO= 0.020631578947368417
[['C', ' CA ', 169.968, 96.599, 130.318]] AA_SCO= 1.7852631578947373 CA_SCO= 0.031
[['C', ' CA ', 167.502, 95.266, 133.704]] AA_SCO= 1.7847368421052634 CA_SCO= 0.031210526315789473
[['C', ' CA ', 169.346, 91.237, 133.307]] AA_SCO= 1.765263157894737 CA_SCO= 0.03152631578947368
[['C', ' CA ', 173.284, 93.23, 133.162]] AA_SCO= 1.7410526315789472 CA_SCO= 0.027052631578947363
[['C', ' CA ', 172.13, 95.665, 136.439]] AA_SCO= 1.6673684210526318 CA_SCO= 0.027421052631578947
[['C', ' CA ', 170.353, 91.303, 138.076]] AA_SCO= 1.7784210526315793 CA_SCO= 0.03331578947368421
[['C', ' CA ', 174.239, 89.929, 137.21]] AA_SCO= 2.032105263157895 CA_SCO= 0.04057894736842106
[['C', ' CA ', 176.265, 93.469, 138.679]] AA_SCO= 2.1436842105263163 CA_SCO= 0.04552631578947369
[['C', ' CA ', 173.691, 94.715, 141.59]] AA_SCO= 2.085263157894737 CA_SCO= 0.044368421052631585
[['C', ' CA ', 171.967, 90.908, 142.863]] AA_SCO= 2.059473684210527 CA_SCO= 0.03663157894736843
[['C', ' CA ', 174.535, 87.9, 141.666]] AA_SCO= 1.9878947368421054 CA_SCO= 0.035421052631578964
[['C', ' CA ', 178.083, 89.853, 141.852]] AA_SCO= 2.027368421052632 CA_SCO= 0.031210526315789484
[['C', ' CA ', 176.27, 92.391, 145.128]] AA_SCO= 2.067894736842105 CA_SCO= 0.033526315789473696
[['C', ' CA ', 177.585, 96.382, 144.312]] AA_SCO= 1.9900000000000002 CA_SCO= 0.032842105263157895
[['C', ' CA ', 174.44, 98.58, 141.818]] AA_SCO= 1.8826315789473687 CA_SCO= 0.03247368421052632
[['C', ' CA ', 175.996, 100.076, 138.049]] AA_SCO= 1.9489473684210528 CA_SCO= 0.03026315789473684
[['C', ' CA ', 176.904, 104.021, 139.287]] AA_SCO= 1.9126315789473682 CA_SCO= 0.024473684210526318
[['C', ' CA ', 179.955, 102.215, 141.782]] AA_SCO= 1.917894736842105 CA_SCO= 0.020157894736842107
[['C', ' CA ', 180.883, 100.062, 138.363]] AA_SCO= 2.1531578947368417 CA_SCO= 0.017684210526315792
[['C', ' CA ', 183.864, 101.78, 136.835]] AA_SCO= 2.2042105263157894 CA_SCO= 0.017684210526315792
[['C', ' CA ', 184.087, 99.592, 133.342]] AA_SCO= 2.3299999999999996 CA_SCO= 0.017842105263157895
[['C', ' CA ', 182.708, 95.98, 132.776]] AA_SCO= 2.342631578947368 CA_SCO= 0.01773684210526316
[['C', ' CA ', 184.402, 93.432, 129.724]] AA_SCO= 2.466842105263158 CA_SCO= 0.02205263157894737
[['C', ' CA ', 182.936, 89.788, 129.407]] AA_SCO= 2.473684210526316 CA_SCO= 0.02236842105263158
[['C', ' CA ', 186.314, 88.172, 127.738]] AA_SCO= 2.44 CA_SCO= 0.011789473684210525
[['C', ' CA ', 188.014, 84.982, 128.654]] AA_SCO= 2.3000000000000003 CA_SCO= 0.004105263157894736
[['C', ' CA ', 185.638, 82.664, 129.814]] AA_SCO= 2.248421052631579 CA_SCO= 0.001894736842105261
[['C', ' CA ', 183.972, 85.515, 132.914]] AA_SCO= 2.2036842105263155 CA_SCO= -0.0004736842105263161
[['C', ' CA ', 182.249, 89.299, 132.472]] AA_SCO= 2.219473684210526 CA_SCO= 0.0032631578947368415
[['C', ' CA ', 184.591, 90.964, 135.278]] AA_SCO= 2.088421052631579 CA_SCO= 0.00736842105263158
[['C', ' CA ', 182.869, 94.613, 136.026]] AA_SCO= 2.051578947368421 CA_SCO= 0.011000000000000001
[['C', ' CA ', 185.823, 96.477, 138.106]] AA_SCO= 1.9094736842105267 CA_SCO= 0.008894736842105263
[['C', ' CA ', 183.826, 99.196, 140.724]] AA_SCO= 1.9863157894736847 CA_SCO= 0.008894736842105263
[['C', ' CA ', 186.874, 101.825, 142.25]] AA_SCO= 2.1105263157894742 CA_SCO= -0.004631578947368421
[['C', ' CA ', 188.626, 99.174, 144.913]] AA_SCO= 2.1578947368421058 CA_SCO= -0.0023157894736842107
[['C', ' CA ', 187.907, 95.369, 143.751]] AA_SCO= 1.9694736842105265 CA_SCO= 0.0009999999999999992
[['C', ' CA ', 187.657, 93.372, 140.769]] AA_SCO= 1.9773684210526312 CA_SCO= 0.004526315789473684
[['C', ' CA ', 184.368, 91.723, 140.736]] AA_SCO= 1.741578947368421 CA_SCO= -0.006421052631578947
[['C', ' CA ', 183.881, 89.033, 137.757]] AA_SCO= 1.7536842105263157 CA_SCO= -0.014421052631578949
[['C', ' CA ', 180.759, 86.36, 137.85]] AA_SCO= 1.5894736842105264 CA_SCO= -0.015789473684210527
[['C', ' CA ', 181.789, 83.419, 135.383]] AA_SCO= 1.5510526315789475 CA_SCO= -0.016421052631578944
[['C', ' CA ', 179.685, 83.961, 132.059]] AA_SCO= 1.4905263157894737 CA_SCO= -0.01668421052631579
[['C', ' CA ', 177.446, 80.004, 131.822]] AA_SCO= 1.5047368421052634 CA_SCO= -0.018999999999999996
[['C', ' CA ', 174.932, 82.475, 134.963]] AA_SCO= 1.6331578947368421 CA_SCO= -0.028578947368421048
[['C', ' CA ', 174.655, 85.342, 131.499]] AA_SCO= 1.7105263157894732 CA_SCO= -0.026421052631578953
[['C', ' CA ', 173.446, 82.109, 128.844]] AA_SCO= 1.81 CA_SCO= -0.031842105263157894
[['C', ' CA ', 169.501, 82.795, 128.822]] AA_SCO= 1.9247368421052629 CA_SCO= -0.04231578947368421
[['C', ' CA ', 169.168, 86.441, 129.973]] AA_SCO= 1.9368421052631577 CA_SCO= -0.03678947368421053
[['C', ' CA ', 170.961, 88.173, 126.559]] AA_SCO= 2.0815789473684205 CA_SCO= -0.04578947368421052
[['C', ' CA ', 168.577, 88.995, 123.784]] AA_SCO= 2.146315789473684 CA_SCO= -0.04805263157894737
[['C', ' CA ', 166.045, 86.858, 121.885]] AA_SCO= 2.1173684210526313 CA_SCO= -0.045894736842105266
[['C', ' CA ', 167.467, 87.365, 117.949]] AA_SCO= 2.09578947368421 CA_SCO= -0.04905263157894737
[['C', ' CA ', 171.101, 87.145, 119.294]] AA_SCO= 2.086315789473684 CA_SCO= -0.047368421052631574
[['C', ' CA ', 170.772, 83.149, 119.007]] AA_SCO= 2.094210526315789 CA_SCO= -0.06494736842105263
[['C', ' CA ', 170.01, 83.334, 115.388]] AA_SCO= 2.251052631578947 CA_SCO= -0.06321052631578947
[['C', ' CA ', 173.035, 85.698, 114.599]] AA_SCO= 2.2268421052631577 CA_SCO= -0.06373684210526316
[['C', ' CA ', 176.08, 84.052, 112.877]] AA_SCO= 2.4489473684210523 CA_SCO= -0.049631578947368415
[['C', ' CA ', 178.802, 87.013, 112.795]] AA_SCO= 2.3994736842105255 CA_SCO= -0.04568421052631579
[['C', ' CA ', 180.959, 87.854, 115.713]] AA_SCO= 2.3573684210526316 CA_SCO= -0.046105263157894726
[['C', ' CA ', 183.673, 89.978, 113.872]] AA_SCO= 2.4073684210526314 CA_SCO= -0.047789473684210514
[['C', ' CA ', 181.867, 92.63, 111.985]] AA_SCO= 2.4115789473684206 CA_SCO= -0.05036842105263156
[['C', ' CA ', 182.593, 91.032, 108.481]] AA_SCO= 2.3889473684210527 CA_SCO= -0.04826315789473682
[['C', ' CA ', 180.391, 93.416, 106.351]] AA_SCO= 2.236315789473684 CA_SCO= -0.03868421052631578
[['C', ' CA ', 181.707, 96.925, 107.87]] AA_SCO= 2.2178947368421054 CA_SCO= -0.05115789473684209
[['C', ' CA ', 185.215, 98.213, 106.549]] AA_SCO= 2.212105263157895 CA_SCO= -0.0558421052631579
[['C', ' CA ', 187.861, 97.623, 109.779]] AA_SCO= 2.117894736842105 CA_SCO= -0.06694736842105263
[['C', ' CA ', 185.94, 95.503, 112.672]] AA_SCO= 2.101578947368421 CA_SCO= -0.09426315789473685
[['C', ' CA ', 188.4, 95.555, 115.784]] AA_SCO= 2.2257894736842103 CA_SCO= -0.08610526315789474
[['C', ' CA ', 187.15, 94.122, 119.475]] AA_SCO= 2.1473684210526316 CA_SCO= -0.08394736842105265
[['C', ' CA ', 190.042, 92.69, 122.306]] AA_SCO= 2.2599999999999993 CA_SCO= -0.08800000000000001
[['C', ' CA ', 190.062, 88.695, 122.023]] AA_SCO= 2.282631578947368 CA_SCO= -0.08415789473684211
[['C', ' CA ', 193.753, 88.019, 120.055]] AA_SCO= 2.2189473684210523 CA_SCO= -0.07194736842105265
[['C', ' CA ', 195.113, 91.066, 121.706]] AA_SCO= 2.2021052631578946 CA_SCO= -0.05510526315789475
[['C', ' CA ', 196.928, 90.82, 125.024]] AA_SCO= 2.231578947368421 CA_SCO= -0.06110526315789474
[['C', ' CA ', 195.443, 93.821, 128.033]] AA_SCO= 2.1989473684210528 CA_SCO= -0.060736842105263165
[['C', ' CA ', 195.025, 97.389, 126.607]] AA_SCO= 2.1805263157894736 CA_SCO= -0.061315789473684226
[['C', ' CA ', 195.702, 96.346, 122.794]] AA_SCO= 2.1894736842105265 CA_SCO= -0.06100000000000001
[['C', ' CA ', 192.401, 94.915, 120.983]] AA_SCO= 2.2647368421052634 CA_SCO= -0.06578947368421054
[['C', ' CA ', 192.787, 93.185, 117.552]] AA_SCO= 2.2442105263157894 CA_SCO= -0.06863157894736843
[['C', ' CA ', 191.009, 95.157, 114.484]] AA_SCO= 2.1789473684210527 CA_SCO= -0.0672105263157895
[['C', ' CA ', 190.991, 92.778, 110.784]] AA_SCO= 2.2000000000000006 CA_SCO= -0.06800000000000002
[['C', ' CA ', 190.012, 95.911, 108.411]] AA_SCO= 2.312631578947369 CA_SCO= -0.06010526315789475
[['C', ' CA ', 188.194, 94.108, 105.454]] AA_SCO= 2.332631578947369 CA_SCO= -0.04247368421052631
[['C', ' CA ', 187.221, 96.526, 102.23]] AA_SCO= 2.352105263157895 CA_SCO= -0.02863157894736841
[['C', ' CA ', 190.217, 98.722, 101.015]] AA_SCO= 2.3768421052631576 CA_SCO= -0.002842105263157897
[['C', ' CA ', 188.68, 102.663, 102.401]] AA_SCO= 2.3015789473684207 CA_SCO= 0.023421052631578943
[['C', ' CA ', 188.919, 100.898, 106.43]] AA_SCO= 2.1647368421052637 CA_SCO= 0.021578947368421048
[['C', ' CA ', 192.912, 99.264, 105.385]] AA_SCO= 2.15 CA_SCO= 0.009052631578947368
[['C', ' CA ', 193.839, 103.139, 103.637]] AA_SCO= 2.1626315789473685 CA_SCO= 0.008999999999999998
[['C', ' CA ', 192.197, 105.539, 106.73]] AA_SCO= 2.1557894736842105 CA_SCO= 0.0016842105263157896
[['C', ' CA ', 193.62, 102.965, 109.734]] AA_SCO= 2.2726315789473683 CA_SCO= 0.0012631578947368393
[['C', ' CA ', 197.185, 101.798, 107.929]] AA_SCO= 2.310526315789474 CA_SCO= 0.001157894736842105
[['C', ' CA ', 197.736, 106.078, 106.676]] AA_SCO= 2.2931578947368423 CA_SCO= 0.0075789473684210506
[['C', ' CA ', 196.694, 107.041, 111.104]] AA_SCO= 2.342105263157895 CA_SCO= 0.005684210526315789
[['C', ' CA ', 199.06, 103.412, 112.355]] AA_SCO= 2.3468421052631583 CA_SCO= 0.006263157894736843
[['C', ' CA ', 202.089, 105.047, 109.406]] AA_SCO= 2.3384210526315794 CA_SCO= 0.009157894736842104
[['C', ' CA ', 201.035, 109.221, 111.118]] AA_SCO= 2.295263157894737 CA_SCO= 0.015157894736842105
[['C', ' CA ', 202.391, 107.121, 114.293]] AA_SCO= 2.2605263157894737 CA_SCO= 0.016684210526315787
[['C', ' CA ', 198.937, 107.83, 116.968]] AA_SCO= 2.314736842105263 CA_SCO= 0.018315789473684205
[['C', ' CA ', 198.247, 103.574, 117.238]] AA_SCO= 2.251578947368421 CA_SCO= 0.015736842105263157
[['C', ' CA ', 201.562, 101.055, 117.401]] AA_SCO= 2.238947368421053 CA_SCO= 0.0030526315789473667
[['C', ' CA ', 199.708, 97.732, 115.843]] AA_SCO= 2.2457894736842103 CA_SCO= -0.0062105263157894745
[['C', ' CA ', 202.343, 94.583, 116.074]] AA_SCO= 2.1005263157894736 CA_SCO= -0.01694736842105263
[['C', ' CA ', 200.196, 92.029, 113.201]] AA_SCO= 2.1110526315789477 CA_SCO= -0.019578947368421053
[['C', ' CA ', 198.237, 89.263, 115.588]] AA_SCO= 2.1926315789473687 CA_SCO= -0.018842105263157896
[['C', ' CA ', 200.556, 85.519, 114.683]] AA_SCO= 2.2126315789473683 CA_SCO= -0.01610526315789474
[['C', ' CA ', 203.665, 87.048, 117.709]] AA_SCO= 2.2773684210526315 CA_SCO= -0.004210526315789476
[['C', ' CA ', 200.697, 87.993, 120.636]] AA_SCO= 2.3068421052631582 CA_SCO= -0.0006315789473684224
[['C', ' CA ', 199.829, 84.841, 122.696]] AA_SCO= 2.321578947368421 CA_SCO= 0.005999999999999999
[['C', ' CA ', 196.025, 84.311, 122.895]] AA_SCO= 2.263157894736842 CA_SCO= 0.0022105263157894735
[['C', ' CA ', 196.845, 83.515, 119.318]] AA_SCO= 2.2684210526315787 CA_SCO= -0.000894736842105265
[['C', ' CA ', 193.856, 84.986, 116.124]] AA_SCO= 2.2484210526315787 CA_SCO= -0.000894736842105265
[['C', ' CA ', 193.303, 80.712, 116.525]] AA_SCO= 2.2505263157894735 CA_SCO= -0.0003684210526315811
[['C', ' CA ', 190.75, 81.306, 119.904]] AA_SCO= 2.2673684210526317 CA_SCO= -0.0015263157894736823
[['C', ' CA ', 188.777, 84.53, 117.753]] AA_SCO= 2.2752631578947367 CA_SCO= -0.0014736842105263163
[['C', ' CA ', 188.151, 82.002, 114.494]] AA_SCO= 2.252105263157895 CA_SCO= -0.0032631578947368376
[['C', ' CA ', 187.053, 78.412, 117.505]] AA_SCO= 2.292105263157895 CA_SCO= -0.001631578947368422
[['C', ' CA ', 184.629, 81.646, 119.358]] AA_SCO= 2.2868421052631582 CA_SCO= -0.0064736842105263155
[['C', ' CA ', 183.567, 83.12, 115.54]] AA_SCO= 2.343684210526316 CA_SCO= -0.00436842105263158
[['C', ' CA ', 182.861, 79.097, 114.186]] AA_SCO= 2.341578947368421 CA_SCO= 0.008578947368421052
[['C', ' CA ', 181.025, 78.043, 117.73]] AA_SCO= 2.3142105263157897 CA_SCO= 0.018315789473684216
[['C', ' CA ', 178.743, 81.657, 117.207]] AA_SCO= 2.4278947368421058 CA_SCO= 0.02636842105263158
[['C', ' CA ', 177.945, 80.286, 113.692]] AA_SCO= 2.4084210526315797 CA_SCO= 0.027473684210526317
[['C', ' CA ', 177.186, 76.61, 114.069]] AA_SCO= 2.423684210526316 CA_SCO= 0.017421052631578955
[['C', ' CA ', 174.83, 77.258, 118.103]] AA_SCO= 2.4200000000000004 CA_SCO= 0.01578947368421053
[['C', ' CA ', 172.985, 80.224, 115.677]] AA_SCO= 2.3810526315789473 CA_SCO= 0.016578947368421058
[['C', ' CA ', 172.637, 77.717, 112.514]] AA_SCO= 2.275789473684211 CA_SCO= 0.015631578947368423
[['C', ' CA ', 171.244, 74.484, 114.747]] AA_SCO= 2.2189473684210523 CA_SCO= 0.015210526315789475
[['C', ' CA ', 168.634, 77.278, 116.48]] AA_SCO= 2.2478947368421047 CA_SCO= 0.019578947368421057
[['C', ' CA ', 167.78, 79.091, 112.696]] AA_SCO= 2.291052631578947 CA_SCO= 0.023526315789473687
[['C', ' CA ', 167.105, 75.23, 111.188]] AA_SCO= 2.3057894736842104 CA_SCO= 0.01378947368421053
[['C', ' CA ', 165.012, 74.094, 114.879]] AA_SCO= 2.31578947368421 CA_SCO= -0.012894736842105263
[['C', ' CA ', 162.815, 77.856, 114.748]] AA_SCO= 2.21578947368421 CA_SCO= -0.04626315789473684
[['C', ' CA ', 162.17, 76.817, 110.558]] AA_SCO= 2.208333333333333 CA_SCO= -0.05144444444444444
[['C', ' CA ', 160.974, 72.738, 111.721]] AA_SCO= 2.264117647058823 CA_SCO= -0.05547058823529411
[['C', ' CA ', 158.421, 74.425, 114.752]] AA_SCO= 2.254375 CA_SCO= -0.0603125
[['C', ' CA ', 157.233, 76.515, 111.106]] AA_SCO= 2.26 CA_SCO= -0.062200000000000005
[['C', ' CA ', 157.656, 80.474, 112.486]] AA_SCO= 2.236428571428571 CA_SCO= -0.06907142857142858
[['C', ' CA ', 159.512, 82.548, 109.617]] AA_SCO= 2.183076923076923 CA_SCO= -0.07561538461538461
[['C', ' CA ', 163.141, 83.142, 110.27]] AA_SCO= 2.1799999999999993 CA_SCO= -0.08708333333333333
[['C', ' CA ', 164.838, 86.035, 107.813]] AA_SCO= 2.1599999999999997 CA_SCO= -0.096
[['C', ' CA ', 167.824, 84.045, 105.805]] AA_SCO= 2.152 CA_SCO= -0.10840000000000001
INFO : Start RosettaCM
VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
<generator object Model.get_residues at 0x7fd3ba3d09e0>
1 S
Detected: S
2 E
Detected: E
3 R
Detected: R
4 I
Detected: I
5 V
Detected: V
6 I
Detected: I
7 S
Detected: S
8 P
Detected: P
9 T
Detected: T
10 S
Detected: S
11 R
Detected: R
12 Q
Detected: Q
13 E
Detected: E
14 G
Detected: G
15 H
Detected: H
16 A
Detected: A
17 E
Detected: E
18 L
Detected: L
19 V
Detected: V
20 M
Detected: M
21 E
Detected: E
22 V
Detected: V
23 D
Detected: D
24 D
Detected: D
25 E
Detected: E
26 G
Detected: G
27 I
Detected: I
28 V
Detected: V
29 T
Detected: T
30 K
Detected: K
31 G
Detected: G
32 R
Detected: R
33 Y
Detected: Y
34 F
Detected: F
35 S
Detected: S
36 I
Detected: I
37 T
Detected: T
38 P
Detected: P
39 V
Detected: V
40 R
Detected: R
41 G
Detected: G
42 L
Detected: L
43 E
Detected: E
44 K
Detected: K
45 M
Detected: M
46 V
Detected: V
47 T
Detected: T
48 G
Detected: G
49 K
Detected: K
50 A
Detected: A
51 P
Detected: P
52 E
Detected: E
53 T
Detected: T
54 A
Detected: A
55 P
Detected: P
56 V
Detected: V
57 M
Detected: M
58 V
Detected: V
59 Q
Detected: Q
60 R
Detected: R
61 I
Detected: I
62 C
Detected: C
63 G
Detected: G
64 V
Detected: V
65 C
Detected: C
66 P
Detected: P
67 I
Detected: I
68 P
Detected: P
69 H
Detected: H
70 T
Detected: T
71 L
Detected: L
72 A
Detected: A
73 S
Detected: S
74 V
Detected: V
75 E
Detected: E
76 A
Detected: A
77 I
Detected: I
78 D
Detected: D
79 D
Detected: D
80 S
Detected: S
81 L
Detected: L
82 D
Detected: D
83 I
Detected: I
84 E
Detected: E
85 V
Detected: V
86 P
Detected: P
87 K
Detected: K
88 A
Detected: A
89 G
Detected: G
90 R
Detected: R
91 L
Detected: L
92 L
Detected: L
93 R
Detected: R
94 E
Detected: E
95 L
Detected: L
96 T
Detected: T
97 L
Detected: L
98 A
Detected: A
99 A
Detected: A
100 H
Detected: H
101 H
Detected: H
102 V
Detected: V
103 N
Detected: N
104 S
Detected: S
105 H
Detected: H
106 A
Detected: A
107 I
Detected: I
108 H
Detected: H
109 H
Detected: H
110 F
Detected: F
111 L
Detected: L
112 I
Detected: I
113 A
Detected: A
114 P
Detected: P
115 D
Detected: D
116 F
Detected: F
117 V
Detected: V
118 P
Detected: P
119 E
Detected: E
120 N
Detected: N
121 L
Detected: L
122 M
Detected: M
123 A
Detected: A
124 D
Detected: D
125 A
Detected: A
126 I
Detected: I
127 N
Detected: N
128 S
Detected: S
129 V
Detected: V
130 S
Detected: S
131 E
Detected: E
132 I
Detected: I
133 R
Detected: R
134 K
Detected: K
135 N
Detected: N
136 A
Detected: A
137 Q
Detected: Q
138 Y
Detected: Y
139 V
Detected: V
140 V
Detected: V
141 D
Detected: D
142 M
Detected: M
143 V
Detected: V
144 A
Detected: A
145 G
Detected: G
146 E
Detected: E
147 G
Detected: G
148 I
Detected: I
149 H
Detected: H
150 P
Detected: P
151 S
Detected: S
152 D
Detected: D
153 V
Detected: V
154 R
Detected: R
155 I
Detected: I
156 G
Detected: G
157 G
Detected: G
158 M
Detected: M
159 A
Detected: A
160 D
Detected: D
161 N
Detected: N
162 I
Detected: I
163 T
Detected: T
164 E
Detected: E
165 L
Detected: L
166 A
Detected: A
167 R
Detected: R
168 K
Detected: K
169 R
Detected: R
170 L
Detected: L
171 Y
Detected: Y
172 A
Detected: A
173 R
Detected: R
174 L
Detected: L
175 K
Detected: K
176 Q
Detected: Q
177 L
Detected: L
178 K
Detected: K
179 P
Detected: P
180 K
Detected: K
181 V
Detected: V
182 N
Detected: N
183 E
Detected: E
184 H
Detected: H
185 V
Detected: V
186 E
Detected: E
187 L
Detected: L
188 M
Detected: M
189 I
Detected: I
190 G
Detected: G
191 L
Detected: L
192 I
Detected: I
193 E
Detected: E
194 D
Detected: D
195 K
Detected: K
196 G
Detected: G
197 L
Detected: L
198 P
Detected: P
199 E
Detected: E
200 G
Detected: G
201 L
Detected: L
202 G
Detected: G
203 V
Detected: V
204 H
Detected: H
205 N
Detected: N
206 Q
Detected: Q
207 P
Detected: P
208 T
Detected: T
209 L
Detected: L
210 A
Detected: A
211 S
Detected: S
212 H
Detected: H
213 Q
Detected: Q
214 I
Detected: I
215 Y
Detected: Y
216 G
Detected: G
217 D
Detected: D
218 R
Detected: R
219 T
Detected: T
220 K
Detected: K
221 F
Detected: F
222 D
Detected: D
223 L
Detected: L
224 D
Detected: D
225 R
Detected: R
226 F
Detected: F
227 T
Detected: T
228 E
Detected: E
229 I
Detected: I
230 M
Detected: M
231 P
Detected: P
232 E
Detected: E
233 S
Detected: S
234 W
Detected: W
235 Y
Detected: Y
236 D
Detected: D
237 D
Detected: D
238 P
Detected: P
239 E
Detected: E
240 I
Detected: I
241 A
Detected: A
242 K
Detected: K
243 R
Detected: R
244 A
Detected: A
245 C
Detected: C
246 S
Detected: S
247 T
Detected: T
248 I
Detected: I
249 P
Detected: P
250 L
Detected: L
251 Y
Detected: Y
252 D
Detected: D
253 G
Detected: G
254 R
Detected: R
255 N
Detected: N
256 V
Detected: V
257 E
Detected: E
258 V
Detected: V
259 G
Detected: G
260 P
Detected: P
261 R
Detected: R
262 A
Detected: A
263 R
Detected: R
264 M
Detected: M
265 V
Detected: V
266 E
Detected: E
267 F
Detected: F
268 Q
Detected: Q
269 G
Detected: G
270 F
Detected: F
271 K
Detected: K
272 E
Detected: E
273 R
Detected: R
274 G
Detected: G
275 V
Detected: V
276 V
Detected: V
277 A
Detected: A
278 Q
Detected: Q
279 H
Detected: H
280 V
Detected: V
281 A
Detected: A
282 R
Detected: R
283 A
Detected: A
284 L
Detected: L
285 E
Detected: E
286 M
Detected: M
287 K
Detected: K
288 T
Detected: T
289 A
Detected: A
290 L
Detected: L
291 S
Detected: S
292 R
Detected: R
293 A
Detected: A
294 I
Detected: I
295 E
Detected: E
296 I
Detected: I
297 L
Detected: L
298 D
Detected: D
299 E
Detected: E
300 L
Detected: L
301 D
Detected: D
302 T
Detected: T
303 S
Detected: S
304 A
Detected: A
305 P
Detected: P
306 V
Detected: V
307 R
Detected: R
308 A
Detected: A
309 D
Detected: D
310 F
Detected: F
311 D
Detected: D
312 E
Detected: E
313 R
Detected: R
314 G
Detected: G
315 T
Detected: T
316 G
Detected: G
317 K
Detected: K
318 L
Detected: L
319 G
Detected: G
320 I
Detected: I
321 G
Detected: G
322 A
Detected: A
323 I
Detected: I
324 E
Detected: E
325 A
Detected: A
326 P
Detected: P
327 R
Detected: R
328 G
Detected: G
329 L
Detected: L
330 D
Detected: D
331 V
Detected: V
332 H
Detected: H
333 M
Detected: M
334 A
Detected: A
335 K
Detected: K
336 V
Detected: V
337 E
Detected: E
338 N
Detected: N
339 G
Detected: G
340 K
Detected: K
341 I
Detected: I
342 Q
Detected: Q
343 F
Detected: F
344 Y
Detected: Y
345 S
Detected: S
346 A
Detected: A
347 L
Detected: L
348 V
Detected: V
349 P
Detected: P
350 T
Detected: T
351 T
Detected: T
352 W
Detected: W
353 N
Detected: N
354 I
Detected: I
355 P
Detected: P
356 T
Detected: T
357 M
Detected: M
358 G
Detected: G
359 P
Detected: P
360 A
Detected: A
361 T
Detected: T
362 E
Detected: E
363 G
Detected: G
364 F
Detected: F
365 H
Detected: H
366 H
Detected: H
367 E
Detected: E
368 Y
Detected: Y
369 G
Detected: G
370 P
Detected: P
371 H
Detected: H
372 V
Detected: V
373 I
Detected: I
374 R
Detected: R
375 A
Detected: A
376 Y
Detected: Y
377 D
Detected: D
378 P
Detected: P
379 C
Detected: C
380 L
Detected: L
381 S
Detected: S
382 C
Detected: C
383 A
Detected: A
384 T
Detected: T
385 H
Detected: H
386 K
Detected: K
387 P
388 R
Detected: R
389 I
Detected: I
390 G
Detected: G
391 Y
Detected: Y
392 I
Detected: I
393 H
Detected: H
394 L
Detected: L
395 S
Detected: S
396 G
Detected: G
397 C
Detected: C
398 T
Detected: T
399 G
Detected: G
400 D
Detected: D
401 A
Detected: A
402 M
Detected: M
403 S
Detected: S
404 L
Detected: L
405 T
Detected: T
406 E
Detected: E
407 N
Detected: N
408 Y
Detected: Y
409 D
Detected: D
410 I
Detected: I
411 L
Detected: L
412 A
Detected: A
413 E
Detected: E
414 L
Detected: L
415 L
Detected: L
416 T
Detected: T
417 N
Detected: N
418 M
Detected: M
419 V
Detected: V
420 D
Detected: D
421 I
Detected: I
422 V
Detected: V
423 Y
Detected: Y
424 G
Detected: G
425 Q
Detected: Q
426 T
Detected: T
427 L
Detected: L
428 V
Detected: V
429 D
Detected: D
430 L
Detected: L
431 W
Detected: W
432 E
Detected: E
433 M
Detected: M
434 P
Detected: P
435 E
Detected: E
436 M
Detected: M
437 D
Detected: D
438 L
Detected: L
439 A
Detected: A
440 L
Detected: L
441 V
Detected: V
442 E
Detected: E
443 G
Detected: G
444 S
Detected: S
445 V
Detected: V
446 C
Detected: C
447 L
Detected: L
448 Q
Detected: Q
449 D
Detected: D
450 E
Detected: E
451 H
Detected: H
452 S
Detected: S
453 L
Detected: L
454 H
Detected: H
455 E
Detected: E
456 L
Detected: L
457 K
Detected: K
458 E
Detected: E
459 L
Detected: L
460 R
Detected: R
461 E
Detected: E
462 K
Detected: K
463 A
Detected: A
464 K
Detected: K
465 L
Detected: L
466 V
Detected: V
467 C
Detected: C
468 A
Detected: A
469 F
Detected: F
470 G
Detected: G
471 S
Detected: S
472 C
Detected: C
473 A
Detected: A
474 A
Detected: A
475 T
Detected: T
476 G
Detected: G
477 C
Detected: C
478 F
Detected: F
479 T
Detected: T
480 R
Detected: R
481 Y
Detected: Y
482 S
Detected: S
483 R
Detected: R
484 G
Detected: G
485 G
Detected: G
486 Q
Detected: Q
487 Q
Detected: Q
488 A
Detected: A
489 Q
Detected: Q
490 P
Detected: P
491 S
Detected: S
492 H
Detected: H
493 E
Detected: E
494 S
Detected: S
495 F
Detected: F
496 V
Detected: V
497 P
Detected: P
498 I
Detected: I
499 A
Detected: A
500 D
Detected: D
501 L
Detected: L
502 I
Detected: I
503 D
Detected: D
504 V
Detected: V
505 D
Detected: D
506 L
Detected: L
507 A
Detected: A
508 L
Detected: L
509 P
Detected: P
510 G
Detected: G
511 C
Detected: C
512 P
Detected: P
513 P
Detected: P
514 S
Detected: S
515 P
Detected: P
516 E
Detected: E
517 I
Detected: I
518 I
Detected: I
519 A
Detected: A
520 K
Detected: K
521 T
Detected: T
522 V
Detected: V
523 V
Detected: V
524 A
Detected: A
525 L
Detected: L
526 L
Detected: L
527 N
Detected: N
528 N
Detected: N
529 D
Detected: D
530 M
Detected: M
531 D
Detected: D
532 Y
Detected: Y
533 L
Detected: L
534 Q
Detected: Q
535 P
Detected: P
536 M
Detected: M
537 L
Detected: L
538 D
Detected: D
539 L
Detected: L
540 A
Detected: A
541 G
Detected: G
542 Y
Detected: Y
543 T
Detected: T
544 E
Detected: E
545 A
Detected: A
546 C
Detected: C
547 G
Detected: G
548 C
Detected: C
549 D
Detected: D
550 L
Detected: L
551 Q
Detected: Q
552 T
Detected: T
553 K
Detected: K
554 V
Detected: V
555 V
Detected: V
556 N
Detected: N
557 Q
Detected: Q
558 G
Detected: G
559 L
Detected: L
560 C
Detected: C
561 I
Detected: I
562 G
Detected: G
563 C
Detected: C
564 G
Detected: G
565 T
Detected: T
566 C
Detected: C
567 A
Detected: A
568 M
Detected: M
569 A
Detected: A
570 C
Detected: C
571 Q
Detected: Q
572 T
Detected: T
573 R
Detected: R
574 A
Detected: A
575 L
Detected: L
576 D
Detected: D
577 M
Detected: M
578 T
Detected: T
579 N
Detected: N
580 G
Detected: G
581 R
Detected: R
582 P
Detected: P
583 E
Detected: E
584 L
Detected: L
585 N
Detected: N
586 S
Detected: S
587 D
Detected: D
588 R
Detected: R
589 C
Detected: C
590 I
Detected: I
591 K
Detected: K
592 C
Detected: C
593 G
Detected: G
594 I
Detected: I
595 C
Detected: C
596 Y
Detected: Y
597 V
Detected: V
598 Q
Detected: Q
599 C
Detected: C
600 P
Detected: P
601 R
Detected: R
602 S
Detected: S
603 W
Detected: W
604 W
Detected: W
605 P
Detected: P
606 E
Detected: E
607 E
Detected: E
608 Q
Detected: Q
609 I
Detected: I
610 K
Detected: K
611 K
Detected: K
612 E
Detected: E
613 L
Detected: L
614 V
Detected: V
615 L
Detected: L
616 G
Detected: G
617 T
Detected: T
618 Y
Detected: Y
619 K
Detected: K
620 E
Detected: E
621 I
Detected: I
622 V
Detected: V
623 S
Detected: S
624 A
Detected: A
625 R
Detected: R
626 S
Detected: S
627 T
Detected: T
628 D
Detected: D
629 R
Detected: R
630 E
Detected: E
631 I
Detected: I
632 Q
Detected: Q
633 K
Detected: K
634 L
Detected: L
635 A
Detected: A
636 Q
Detected: Q
637 D
Detected: D
638 G
Detected: G
639 G
Detected: G
640 I
Detected: I
641 V
Detected: V
642 T
Detected: T
643 G
Detected: G
644 L
Detected: L
645 L
Detected: L
646 A
Detected: A
647 Y
Detected: Y
648 A
Detected: A
649 L
Detected: L
650 D
Detected: D
651 E
Detected: E
652 G
Detected: G
653 I
Detected: I
654 I
Detected: I
655 E
Detected: E
656 G
Detected: G
657 A
Detected: A
658 V
Detected: V
659 V
Detected: V
660 A
Detected: A
661 G
Detected: G
662 P
Detected: P
663 G
Detected: G
664 E
Detected: E
665 E
Detected: E
666 F
Detected: F
667 W
Detected: W
668 K
Detected: K
669 P
Detected: P
670 Q
Detected: Q
671 P
Detected: P
672 M
Detected: M
673 V
Detected: V
674 A
Detected: A
675 M
Detected: M
676 S
Detected: S
677 S
Detected: S
678 D
Detected: D
679 E
Detected: E
680 L
Detected: L
681 K
Detected: K
682 A
Detected: A
683 A
Detected: A
684 A
Detected: A
685 G
Detected: G
686 T
Detected: T
687 K
Detected: K
688 Y
Detected: Y
689 T
Detected: T
690 F
Detected: F
691 S
Detected: S
692 P
Detected: P
693 N
Detected: N
694 V
Detected: V
695 M
Detected: M
696 M
Detected: M
697 L
Detected: L
698 K
Detected: K
699 K
Detected: K
700 A
Detected: A
701 V
Detected: V
702 R
Detected: R
703 Q
Detected: Q
704 Y
Detected: Y
705 G
Detected: G
706 I
Detected: I
707 E
Detected: E
708 K
Detected: K
709 L
Detected: L
710 G
Detected: G
711 T
Detected: T
712 V
Detected: V
713 A
Detected: A
714 I
Detected: I
715 P
Detected: P
716 C
Detected: C
717 Q
Detected: Q
718 T
Detected: T
719 M
Detected: M
720 G
Detected: G
721 I
Detected: I
722 R
Detected: R
723 K
Detected: K
724 M
Detected: M
725 Q
Detected: Q
726 T
Detected: T
727 Y
Detected: Y
728 P
Detected: P
729 F
Detected: F
730 G
Detected: G
731 V
Detected: V
732 R
Detected: R
733 F
Detected: F
734 L
Detected: L
735 A
Detected: A
736 D
Detected: D
737 K
Detected: K
738 I
Detected: I
739 K
Detected: K
740 L
Detected: L
741 L
Detected: L
742 V
Detected: V
743 G
Detected: G
744 I
Detected: I
745 Y
Detected: Y
746 C
Detected: C
747 M
Detected: M
748 E
Detected: E
749 N
Detected: N
750 F
Detected: F
751 P
Detected: P
752 Y
Detected: Y
753 T
Detected: T
754 S
Detected: S
755 L
Detected: L
756 Q
Detected: Q
757 T
Detected: T
758 F
Detected: F
759 I
Detected: I
760 C
Detected: C
761 E
Detected: E
762 K
Detected: K
763 L
Detected: L
764 G
Detected: G
765 V
Detected: V
766 S
Detected: S
767 M
Detected: M
768 E
Detected: E
769 L
Detected: L
770 V
Detected: V
771 E
Detected: E
772 K
Detected: K
773 M
Detected: M
774 D
Detected: D
775 I
Detected: I
776 G
Detected: G
777 K
Detected: K
778 G
Detected: G
779 K
Detected: K
780 F
Detected: F
781 W
Detected: W
782 V
Detected: V
783 Y
Detected: Y
784 T
Detected: T
785 Q
Detected: Q
786 D
Detected: D
787 D
Detected: D
788 V
Detected: V
789 L
Detected: L
790 T
Detected: T
791 L
Detected: L
792 P
Detected: P
793 L
Detected: L
794 K
Detected: K
795 E
Detected: E
796 T
Detected: T
797 H
Detected: H
798 G
Detected: G
799 Y
Detected: Y
800 E
Detected: E
801 Q
Detected: Q
802 A
Detected: A
803 G
Detected: G
804 C
Detected: C
805 K
Detected: K
806 I
Detected: I
807 C
Detected: C
808 K
Detected: K
809 D
Detected: D
810 Y
Detected: Y
811 V
Detected: V
812 A
Detected: A
813 E
Detected: E
814 L
Detected: L
815 A
Detected: A
816 D
Detected: D
817 V
Detected: V
818 S
Detected: S
819 T
Detected: T
820 G
Detected: G
821 S
Detected: S
822 V
Detected: V
823 G
Detected: G
824 S
Detected: S
825 P
Detected: P
826 D
Detected: D
827 G
Detected: G
828 W
Detected: W
829 S
Detected: S
830 T
Detected: T
831 V
Detected: V
832 I
Detected: I
833 T
Detected: T
834 R
Detected: R
835 T
Detected: T
836 D
Detected: D
837 A
Detected: A
838 G
Detected: G
839 D
Detected: D
840 S
Detected: S
841 I
Detected: I
842 F
Detected: F
843 K
Detected: K
844 Q
Detected: Q
845 A
Detected: A
846 V
Detected: V
847 E
Detected: E
848 A
Detected: A
849 G
Detected: G
850 L
Detected: L
851 F
Detected: F
852 E
Detected: E
853 T
Detected: T
854 K
Detected: K
855 P
Detected: P
856 I
Detected: I
857 E
Detected: E
858 E
Detected: E
859 V
Detected: V
860 K
Detected: K
861 P
Detected: P
862 G
Detected: G
863 L
Detected: L
864 G
Detected: G
865 L
Detected: L
866 L
Detected: L
867 E
Detected: E
868 K
Detected: K
869 L
Detected: L
870 A
Detected: A
871 A
Detected: A
872 Q
Detected: Q
873 K
Detected: K
874 K
Detected: K
875 E
Detected: E
876 K
Detected: K
877 A
Detected: A
878 E
Detected: E
879 K
Detected: K
880 N
Detected: N
881 I
Detected: I
882 A
Detected: A
883 A
Detected: A
884 R
Detected: R
885 K
Detected: K
886 E
Detected: E
887 M
Detected: M
888 G
Detected: G
889 L
Detected: L
890 P
Detected: P
891 T
Detected: T
892 P
Detected: P
893 F
Detected: F
VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
max_jobs: 8


flags
www.rosettacommons.org 2021-04-20T20:52:25.363712
-in::file::fasta seq.fasta -in::file::alignment alignment.txt -in::file::template_pdb 1tmpA.pdb
urandom', seed=429659882 seed_offset=0 real_seed=429659882
basic.random.init_random_generator: RandomGenerator:init: Normal mode, seed=429659882 RG_type=mt19937
core.chemical.GlobalResidueTypeSet: Finished initializing fa_standard residue type set. Created 984 residue types
core.chemical.GlobalResidueTypeSet: Total time to initialize 1.21 seconds.
core.import_pose.import_pose: File '1tmpA.pdb' automatically determined to be of type PDB
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER:NtermProteinFull 1
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER:NtermProteinFull 1
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 2
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 2
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 2
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 2
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 2
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 4
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 4
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 4
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 4
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 5
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 5
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 5
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 6
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 6
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 6
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 6
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 7
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 7
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 8
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 8
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 8
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 9
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 9
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 9
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 10
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 10
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 16
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 18
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 18
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 18
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 18
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 19
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 19
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 19
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 20
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 20
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 20
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 20
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 22
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 22
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 22
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 23
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 23
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 23
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 23
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 24
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 24
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 24
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 24
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 25
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 25
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 25
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 25
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 25
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 27
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 27
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 27
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 27
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 28
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 28
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 28
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 29
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 29
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 29
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 30
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 30
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 30
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 30
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 30
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 35
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 35
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 36
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 36
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 36
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 36
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 37
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 37
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 37
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 38
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 38
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 38
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 39
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 39
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 39
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 42
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 42
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 42
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 42
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 43
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 43
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 43
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 43
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 43
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 44
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 44
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 44
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 44
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 44
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 45
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 45
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 45
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 45
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 46
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 46
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 46
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 47
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 47
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 47
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 49
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 49
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 49
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 49
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 49
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 50
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 51
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 51
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 51
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 52
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 52
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 52
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 52
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 52
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 53
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 53
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 53
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 54
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 55
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 55
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 55
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 56
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 56
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 56
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 57
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 57
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 57
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 57
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 58
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 58
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 58
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 59
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 59
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 59
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 59
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 59
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 61
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 61
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 61
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 61
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 62
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 62
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 64
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 64
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 64
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 65
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 65
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 66
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 66
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 66
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 67
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 67
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 67
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 67
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 68
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 68
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 68
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 70
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 70
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 70
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 71
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 71
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 71
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 71
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 72
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 73
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 73
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 74
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 74
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 74
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 75
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 75
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 75
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 75
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 75
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 76
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 77
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 77
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 77
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 77
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 78
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 78
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 78
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 78
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 79
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 79
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 79
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 79
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 80
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 80
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 81
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 81
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 81
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 81
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 82
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 82
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 82
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 82
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 83
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 83
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 83
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 83
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 84
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 84
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 84
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 84
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 84
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 85
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 85
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 85
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 86
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 86
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 86
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 87
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 87
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 87
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 87
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 87
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 88
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 91
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 91
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 91
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 91
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 92
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 92
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 92
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 92
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 94
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 94
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 94
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 94
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 94
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 95
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 95
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 95
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 95
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 96
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 96
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 96
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 97
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 97
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 97
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 97
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 98
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 99
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 102
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 102
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 102
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 103
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 103
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 103
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 103
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 104
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 104
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 106
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 107
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 107
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 107
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 107
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 111
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 111
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 111
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 111
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 112
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 112
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 112
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 112
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 113
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 114
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 114
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 114
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 115
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 115
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 115
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 115
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 117
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 117
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 117
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 118
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 118
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 118
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 119
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 119
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 119
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 119
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 119
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 120
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 120
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 120
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 120
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 121
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 121
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 121
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 121
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 122
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 122
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 122
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 122
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 123
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 124
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 124
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 124
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 124
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 125
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 126
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 126
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 126
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 126
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 127
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 127
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 127
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 127
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 128
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 128
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 129
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 129
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 129
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 130
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 130
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 131
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 131
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 131
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 131
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 131
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 132
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 132
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 132
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 132
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 134
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 134
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 134
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 134
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 134
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 135
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 135
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 135
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 135
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 136
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 137
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 137
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 137
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 137
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 137
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 139
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 139
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 139
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 140
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 140
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 140
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 141
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 141
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 141
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 141
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 142
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 142
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 142
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 142
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 143
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 143
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 143
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 144
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 146
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 146
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 146
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 146
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 146
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 148
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 148
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 148
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 148
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 150
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 150
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 150
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 151
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 151
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 152
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 152
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 152
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 152
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 153
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 153
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 153
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 155
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 155
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 155
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 155
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 158
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 158
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 158
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 158
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 159
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 160
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 160
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 160
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 160
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 161
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 161
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 161
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 161
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 162
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 162
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 162
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 162
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 163
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 163
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 163
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 164
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 164
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 164
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 164
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 164
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 165
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 165
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 165
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 165
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 166
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 168
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 168
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 168
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 168
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 168
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 170
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 170
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 170
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 170
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 172
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 174
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 174
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 174
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 174
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 175
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 175
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 175
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 175
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 175
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 176
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 176
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 176
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 176
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 176
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 177
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 177
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 177
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 177
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 178
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 178
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 178
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 178
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 178
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 179
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 179
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 179
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 180
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 180
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 180
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 180
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 180
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 181
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 181
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 181
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 182
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 182
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 182
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 182
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 183
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 183
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 183
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 183
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 183
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 185
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 185
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 185
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 186
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 186
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 186
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 186
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 186
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 187
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 187
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 187
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 187
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 188
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 188
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 188
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 188
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 189
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 189
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 189
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 189
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 191
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 191
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 191
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 191
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 192
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 192
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 192
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 192
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 193
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 193
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 193
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 193
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 193
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 194
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 194
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 194
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 194
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 195
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 195
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 195
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 195
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 195
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 197
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 197
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 197
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 197
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 198
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 198
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 198
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 199
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 199
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 199
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 199
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 199
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 201
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 201
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 201
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 201
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 203
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 203
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 203
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 205
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 205
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 205
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 205
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 206
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 206
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 206
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 206
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 206
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 207
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 207
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 207
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 208
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 208
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 208
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 209
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 209
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 209
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 209
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 210
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 211
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 211
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 213
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 213
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 213
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 213
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 213
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 214
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 214
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 214
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 214
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 217
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 217
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 217
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 217
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 219
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 219
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 219
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 220
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 220
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 220
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 220
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 220
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 222
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 222
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 222
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 222
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 223
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 223
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 223
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 223
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 224
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 224
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 224
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 224
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 227
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 227
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 227
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 228
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 228
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 228
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 228
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 228
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 229
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 229
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 229
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 229
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 230
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 230
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 230
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 230
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 231
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 231
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 231
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 232
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 232
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 232
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 232
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 232
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 233
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 233
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 236
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 236
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 236
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 236
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 237
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 237
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 237
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 237
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 238
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 238
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 238
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 239
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 239
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 239
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 239
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 239
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 240
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 240
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 240
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 240
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 241
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 242
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 242
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 242
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 242
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 242
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 244
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 245
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 245
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 246
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 246
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 247
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 247
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 247
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 248
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 248
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 248
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 248
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 249
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 249
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 249
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 250
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 250
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 250
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 250
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 252
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 252
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 252
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 252
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 255
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 255
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 255
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 255
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 256
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 256
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 256
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 257
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 257
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 257
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 257
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 257
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 258
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 258
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 258
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 260
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 260
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 260
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 262
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 264
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 264
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 264
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 264
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 265
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 265
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 265
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 266
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 266
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 266
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 266
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 266
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 268
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 268
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 268
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 268
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 268
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 271
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 271
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 271
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 271
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 271
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 272
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 272
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 272
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 272
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 272
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 275
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 275
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 275
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 276
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 276
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 276
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 277
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 278
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 278
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 278
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 278
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 278
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 280
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 280
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 280
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 281
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 283
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 284
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 284
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 284
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 284
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 285
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 285
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 285
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 285
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 285
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 286
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 286
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 286
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 286
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 287
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 287
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 287
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 287
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 287
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 288
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 288
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 288
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 289
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 290
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 290
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 290
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 290
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 291
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 291
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 293
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 294
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 294
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 294
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 294
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 295
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 295
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 295
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 295
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 295
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 296
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 296
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 296
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 296
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 297
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 297
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 297
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 297
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 298
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 298
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 298
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 298
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 299
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 299
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 299
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 299
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 299
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 300
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 300
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 300
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 300
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 301
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 301
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 301
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 301
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 302
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 302
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 302
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 303
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 303
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 304
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 305
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 305
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 305
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 306
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 306
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 306
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 308
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 309
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 309
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 309
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 309
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 311
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 311
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 311
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 311
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 312
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 312
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 312
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 312
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 312
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 315
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 315
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 315
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 317
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 317
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 317
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 317
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 317
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 318
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 318
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 318
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 318
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 320
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 320
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 320
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 320
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 322
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 323
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 323
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 323
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 323
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 324
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 324
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 324
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 324
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 324
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 325
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 326
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 326
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 326
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 329
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 329
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 329
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 329
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 330
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 330
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 330
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 330
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 331
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 331
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 331
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 333
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 333
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 333
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 333
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 334
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 335
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 335
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 335
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 335
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 335
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 336
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 336
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 336
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 337
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 337
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 337
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 337
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 337
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 338
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 338
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 338
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 338
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 340
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 340
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 340
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 340
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 340
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 341
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 341
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 341
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 341
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 342
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 342
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 342
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 342
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 342
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 345
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 345
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 346
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 347
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 347
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 347
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 347
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 348
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 348
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 348
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 349
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 349
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 349
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 350
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 350
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 350
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 351
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 351
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 351
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 353
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 353
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 353
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 353
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 354
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 354
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 354
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 354
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 355
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 355
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 355
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 356
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 356
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 356
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 357
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 357
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 357
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 357
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 359
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 359
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 359
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 360
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 361
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 361
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 361
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 362
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 362
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 362
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 362
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 362
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 367
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 367
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 367
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 367
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 367
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 370
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 370
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 370
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 372
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 372
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 372
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 373
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 373
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 373
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 373
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 375
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 377
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 377
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 377
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 377
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 378
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 378
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 378
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 379
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 379
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 380
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 380
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 380
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 380
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 381
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 381
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 382
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 382
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 383
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 384
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 384
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 384
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS:NtermProteinFull 386
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS:NtermProteinFull 386
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS:NtermProteinFull 386
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS:NtermProteinFull 386
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS:NtermProteinFull 386
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 388
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 388
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 388
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 388
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 391
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 391
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 391
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 391
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 393
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 393
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 393
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 393
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 394
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 394
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 396
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 396
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 397
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 397
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 397
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 399
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 399
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 399
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 399
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 400
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 401
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 401
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 401
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 401
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 402
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 402
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 403
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 403
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 403
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 403
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 404
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 404
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 404
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 405
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 405
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 405
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 405
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 405
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 406
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 406
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 406
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 406
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 408
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 408
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 408
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 408
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 409
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 409
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 409
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 409
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 410
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 410
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 410
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 410
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 411
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 412
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 412
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 412
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 412
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 412
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 413
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 413
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 413
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 413
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 414
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 414
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 414
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 414
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 415
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 415
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 415
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 416
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 416
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 416
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 416
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 417
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 417
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 417
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 417
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 418
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 418
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 418
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 419
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 419
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 419
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 419
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 420
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 420
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 420
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 420
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 421
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 421
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 421
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 424
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 424
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 424
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 424
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 424
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 425
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 425
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 425
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 426
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 426
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 426
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 426
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 427
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 427
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 427
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 428
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 428
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 428
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 428
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 429
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 429
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 429
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 429
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 431
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 431
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 431
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 431
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 431
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 432
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 432
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 432
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 432
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 433
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 433
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 433
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 434
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 434
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 434
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 434
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 434
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 435
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 435
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 435
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 435
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 436
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 436
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 436
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 436
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 437
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 437
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 437
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 437
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 438
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 439
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 439
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 439
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 439
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 440
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 440
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 440
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 441
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 441
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 441
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 441
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 441
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 443
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 443
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 444
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 444
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 444
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 445
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 445
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 446
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 446
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 446
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 446
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 447
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 447
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 447
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 447
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 447
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 448
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 448
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 448
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 448
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 449
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 449
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 449
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 449
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 449
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 451
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 451
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 452
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 452
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 452
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 452
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 454
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 454
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 454
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 454
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 454
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 455
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 455
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 455
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 455
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 456
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 456
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 456
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 456
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 456
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 457
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 457
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 457
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 457
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 457
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 458
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 458
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 458
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 458
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 460
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 460
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 460
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 460
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 460
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 461
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 461
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 461
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 461
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 461
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 462
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 463
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 463
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 463
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 463
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 463
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 464
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 464
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 464
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 464
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 465
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 465
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 465
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 466
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 466
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 467
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 470
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 470
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 471
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 471
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 472
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 473
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 474
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 474
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 474
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 476
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 476
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 478
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 478
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 478
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 481
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 481
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 485
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 485
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 485
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 485
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 485
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 486
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 486
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 486
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 486
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 486
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 487
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 488
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 488
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 488
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 488
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 488
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 489
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 489
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 489
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 490
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 490
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 492
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 492
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 492
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 492
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 492
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 493
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 493
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 495
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 495
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 495
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 496
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 496
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 496
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 497
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 497
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 497
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 497
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 498
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 499
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 499
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 499
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 499
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 500
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 500
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 500
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 500
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 501
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 501
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 501
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 501
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 502
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 502
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 502
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 502
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 503
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 503
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 503
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 504
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 504
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 504
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 504
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 505
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 505
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 505
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 505
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 506
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 507
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 507
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 507
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 507
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 508
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 508
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 508
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 510
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 510
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 511
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 511
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 511
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 512
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 512
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 512
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 513
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 513
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 514
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 514
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 514
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 515
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 515
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 515
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 515
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 515
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 516
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 516
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 516
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 516
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 517
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 517
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 517
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 517
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 518
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 519
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 519
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 519
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 519
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 519
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 520
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 520
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 520
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 521
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 521
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 521
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 522
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 522
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 522
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 523
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 524
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 524
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 524
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 524
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 525
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 525
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 525
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 525
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 526
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 526
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 526
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 526
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 527
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 527
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 527
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 527
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 528
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 528
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 528
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 528
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 529
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 529
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 529
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 529
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 530
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 530
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 530
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 530
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 532
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 532
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 532
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 532
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 533
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 533
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 533
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 533
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 533
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 534
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 534
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 534
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 535
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 535
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 535
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 535
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 536
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 536
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 536
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 536
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 537
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 537
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 537
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 537
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 538
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 538
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 538
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 538
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 539
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 542
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 542
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 542
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 543
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 543
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 543
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 543
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 543
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 544
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 545
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 545
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 547
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 547
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 548
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 548
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 548
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 548
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 549
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 549
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 549
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 549
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 550
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 550
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 550
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 550
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 550
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 551
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 551
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 551
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 552
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 552
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 552
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 552
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 552
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 553
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 553
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 553
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 554
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 554
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 554
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 555
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 555
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 555
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 555
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 556
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 556
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 556
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 556
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 556
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 558
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 558
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 558
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 558
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 559
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 559
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 560
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 560
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 560
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 560
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 562
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 562
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 564
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 564
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 564
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 565
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 565
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 566
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 567
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 567
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 567
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 567
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 568
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 569
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 569
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 570
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 570
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 570
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 570
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 570
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 571
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 571
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 571
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 573
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 574
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 574
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 574
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 574
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 575
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 575
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 575
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 575
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 576
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 576
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 576
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 576
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 577
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 577
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 577
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 578
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 578
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 578
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 578
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 581
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 581
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 581
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 582
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 582
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 582
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 582
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 582
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 583
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 583
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 583
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 583
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 584
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 584
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 584
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 584
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 585
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 585
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 586
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 586
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 586
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 586
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 588
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 588
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 589
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 589
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 589
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 589
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 590
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 590
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 590
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 590
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 590
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 591
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 591
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 593
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 593
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 593
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 593
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 594
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 594
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 596
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 596
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 596
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 597
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 597
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 597
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 597
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 597
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 598
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 598
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 599
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 599
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 599
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 601
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 601
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 604
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 604
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 604
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 605
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 605
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 605
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 605
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 605
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 606
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 606
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 606
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 606
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 606
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 607
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 607
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 607
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 607
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 607
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 608
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 608
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 608
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 608
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 609
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 609
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 609
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 609
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 609
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 610
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 610
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 610
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 610
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 610
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 611
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 611
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 611
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 611
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 611
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU:CtermProteinFull 612
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU:CtermProteinFull 612
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU:CtermProteinFull 612
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU:CtermProteinFull 612
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL:NtermProteinFull 613
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL:NtermProteinFull 613
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL:NtermProteinFull 613
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 614
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 614
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 614
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 614
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 616
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 616
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 616
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 618
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 618
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 618
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 618
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 618
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 619
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 619
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 619
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 619
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 619
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 620
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 620
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 620
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 620
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 621
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 621
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 621
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 622
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 622
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 623
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 625
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 625
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 626
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 626
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 626
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 627
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 627
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 627
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 627
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 629
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 629
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 629
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 629
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 629
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 630
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 630
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 630
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 630
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 631
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 631
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 631
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 631
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 631
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 632
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 632
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 632
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 632
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 632
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 633
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 633
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 633
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 633
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 634
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 635
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 635
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 635
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 635
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 635
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 636
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 636
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 636
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 636
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 639
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 639
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 639
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 639
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 640
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 640
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 640
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 641
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 641
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 641
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 643
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 643
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 643
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 643
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 644
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 644
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 644
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 644
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 645
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 647
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 648
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 648
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 648
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 648
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 649
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 649
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 649
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 649
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 650
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 650
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 650
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 650
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 650
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 652
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 652
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 652
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 652
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 653
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 653
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 653
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 653
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 654
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 654
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 654
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 654
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 654
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 656
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 657
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 657
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 657
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 658
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 658
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 658
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 659
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 661
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 661
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 661
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 663
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 663
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 663
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 663
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 663
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 664
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 664
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 664
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 664
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 664
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 667
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 667
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 667
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 667
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 667
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 668
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 668
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 668
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 669
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 669
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 669
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 669
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 669
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 670
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 670
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 670
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 671
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 671
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 671
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 671
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 672
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 672
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 672
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 673
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 674
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 674
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 674
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 674
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 675
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 675
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 676
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 676
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 677
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 677
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 677
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 677
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 678
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 678
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 678
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 678
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 678
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 679
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 679
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 679
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 679
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 680
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 680
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 680
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 680
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 680
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 681
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 682
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 683
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 685
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 685
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 685
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 686
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 686
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 686
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 686
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 686
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 688
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 688
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 688
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 690
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 690
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 691
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 691
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 691
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 692
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 692
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 692
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 692
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 693
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 693
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 693
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 694
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 694
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 694
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 694
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 695
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 695
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 695
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 695
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 696
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 696
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 696
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 696
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 697
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 697
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 697
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 697
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 697
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 698
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 698
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 698
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 698
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 698
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 699
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 700
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 700
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 700
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 702
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 702
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 702
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 702
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 702
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 705
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 705
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 705
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 705
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 706
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 706
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 706
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 706
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 706
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 707
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 707
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 707
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 707
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 707
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 708
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 708
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 708
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 708
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 710
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 710
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 710
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 711
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 711
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 711
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 712
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 713
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 713
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 713
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 713
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 714
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 714
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 714
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 715
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 715
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 716
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 716
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 716
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 716
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 716
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 717
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 717
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 717
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 718
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 718
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 718
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 718
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 720
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 720
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 720
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 720
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 722
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 722
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 722
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 722
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 722
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 723
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 723
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 723
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 723
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 724
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 724
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 724
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 724
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 724
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 725
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 725
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 725
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 727
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 727
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 727
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 730
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 730
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 730
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 733
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 733
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 733
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 733
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 734
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 735
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 735
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 735
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 735
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 736
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 736
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 736
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 736
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 736
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 737
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 737
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 737
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 737
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 738
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 738
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 738
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 738
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 738
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 739
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 739
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 739
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 739
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 740
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 740
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 740
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 740
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 741
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 741
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 741
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 743
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 743
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 743
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 743
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 745
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 745
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 746
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 746
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 746
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 746
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 747
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 747
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 747
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 747
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 747
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 748
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 748
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 748
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 748
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 750
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 750
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 750
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 752
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 752
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 752
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 753
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 753
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 754
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 754
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 754
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 754
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 755
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 755
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 755
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 755
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 755
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 756
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 756
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 756
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 758
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 758
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 758
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 758
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 759
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 759
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 760
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 760
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 760
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 760
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 760
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 761
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 761
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 761
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 761
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 761
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 762
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 762
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 762
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 762
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 764
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 764
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 764
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 765
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 765
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 766
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 766
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 766
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 766
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 767
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 767
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 767
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 767
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 767
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 768
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 768
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 768
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 768
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 769
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 769
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 769
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 770
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 770
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 770
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 770
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 770
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 771
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 771
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 771
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 771
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 771
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 772
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 772
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 772
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 772
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 773
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 773
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 773
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 773
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 774
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 774
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 774
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 774
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 776
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 776
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 776
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 776
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 776
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 778
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 778
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 778
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 778
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 778
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 781
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 781
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 781
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 783
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 783
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 783
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 784
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 784
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 784
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 784
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 784
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 785
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 785
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 785
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 785
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 786
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 786
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 786
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 786
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 787
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 787
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 787
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 788
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 788
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 788
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 788
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 789
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 789
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 789
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 790
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 790
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 790
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 790
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 791
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 791
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 791
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 792
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 792
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 792
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 792
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 793
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 793
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 793
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 793
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 793
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 794
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 794
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 794
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 794
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 794
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 795
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 795
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 795
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 799
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 799
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 799
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 799
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 799
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 800
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 800
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 800
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 800
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 800
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 801
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 803
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 803
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 804
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 804
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 804
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 804
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 804
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 805
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 805
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 805
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 805
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 806
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 806
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 807
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 807
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 807
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 807
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 807
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 808
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 808
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 808
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 808
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 810
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 810
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 810
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 811
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 812
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 812
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 812
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 812
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 812
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 813
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 813
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 813
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 813
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 814
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 815
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 815
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 815
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 815
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 816
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 816
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 816
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 817
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 817
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 818
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 818
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 818
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 820
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 820
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 821
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 821
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 821
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 823
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 823
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 824
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 824
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 824
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 825
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 825
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 825
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 825
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 828
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 828
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 829
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 829
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 829
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 830
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 830
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 830
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 831
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 831
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 831
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 831
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 832
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 832
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 832
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 834
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 834
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 834
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 835
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 835
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 835
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 835
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 836
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 838
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 838
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 838
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 838
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 839
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 839
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 840
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 840
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 840
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 840
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 842
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 842
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 842
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 842
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 842
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 843
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 843
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 843
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 843
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 843
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 844
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 845
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 845
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 845
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 846
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 846
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 846
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 846
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 846
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 847
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 849
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 849
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 849
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 849
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 851
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 851
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 851
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 851
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 851
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 852
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 852
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 852
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 853
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 853
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 853
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 853
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 853
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 854
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 854
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 854
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 855
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 855
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 855
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 855
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 856
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 856
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 856
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 856
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 856
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 857
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 857
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 857
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 857
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 857
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 858
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 858
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 858
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 859
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 859
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 859
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 859
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 859
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 860
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 860
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 860
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 862
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 862
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 862
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 862
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 864
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 864
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 864
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 864
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 865
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 865
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 865
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 865
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 866
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 866
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 866
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 866
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 866
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 867
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 867
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 867
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 867
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 867
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 868
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 868
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 868
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 868
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 869
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 870
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 871
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 871
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 871
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 871
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 871
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 872
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 872
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 872
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 872
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 872
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 873
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 873
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 873
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 873
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 873
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 874
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 874
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 874
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 874
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 874
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 875
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 875
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 875
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 875
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 875
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 876
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 877
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 877
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 877
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 877
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 877
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 878
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 878
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 878
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 878
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 878
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 879
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 879
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 879
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 879
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 880
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 880
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 880
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 880
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 881
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 882
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 884
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 884
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 884
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 884
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 884
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 885
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 885
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 885
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 885
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 885
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 886
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 886
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 886
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 886
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 888
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 888
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 888
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 888
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 889
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 889
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 889
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 890
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 890
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 890
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 891
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 891
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 891
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE:CtermProteinFull 892
core.pack.pack_missing_sidechains: packing residue number 1 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 2 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 3 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 4 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 5 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 6 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 7 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 8 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 9 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 10 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 11 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 12 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 13 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 15 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 16 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 17 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 18 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 19 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 20 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 21 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 22 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 23 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 24 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 25 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 27 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 28 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 29 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 30 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 32 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 33 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 34 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 35 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 36 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 37 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 38 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 39 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 40 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 42 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 43 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 44 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 45 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 46 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 47 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 49 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 50 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 51 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 52 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 53 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 54 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 55 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 56 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 57 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 58 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 59 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 60 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 61 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 62 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 64 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 65 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 66 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 67 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 68 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 69 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 70 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 71 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 72 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 73 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 74 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 75 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 76 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 77 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 78 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 79 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 80 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 81 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 82 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 83 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 84 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 85 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 86 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 87 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 88 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 90 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 91 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 92 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 93 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 94 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 95 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 96 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 97 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 98 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 99 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 100 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 101 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 102 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 103 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 104 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 105 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 106 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 107 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 108 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 109 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 110 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 111 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 112 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 113 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 114 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 115 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 116 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 117 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 118 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 119 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 120 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 121 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 122 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 123 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 124 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 125 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 126 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 127 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 128 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 129 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 130 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 131 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 132 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 133 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 134 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 135 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 136 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 137 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 138 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 139 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 140 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 141 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 142 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 143 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 144 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 146 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 148 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 149 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 150 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 151 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 152 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 153 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 154 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 155 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 158 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 159 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 160 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 161 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 162 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 163 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 164 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 165 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 166 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 167 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 168 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 169 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 170 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 171 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 172 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 173 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 174 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 175 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 176 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 177 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 178 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 179 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 180 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 181 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 182 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 183 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 184 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 185 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 186 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 187 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 188 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 189 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 191 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 192 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 193 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 194 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 195 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 197 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 198 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 199 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 201 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 203 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 204 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 205 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 206 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 207 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 208 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 209 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 210 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 211 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 212 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 213 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 214 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 215 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 217 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 218 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 219 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 220 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 221 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 222 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 223 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 224 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 225 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 226 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 227 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 228 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 229 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 230 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 231 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 232 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 233 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 234 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 235 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 236 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 237 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 238 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 239 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 240 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 241 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 242 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 243 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 244 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 245 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 246 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 247 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 248 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 249 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 250 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 251 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 252 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 254 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 255 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 256 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 257 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 258 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 260 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 261 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 262 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 263 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 264 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 265 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 266 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 267 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 268 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 270 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 271 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 272 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 273 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 275 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 276 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 277 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 278 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 279 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 280 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 281 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 282 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 283 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 284 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 285 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 286 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 287 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 288 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 289 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 290 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 291 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 292 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 293 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 294 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 295 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 296 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 297 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 298 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 299 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 300 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 301 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 302 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 303 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 304 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 305 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 306 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 307 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 308 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 309 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 310 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 311 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 312 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 313 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 315 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 317 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 318 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 320 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 322 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 323 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 324 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 325 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 326 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 327 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 329 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 330 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 331 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 332 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 333 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 334 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 335 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 336 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 337 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 338 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 340 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 341 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 342 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 343 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 344 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 345 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 346 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 347 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 348 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 349 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 350 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 351 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 352 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 353 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 354 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 355 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 356 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 357 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 359 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 360 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 361 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 362 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 364 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 365 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 366 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 367 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 368 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 370 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 371 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 372 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 373 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 374 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 375 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 376 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 377 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 378 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 379 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 380 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 381 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 382 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 383 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 384 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 385 because of missing atom number 6 atom name CB
core.pack.pack_missing_sidechains: packing residue number 386 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 387 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 388 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 390 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 391 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 392 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 393 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 394 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 396 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 397 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 399 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 400 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 401 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 402 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 403 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 404 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 405 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 406 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 407 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 408 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 409 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 410 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 411 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 412 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 413 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 414 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 415 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 416 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 417 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 418 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 419 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 420 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 421 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 422 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 424 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 425 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 426 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 427 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 428 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 429 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 430 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 431 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 432 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 433 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 434 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 435 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 436 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 437 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 438 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 439 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 440 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 441 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 443 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 444 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 445 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 446 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 447 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 448 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 449 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 450 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 451 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 452 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 453 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 454 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 455 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 456 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 457 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 458 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 459 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 460 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 461 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 462 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 463 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 464 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 465 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 466 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 467 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 468 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 470 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 471 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 472 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 473 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 474 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 476 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 477 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 478 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 479 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 480 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 481 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 482 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 485 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 486 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 487 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 488 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 489 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 490 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 491 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 492 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 493 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 494 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 495 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 496 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 497 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 498 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 499 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 500 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 501 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 502 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 503 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 504 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 505 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 506 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 507 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 508 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 510 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 511 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 512 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 513 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 514 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 515 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 516 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 517 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 518 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 519 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 520 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 521 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 522 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 523 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 524 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 525 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 526 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 527 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 528 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 529 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 530 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 531 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 532 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 533 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 534 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 535 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 536 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 537 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 538 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 539 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 541 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 542 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 543 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 544 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 545 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 547 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 548 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 549 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 550 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 551 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 552 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 553 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 554 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 555 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 556 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 558 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 559 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 560 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 562 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 564 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 565 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 566 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 567 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 568 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 569 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 570 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 571 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 572 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 573 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 574 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 575 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 576 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 577 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 578 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 580 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 581 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 582 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 583 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 584 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 585 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 586 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 587 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 588 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 589 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 590 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 591 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 593 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 594 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 595 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 596 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 597 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 598 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 599 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 600 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 601 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 602 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 603 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 604 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 605 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 606 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 607 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 608 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 609 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 610 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 611 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 612 because of missing atom number 6 atom name CB
core.pack.pack_missing_sidechains: packing residue number 613 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 614 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 616 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 617 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 618 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 619 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 620 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 621 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 622 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 623 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 624 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 625 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 626 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 627 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 628 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 629 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 630 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 631 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 632 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 633 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 634 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 635 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 636 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 639 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 640 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 641 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 643 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 644 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 645 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 646 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 647 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 648 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 649 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 650 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 652 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 653 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 654 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 656 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 657 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 658 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 659 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 661 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 663 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 664 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 665 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 666 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 667 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 668 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 669 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 670 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 671 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 672 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 673 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 674 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 675 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 676 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 677 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 678 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 679 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 680 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 681 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 682 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 683 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 685 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 686 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 687 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 688 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 689 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 690 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 691 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 692 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 693 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 694 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 695 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 696 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 697 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 698 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 699 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 700 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 701 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 702 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 703 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 705 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 706 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 707 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 708 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 710 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 711 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 712 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 713 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 714 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 715 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 716 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 717 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 718 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 720 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 721 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 722 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 723 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 724 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 725 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 726 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 727 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 728 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 730 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 731 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 732 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 733 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 734 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 735 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 736 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 737 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 738 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 739 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 740 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 741 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 743 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 744 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 745 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 746 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 747 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 748 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 749 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 750 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 751 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 752 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 753 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 754 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 755 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 756 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 757 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 758 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 759 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 760 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 761 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 762 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 764 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 765 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 766 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 767 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 768 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 769 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 770 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 771 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 772 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 773 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 774 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 776 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 778 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 779 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 780 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 781 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 782 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 783 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 784 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 785 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 786 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 787 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 788 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 789 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 790 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 791 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 792 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 793 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 794 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 795 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 796 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 798 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 799 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 800 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 801 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 803 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 804 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 805 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 806 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 807 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 808 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 809 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 810 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 811 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 812 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 813 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 814 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 815 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 816 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 817 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 818 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 820 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 821 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 823 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 824 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 825 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 827 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 828 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 829 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 830 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 831 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 832 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 833 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 834 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 835 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 836 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 838 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 839 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 840 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 841 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 842 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 843 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 844 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 845 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 846 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 847 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 849 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 850 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 851 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 852 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 853 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 854 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 855 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 856 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 857 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 858 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 859 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 860 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 862 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 864 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 865 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 866 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 867 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 868 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 869 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 870 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 871 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 872 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 873 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 874 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 875 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 876 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 877 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 878 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 879 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 880 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 881 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 882 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 883 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 884 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 885 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 886 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 888 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 889 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 890 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 891 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 892 because of missing atom number 6 atom name CB
core.pack.task: Packer task: initialize from command line()
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.scoring.etable: Starting energy table calculation
rep split to bottom of energy well
core.scoring.etable: smooth_etable: spline smoothing lj etables (maxdis = 6)
core.scoring.etable: smooth_etable: spline smoothing solvation etables (max_dis = 6)
core.scoring.etable: Finished calculating energy tables.
HBPoly1D.csv
HBFadeIntervals.csv
HBEval.csv
DonStrength.csv
AccStrength.csv
all.ramaProb
prepro.ramaProb
omega_ppdep.all.txt
omega_ppdep.gly.txt
omega_ppdep.pro.txt
omega_ppdep.valile.txt
P_AA
P_AA_n
core.scoring.P_AA: shapovalov_lib::shap_p_aa_pp_smooth_level of 1( aka low_smooth ) got activated.
a20.prop
elec_cp_reps.dat
core.scoring.elec.util: Read 40 countpair representative atoms
core.pack.dunbrack.RotamerLibrary: shapovalov_lib_fixes_enable option is true.
core.pack.dunbrack.RotamerLibrary: shapovalov_lib::shap_dun10_smooth_level of 1( aka lowest_smooth ) got activated.
Dunbrack10.lib.bin
Dunbrack10.lib.bin'.
core.pack.dunbrack.RotamerLibrary: Dunbrack 2010 library took 0.15 seconds to load from binary
core.pack.pack_rotamers: built 7225 rotamers at 819 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
893
partial_thread: 1XXX_ 1 SERIVISPTSRQEGHAELVMEVDDEGIVTKGRYFSITPVRGLEKMVTGKAPETAPVMVQRICGVCPIPHTLASVEAIDDSLDIEVPKAGRLLRELTLAAHHVNSHAIHHFLIAPDFVPENLMADAINSVSEIRKNAQYVVDMVAGEGIHPSDVRIGGMADNITELARKRLYARLKQLKPKVNEHVELMIGLIEDKGLPEGLGVHNQPTLASHQIYGDRTKFDLDRFTEIMPESWYDDPEIAKRACSTIPLYDGRNVEVGPRARMVEFQGFKERGVVAQHVARALEMKTALSRAIEILDELDTSAPVRADFDERGTGKLGIGAIEAPRGLDVHMAKVENGKIQFYSALVPTTWNIPTMGPATEGFHHEYGPHVIRAYDPCLSCATHKPRIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKELVLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
partial_thread: 1tmpA_thread 1 SERIVISPTSRQEGHAELVMEVDDEGIVTKGRYFSITPVRGLEKMVTGKAPETAPVMVQRICGVCPIPHTLASVEAIDDSLDIEVPKAGRLLRELTLAAHHVNSHAIHHFLIAPDFVPENLMADAINSVSEIRKNAQYVVDMVAGEGIHPSDVRIGGMADNITELARKRLYARLKQLKPKVNEHVELMIGLIEDKGLPEGLGVHNQPTLASHQIYGDRTKFDLDRFTEIMPESWYDDPEIAKRACSTIPLYDGRNVEVGPRARMVEFQGFKERGVVAQHVARALEMKTALSRAIEILDELDTSAPVRADFDERGTGKLGIGAIEAPRGLDVHMAKVENGKIQFYSALVPTTWNIPTMGPATEGFHHEYGPHVIRAYDPCLSCATHK-RIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKELVLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
partial_thread:
partial_thread: id 1tmpA_thread => 1tmpA
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 2539 rotamers at 892 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 1 SER:NtermProteinFull SER:NtermProteinFull
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 7 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 9 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 10 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 29 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 35 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 37 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 47 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 53 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 62 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 65 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 70 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 73 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 80 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 96 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 104 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 128 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 130 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 151 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 163 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 171 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 208 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 215 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 219 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 2 position: 227 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 245 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 246 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 247 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 251 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 288 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 291 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 302 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 303 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 315 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 345 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 350 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 351 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 356 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 361 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 379 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 381 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 382 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 384 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 390 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 394 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 396 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 397 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 402 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 404 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 407 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 415 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 422 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 425 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 443 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 445 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 451 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 466 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 470 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 474 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 476 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 478 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 480 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 481 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 490 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 493 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 513 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 520 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 2 position: 542 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 545 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 547 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 551 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 564 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 565 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 571 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 577 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 585 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 594 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 598 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 601 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 616 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 622 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 626 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 641 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 646 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 675 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 676 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 685 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 688 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 690 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 703 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 710 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 717 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 725 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 744 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 745 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 752 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 753 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 756 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 759 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 765 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 783 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 789 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 795 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 798 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 803 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 806 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 817 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 818 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 820 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 828 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 829 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 832 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 834 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 839 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 2 position: 852 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 890 THR THR
max_jobs: 8
CM_DMonly.log
CM_DMonly.log
INFO : DAQ scoring for Full-atom models
S_singletgt_0001.daq
S_singletgt_0002.daq
S_singletgt_0003.daq
S_singletgt_0004.daq
S_singletgt_0005.daq
S_singletgt_0001.daq
S_singletgt_0002.daq
S_singletgt_0003.daq
S_singletgt_0004.daq
S_singletgt_0005.daq
S_singletgt_0001.daq
S_singletgt_0002.daq
S_singletgt_0003.daq
S_singletgt_0004.daq
S_singletgt_0005.daq
S_singletgt_0001.daq
S_singletgt_0002.daq
S_singletgt_0003.daq
S_singletgt_0004.daq
S_singletgt_0005.daq
max_jobs: 8
S_singletgt_0001.daq
S_singletgt_0001.daq
WARNING: Use StructureBlurrer.gaussian_blur_real_space_box()to blured a map with a user defined defined cubic box
S_singletgt_0001.pdb 2.102520372526193
%s total different chains : {'C', 'B', 'A'}
[['C', ' N ', 188.805, 82.886, 106.132], ['C', ' CA ', 187.697, 83.853, 106.255], ['C', ' C ', 187.024, 83.727, 107.649], ['C', ' O ', 186.525, 82.648, 107.989], ['C', ' CB ', 186.627, 83.616, 105.076], ['C', ' CG1', 185.336, 84.586, 105.185], ['C', ' CG2', 187.304, 83.874, 103.626], ['C', ' H ', 189.212, 82.966, 105.211], ['C', ' H ', 189.52, 83.045, 106.827], ['C', ' H ', 188.432, 81.952, 106.25], ['C', ' HA ', 188.121, 84.857, 106.126], ['C', ' HB ', 186.256, 82.574, 105.14], ['C', ' HG1', 184.635, 84.37, 104.374], ['C', ' HG1', 184.81, 84.446, 106.132], ['C', ' HG1', 185.631, 85.601, 105.1], ['C', ' HG2', 186.568, 83.689, 102.835], ['C', ' HG2', 187.65, 84.912, 103.545], ['C', ' HG2', 188.151, 83.209, 103.46]]
[['C', ' N ', 187.033, 84.828, 108.434], ['C', ' CA ', 186.382, 84.957, 109.731], ['C', ' C ', 184.891, 85.245, 109.466], ['C', ' O ', 184.063, 84.432, 109.882], ['C', ' CB ', 187.089, 86.018, 110.583], ['C', ' CG ', 188.247, 85.51, 111.477], ['C', ' CD1', 189.333, 84.853, 110.651], ['C', ' CD2', 188.841, 86.657, 112.193], ['C', ' H ', 187.479, 85.651, 108.065], ['C', ' HA ', 186.446, 84.012, 110.276], ['C', ' HB ', 187.531, 86.751, 109.919], ['C', ' HB ', 186.354, 86.507, 111.215], ['C', ' HG ', 187.86, 84.784, 112.196], ['C', ' HD1', 190.138, 84.518, 111.312], ['C', ' HD1', 188.937, 83.993, 110.121], ['C', ' HD1', 189.732, 85.568, 109.938], ['C', ' HD2', 189.637, 86.288, 112.822], ['C', ' HD2', 189.241, 87.368, 111.474], ['C', ' HD2', 188.107, 87.142, 112.8]]
[['C', ' N ', 184.497, 86.314, 108.718], ['C', ' CA ', 185.232, 87.51, 108.259], ['C', ' C ', 186.08, 87.469, 106.989], ['C', ' O ', 187.196, 86.961, 106.992], ['C', ' H ', 183.509, 86.321, 108.477], ['C', ' HA ', 184.488, 88.282, 108.1], ['C', ' HA ', 185.828, 87.895, 109.073]]
[['C', ' N ', 185.643, 88.147, 105.95], ['C', ' CA ', 186.5, 88.338, 104.791], ['C', ' C ', 187.461, 89.41, 105.212], ['C', ' O ', 187.041, 90.354, 105.877], ['C', ' CB ', 185.717, 88.793, 103.545], ['C', ' OG1', 184.731, 87.811, 103.202], ['C', ' CG2', 186.671, 88.946, 102.371], ['C', ' H ', 184.709, 88.53, 105.936], ['C', ' HA ', 187.059, 87.428, 104.572], ['C', ' HB ', 185.223, 89.743, 103.748], ['C', ' HG1', 184.139, 88.174, 102.536], ['C', ' HG2', 186.106, 89.257, 101.494], ['C', ' HG2', 187.428, 89.696, 102.586], ['C', ' HG2', 187.154, 87.991, 102.171]]
[['C', ' N ', 188.74, 89.28, 104.912], ['C', ' CA ', 189.633, 90.341, 105.335], ['C', ' C ', 190.808, 90.552, 104.439], ['C', ' O ', 191.173, 89.682, 103.648], ['C', ' CB ', 190.137, 90.099, 106.745], ['C', ' CG ', 190.996, 88.904, 106.909], ['C', ' CD1', 192.354, 89.011, 106.742], ['C', ' CD2', 190.438, 87.701, 107.253], ['C', ' CE1', 193.153, 87.923, 106.909], ['C', ' CE2', 191.235, 86.601, 107.425], ['C', ' CZ ', 192.591, 86.71, 107.253], ['C', ' OH ', 193.405, 85.619, 107.434], ['C', ' H ', 189.08, 88.486, 104.386], ['C', ' HA ', 189.079, 91.27, 105.326], ['C', ' HB ', 190.712, 90.969, 107.061], ['C', ' HB ', 189.288, 89.998, 107.412], ['C', ' HD1', 192.795, 89.954, 106.484], ['C', ' HD2', 189.376, 87.626, 107.394], ['C', ' HE1', 194.23, 88.015, 106.776], ['C', ' HE2', 190.79, 85.646, 107.703], ['C', ' HH ', 192.892, 84.886, 107.786]]
[['C', ' N ', 191.412, 91.727, 104.584], ['C', ' CA ', 192.612, 92.066, 103.866], ['C', ' C ', 193.823, 91.944, 104.791], ['C', ' O ', 194.859, 91.415, 104.386], ['C', ' CB ', 192.474, 93.475, 103.3], ['C', ' CG ', 193.592, 93.93, 102.41], ['C', ' CD ', 193.237, 95.277, 101.77], ['C', ' CE ', 194.296, 95.741, 100.785], ['C', ' NZ ', 193.934, 97.052, 100.171], ['C', ' H ', 191.04, 92.416, 105.235], ['C', ' HA ', 192.743, 91.363, 103.044], ['C', ' HB ', 191.547, 93.546, 102.738], ['C', ' HB ', 192.408, 94.185, 104.129], ['C', ' HG ', 194.505, 94.042, 103.003], ['C', ' HG ', 193.77, 93.185, 101.633], ['C', ' HD ', 192.284, 95.204, 101.239], ['C', ' HD ', 193.133, 96.036, 102.546], ['C', ' HE ', 195.25, 95.842, 101.299], ['C', ' HE ', 194.394, 94.998, 99.996], ['C', ' HZ ', 194.633, 97.349, 99.522], ['C', ' HZ ', 193.025, 97.002, 99.683], ['C', ' HZ ', 193.838, 97.758, 100.903]]
[['C', ' N ', 193.693, 92.424, 106.034], ['C', ' CA ', 194.82, 92.351, 106.972], ['C', ' C ', 194.417, 92.315, 108.448], ['C', ' O ', 193.541, 93.067, 108.884], ['C', ' CB ', 195.771, 93.517, 106.737], ['C', ' CG ', 197.03, 93.462, 107.571], ['C', ' CD ', 197.999, 94.533, 107.233], ['C', ' OE1', 197.659, 95.42, 106.483], ['C', ' OE2', 199.094, 94.482, 107.722], ['C', ' H ', 192.804, 92.851, 106.305], ['C', ' HA ', 195.366, 91.43, 106.763], ['C', ' HB ', 196.06, 93.551, 105.686], ['C', ' HB ', 195.26, 94.449, 106.966], ['C', ' HG ', 196.763, 93.575, 108.615], ['C', ' HG ', 197.502, 92.49, 107.445]]
[['C', ' N ', 195.078, 91.465, 109.253], ['C', ' CA ', 194.74, 91.46, 110.673], ['C', ' C ', 195.948, 91.729, 111.554], ['C', ' O ', 196.975, 91.037, 111.461], ['C', ' CB ', 194.142, 90.131, 111.126], ['C', ' CG1', 192.973, 89.816, 110.261], ['C', ' CG2', 193.676, 90.301, 112.606], ['C', ' CD1', 192.293, 88.499, 110.517], ['C', ' H ', 195.799, 90.859, 108.881], ['C', ' HA ', 194.016, 92.249, 110.868], ['C', ' HB ', 194.868, 89.333, 111.031], ['C', ' HG1', 192.316, 90.6, 110.332], ['C', ' HG1', 193.32, 89.784, 109.249], ['C', ' HG2', 193.227, 89.406, 112.974], ['C', ' HG2', 194.482, 90.546, 113.24], ['C', ' HG2', 192.962, 91.107, 112.668], ['C', ' HD1', 191.482, 88.381, 109.817], ['C', ' HD1', 193.007, 87.692, 110.386], ['C', ' HD1', 191.886, 88.464, 111.512]]
[['C', ' N ', 195.806, 92.738, 112.4], ['C', ' CA ', 196.841, 93.133, 113.346], ['C', ' C ', 196.256, 93.35, 114.717], ['C', ' O ', 195.047, 93.503, 114.844], ['C', ' CB ', 197.518, 94.426, 112.902], ['C', ' CG1', 198.153, 94.242, 111.545], ['C', ' CG2', 196.504, 95.574, 112.9], ['C', ' H ', 194.9, 93.229, 112.386], ['C', ' HA ', 197.589, 92.348, 113.41], ['C', ' HB ', 198.316, 94.646, 113.595], ['C', ' HG1', 198.662, 95.159, 111.253], ['C', ' HG1', 198.87, 93.43, 111.591], ['C', ' HG1', 197.395, 94.011, 110.813], ['C', ' HG2', 197.008, 96.479, 112.601], ['C', ' HG2', 195.696, 95.355, 112.199], ['C', ' HG2', 196.091, 95.714, 113.896]]
[['C', ' N ', 197.089, 93.4, 115.738], ['C', ' CA ', 196.605, 93.861, 117.023], ['C', ' C ', 197.104, 95.284, 117.113], ['C', ' O ', 198.147, 95.627, 116.548], ['C', ' CB ', 197.103, 93.008, 118.171], ['C', ' OG ', 198.487, 93.043, 118.271], ['C', ' H ', 198.079, 93.194, 115.595], ['C', ' HA ', 195.522, 93.875, 117.034], ['C', ' HB ', 196.664, 93.369, 119.098], ['C', ' HB ', 196.771, 91.985, 118.033], ['C', ' HG ', 198.718, 92.362, 118.916]]
[['C', ' N ', 196.401, 96.137, 117.814], ['C', ' CA ', 196.851, 97.505, 117.903], ['C', ' C ', 196.262, 98.221, 119.08], ['C', ' O ', 195.266, 97.802, 119.671], ['C', ' CB ', 196.499, 98.247, 116.631], ['C', ' H ', 195.536, 95.835, 118.256], ['C', ' HA ', 197.923, 97.504, 118.023], ['C', ' HB ', 196.866, 99.271, 116.696], ['C', ' HB ', 196.947, 97.76, 115.781], ['C', ' HB ', 195.435, 98.255, 116.51]]
[['C', ' N ', 196.893, 99.307, 119.448], ['C', ' CA ', 196.292, 100.159, 120.442], ['C', ' C ', 196.59, 101.604, 120.178], ['C', ' O ', 197.603, 101.948, 119.565], ['C', ' CB ', 196.73, 99.823, 121.845], ['C', ' CG ', 198.148, 100.03, 122.166], ['C', ' CD ', 198.379, 99.719, 123.566], ['C', ' NE ', 199.744, 99.896, 123.901], ['C', ' CZ ', 200.294, 99.692, 125.096], ['C', ' NH1', 199.571, 99.299, 126.127], ['C', ' NH2', 201.589, 99.895, 125.205], ['C', ' H ', 197.755, 99.558, 118.953], ['C', ' HA ', 195.211, 100.031, 120.389], ['C', ' HB ', 196.148, 100.397, 122.563], ['C', ' HB ', 196.541, 98.796, 122.029], ['C', ' HG ', 198.767, 99.371, 121.561], ['C', ' HG ', 198.441, 101.067, 121.993], ['C', ' HD ', 197.784, 100.396, 124.178], ['C', ' HD ', 198.092, 98.696, 123.769], ['C', ' HE ', 200.38, 100.193, 123.152], ['C', ' HH1', 198.579, 99.143, 126.019], ['C', ' HH1', 200.006, 99.149, 127.026], ['C', ' HH2', 202.099, 100.198, 124.355], ['C', ' HH2', 202.066, 99.756, 126.081]]
[['C', ' N ', 195.715, 102.46, 120.676], ['C', ' CA ', 195.936, 103.889, 120.617], ['C', ' C ', 197.124, 104.216, 121.475], ['C', ' O ', 197.274, 103.637, 122.553], ['C', ' CB ', 194.727, 104.657, 121.089], ['C', ' OG ', 195.005, 106.033, 121.138], ['C', ' H ', 194.887, 102.11, 121.131], ['C', ' HA ', 196.149, 104.173, 119.598], ['C', ' HB ', 193.892, 104.477, 120.409], ['C', ' HB ', 194.427, 104.309, 122.078], ['C', ' HG ', 194.141, 106.451, 121.274]]
[['C', ' N ', 197.931, 105.165, 121.028], ['C', ' CA ', 199.112, 105.628, 121.737], ['C', ' C ', 198.808, 106.843, 122.592], ['C', ' O ', 199.673, 107.333, 123.323], ['C', ' CB ', 200.218, 105.982, 120.74], ['C', ' OG1', 199.752, 107.051, 119.9], ['C', ' CG2', 200.521, 104.76, 119.903], ['C', ' H ', 197.716, 105.572, 120.117], ['C', ' HA ', 199.466, 104.828, 122.382], ['C', ' HB ', 201.115, 106.304, 121.265], ['C', ' HG1', 200.437, 107.305, 119.226], ['C', ' HG2', 201.292, 104.992, 119.168], ['C', ' HG2', 200.865, 103.954, 120.547], ['C', ' HG2', 199.636, 104.456, 119.408]]
[['C', ' N ', 197.582, 107.342, 122.496], ['C', ' CA ', 197.169, 108.503, 123.256], ['C', ' C ', 196.66, 108.077, 124.615], ['C', ' O ', 195.625, 107.411, 124.717], ['C', ' CB ', 196.092, 109.313, 122.554], ['C', ' CG ', 195.759, 110.595, 123.346], ['C', ' OD1', 196.282, 110.718, 124.462], ['C', ' OD2', 195.043, 111.44, 122.842], ['C', ' H ', 196.909, 106.895, 121.875], ['C', ' HA ', 198.036, 109.148, 123.402], ['C', ' HB ', 196.417, 109.575, 121.545], ['C', ' HB ', 195.205, 108.709, 122.469]]
[['C', ' N ', 197.371, 108.441, 125.661], ['C', ' CA ', 197.034, 107.997, 127.001], ['C', ' C ', 195.628, 108.413, 127.416], ['C', ' O ', 194.995, 107.716, 128.221], ['C', ' CB ', 198.037, 108.507, 128.007], ['C', ' CG ', 199.382, 107.831, 127.908], ['C', ' CD ', 200.247, 108.121, 129.073], ['C', ' NE ', 200.58, 109.54, 129.171], ['C', ' CZ ', 201.606, 110.151, 128.532], ['C', ' NH1', 202.398, 109.473, 127.722], ['C', ' NH2', 201.811, 111.444, 128.718], ['C', ' H ', 198.182, 109.025, 125.5], ['C', ' HA ', 197.089, 106.913, 127.015], ['C', ' HB ', 198.183, 109.576, 127.864], ['C', ' HB ', 197.656, 108.356, 129.016], ['C', ' HG ', 199.233, 106.752, 127.858], ['C', ' HG ', 199.883, 108.163, 127.0], ['C', ' HD ', 199.716, 107.837, 129.982], ['C', ' HD ', 201.166, 107.544, 129.007], ['C', ' HE ', 200.009, 110.109, 129.784], ['C', ' HH1', 202.249, 108.487, 127.567], ['C', ' HH1', 203.16, 109.942, 127.25], ['C', ' HH2', 201.207, 111.969, 129.336], ['C', ' HH2', 202.572, 111.911, 128.246]]
[['C', ' N ', 195.133, 109.544, 126.894], ['C', ' CA ', 193.803, 110.0, 127.262], ['C', ' C ', 192.723, 109.088, 126.708], ['C', ' O ', 191.583, 109.141, 127.15], ['C', ' CB ', 193.527, 111.423, 126.797], ['C', ' CG ', 194.339, 112.477, 127.507], ['C', ' CD ', 193.961, 113.887, 127.116], ['C', ' OE1', 193.054, 114.067, 126.312], ['C', ' OE2', 194.578, 114.793, 127.62], ['C', ' H ', 195.681, 110.105, 126.216], ['C', ' HA ', 193.736, 109.981, 128.345], ['C', ' HB ', 193.748, 111.497, 125.728], ['C', ' HB ', 192.471, 111.653, 126.931], ['C', ' HG ', 194.204, 112.358, 128.58], ['C', ' HG ', 195.393, 112.312, 127.28]]
[['C', ' N ', 193.058, 108.311, 125.694], ['C', ' CA ', 192.126, 107.398, 125.088], ['C', ' C ', 192.331, 106.036, 125.715], ['C', ' O ', 191.377, 105.339, 126.068], ['C', ' CB ', 192.286, 107.345, 123.567], ['C', ' CG1', 191.947, 108.732, 122.998], ['C', ' CG2', 191.387, 106.268, 122.992], ['C', ' CD1', 192.243, 108.935, 121.528], ['C', ' H ', 194.026, 108.301, 125.372], ['C', ' HA ', 191.112, 107.728, 125.312], ['C', ' HB ', 193.325, 107.129, 123.319], ['C', ' HG1', 190.891, 108.924, 123.167], ['C', ' HG1', 192.53, 109.468, 123.548], ['C', ' HG2', 191.493, 106.22, 121.915], ['C', ' HG2', 191.658, 105.312, 123.408], ['C', ' HG2', 190.35, 106.492, 123.246], ['C', ' HD1', 191.975, 109.953, 121.248], ['C', ' HD1', 193.291, 108.781, 121.329], ['C', ' HD1', 191.665, 108.249, 120.93]]
[['C', ' N ', 193.59, 105.659, 125.916], ['C', ' CA ', 193.912, 104.344, 126.451], ['C', ' C ', 193.25, 104.127, 127.798], ['C', ' O ', 192.786, 103.03, 128.098], ['C', ' CB ', 195.412, 104.217, 126.688], ['C', ' CG ', 196.285, 104.17, 125.473], ['C', ' CD ', 197.746, 104.228, 125.863], ['C', ' OE1', 198.059, 104.481, 127.036], ['C', ' NE2', 198.624, 104.015, 124.913], ['C', ' H ', 194.346, 106.28, 125.623], ['C', ' HA ', 193.562, 103.581, 125.758], ['C', ' HB ', 195.733, 105.048, 127.306], ['C', ' HB ', 195.602, 103.31, 127.257], ['C', ' HG ', 196.114, 103.232, 124.945], ['C', ' HG ', 196.068, 105.001, 124.816], ['C', ' HE2', 199.603, 104.046, 125.107], ['C', ' HE2', 198.288, 103.829, 123.972]]
[['C', ' N ', 193.173, 105.18, 128.605], ['C', ' CA ', 192.568, 105.071, 129.918], ['C', ' C ', 191.034, 104.959, 129.882], ['C', ' O ', 190.423, 104.642, 130.911], ['C', ' CB ', 192.945, 106.267, 130.793], ['C', ' CG ', 192.26, 107.565, 130.421], ['C', ' CD ', 192.731, 108.709, 131.289], ['C', ' CE ', 191.943, 109.986, 131.004], ['C', ' NZ ', 192.426, 111.131, 131.833], ['C', ' H ', 193.61, 106.061, 128.317], ['C', ' HA ', 192.956, 104.168, 130.388], ['C', ' HB ', 192.711, 106.046, 131.832], ['C', ' HB ', 194.021, 106.435, 130.723], ['C', ' HG ', 192.445, 107.795, 129.374], ['C', ' HG ', 191.194, 107.462, 130.571], ['C', ' HD ', 192.618, 108.44, 132.338], ['C', ' HD ', 193.788, 108.895, 131.087], ['C', ' HE ', 192.039, 110.242, 129.952], ['C', ' HE ', 190.891, 109.81, 131.225], ['C', ' HZ ', 191.881, 111.955, 131.62], ['C', ' HZ ', 192.327, 110.908, 132.816], ['C', ' HZ ', 193.399, 111.307, 131.625]]
[['C', ' N ', 190.395, 105.304, 128.757], ['C', ' CA ', 188.936, 105.317, 128.685], ['C', ' C ', 188.328, 104.139, 127.934], ['C', ' O ', 187.305, 103.586, 128.346], ['C', ' CB ', 188.487, 106.574, 127.956], ['C', ' CG ', 188.878, 107.911, 128.553], ['C', ' CD1', 188.408, 109.014, 127.609], ['C', ' CD2', 188.274, 108.078, 129.935], ['C', ' H ', 190.934, 105.503, 127.919], ['C', ' HA ', 188.539, 105.295, 129.694], ['C', ' HB ', 188.878, 106.539, 126.937], ['C', ' HB ', 187.413, 106.551, 127.916], ['C', ' HG ', 189.955, 107.973, 128.62], ['C', ' HD1', 188.703, 109.982, 128.01], ['C', ' HD1', 188.871, 108.877, 126.63], ['C', ' HD1', 187.321, 108.978, 127.505], ['C', ' HD2', 188.564, 109.047, 130.333], ['C', ' HD2', 187.186, 108.024, 129.865], ['C', ' HD2', 188.633, 107.303, 130.603]]
[['C', ' N ', 188.938, 103.761, 126.824], ['C', ' CA ', 188.406, 102.677, 126.014], ['C', ' C ', 188.61, 101.394, 126.77], ['C', ' O ', 189.548, 101.297, 127.553], ['C', ' CB ', 189.074, 102.62, 124.674], ['C', ' H ', 189.79, 104.251, 126.538], ['C', ' HA ', 187.337, 102.834, 125.879], ['C', ' HB ', 188.657, 101.795, 124.1], ['C', ' HB ', 188.906, 103.563, 124.148], ['C', ' HB ', 190.142, 102.463, 124.823]]
[['C', ' N ', 187.781, 100.381, 126.548], ['C', ' CA ', 188.026, 99.179, 127.325], ['C', ' C ', 189.342, 98.496, 126.965], ['C', ' O ', 190.062, 98.051, 127.855], ['C', ' CB ', 186.849, 98.211, 127.172], ['C', ' CG ', 186.947, 96.942, 128.011], ['C', ' CD ', 187.026, 97.223, 129.493], ['C', ' OE1', 186.362, 98.126, 130.012], ['C', ' NE2', 187.847, 96.444, 130.185], ['C', ' H ', 187.013, 100.449, 125.897], ['C', ' HA ', 188.084, 99.469, 128.375], ['C', ' HB ', 185.918, 98.716, 127.432], ['C', ' HB ', 186.773, 97.903, 126.133], ['C', ' HG ', 186.057, 96.335, 127.843], ['C', ' HG ', 187.84, 96.375, 127.721], ['C', ' HE2', 187.954, 96.569, 131.169], ['C', ' HE2', 188.363, 95.71, 129.711]]
[['C', ' N ', 189.662, 98.436, 125.679], ['C', ' CA ', 190.907, 97.866, 125.175], ['C', ' C ', 191.171, 98.502, 123.847], ['C', ' O ', 190.22, 98.643, 123.083], ['C', ' CB ', 190.827, 96.348, 124.977], ['C', ' CG ', 190.786, 95.529, 126.259], ['C', ' OD1', 191.824, 95.389, 126.928], ['C', ' OD2', 189.735, 94.995, 126.547], ['C', ' H ', 189.017, 98.828, 125.013], ['C', ' HA ', 191.724, 98.111, 125.854], ['C', ' HB ', 189.945, 96.123, 124.396], ['C', ' HB ', 191.685, 96.02, 124.393]]
[['C', ' N ', 192.418, 98.861, 123.543], ['C', ' CA ', 192.765, 99.371, 122.235], ['C', ' C ', 191.722, 100.337, 121.746], ['C', ' O ', 190.901, 99.988, 120.896], ['C', ' H ', 193.182, 98.752, 124.198], ['C', ' HA ', 193.731, 99.862, 122.295], ['C', ' HA ', 192.872, 98.546, 121.536]]
[['C', ' N ', 191.754, 101.575, 122.238], ['C', ' CA ', 190.746, 102.575, 121.881], ['C', ' C ', 190.86, 103.109, 120.47], ['C', ' O ', 191.044, 104.305, 120.249], ['C', ' H ', 192.46, 101.805, 122.921], ['C', ' HA ', 189.759, 102.131, 121.999], ['C', ' HA ', 190.802, 103.398, 122.582]]
[['C', ' N ', 190.673, 102.206, 119.531], ['C', ' CA ', 190.746, 102.386, 118.107], ['C', ' C ', 189.402, 102.899, 117.66], ['C', ' O ', 189.302, 103.865, 116.909], ['C', ' CB ', 191.159, 101.076, 117.442], ['C', ' CG1', 192.57, 100.781, 117.946], ['C', ' CG2', 191.103, 101.184, 115.899], ['C', ' CD1', 193.07, 99.511, 117.645], ['C', ' H ', 190.491, 101.272, 119.871], ['C', ' HA ', 191.496, 103.137, 117.881], ['C', ' HB ', 190.503, 100.272, 117.783], ['C', ' HG1', 193.242, 101.471, 117.529], ['C', ' HG1', 192.588, 100.881, 119.021], ['C', ' HG2', 191.409, 100.251, 115.436], ['C', ' HG2', 190.088, 101.412, 115.573], ['C', ' HG2', 191.772, 101.973, 115.576], ['C', ' HD1', 194.049, 99.434, 118.055], ['C', ' HD1', 192.442, 98.743, 118.066], ['C', ' HD1', 193.118, 99.408, 116.6]]
[['C', ' N ', 188.347, 102.362, 118.225], ['C', ' CA ', 187.022, 102.826, 117.863], ['C', ' C ', 186.888, 104.316, 118.251], ['C', ' O ', 186.218, 105.08, 117.574], ['C', ' CB ', 185.965, 101.934, 118.552], ['C', ' CG1', 186.111, 100.505, 118.061], ['C', ' CG2', 186.121, 101.965, 120.07], ['C', ' H ', 188.477, 101.594, 118.861], ['C', ' HA ', 186.901, 102.738, 116.783], ['C', ' HB ', 184.984, 102.277, 118.291], ['C', ' HG1', 185.361, 99.887, 118.536], ['C', ' HG1', 185.976, 100.467, 117.001], ['C', ' HG1', 187.094, 100.114, 118.306], ['C', ' HG2', 185.359, 101.325, 120.515], ['C', ' HG2', 187.105, 101.61, 120.369], ['C', ' HG2', 185.977, 102.952, 120.413]]
[['C', ' N ', 187.634, 104.724, 119.28], ['C', ' CA ', 187.781, 106.08, 119.802], ['C', ' C ', 189.077, 106.763, 119.378], ['C', ' O ', 189.414, 107.838, 119.87], ['C', ' CB ', 187.848, 106.017, 121.317], ['C', ' OG1', 188.884, 105.065, 121.671], ['C', ' CG2', 186.57, 105.632, 121.939], ['C', ' H ', 188.118, 104.01, 119.814], ['C', ' HA ', 186.935, 106.681, 119.468], ['C', ' HB ', 188.133, 106.998, 121.698], ['C', ' HG1', 189.744, 105.225, 121.165], ['C', ' HG2', 186.708, 105.604, 122.998], ['C', ' HG2', 185.8, 106.363, 121.685], ['C', ' HG2', 186.269, 104.678, 121.605]]
[['C', ' N ', 189.839, 106.097, 118.542], ['C', ' CA ', 191.154, 106.514, 118.089], ['C', ' C ', 191.111, 106.833, 116.623], ['C', ' O ', 191.465, 107.927, 116.195], ['C', ' H ', 189.467, 105.241, 118.156], ['C', ' HA ', 191.483, 107.385, 118.651], ['C', ' HA ', 191.872, 105.716, 118.276]]
[['C', ' N ', 190.783, 105.813, 115.852], ['C', ' CA ', 190.729, 105.82, 114.421], ['C', ' C ', 189.594, 106.668, 114.008], ['C', ' O ', 189.695, 107.434, 113.06], ['C', ' CB ', 190.487, 104.405, 113.911], ['C', ' CG ', 190.497, 104.173, 112.425], ['C', ' CD1', 191.869, 104.562, 111.861], ['C', ' CD2', 190.168, 102.702, 112.18], ['C', ' H ', 190.511, 104.959, 116.306], ['C', ' HA ', 191.658, 106.231, 114.045], ['C', ' HB ', 191.242, 103.772, 114.33], ['C', ' HB ', 189.52, 104.068, 114.288], ['C', ' HG ', 189.744, 104.793, 111.93], ['C', ' HD1', 191.88, 104.375, 110.818], ['C', ' HD1', 192.079, 105.612, 112.018], ['C', ' HD1', 192.638, 103.972, 112.335], ['C', ' HD2', 190.166, 102.495, 111.113], ['C', ' HD2', 190.902, 102.07, 112.665], ['C', ' HD2', 189.181, 102.482, 112.592]]
[['C', ' N ', 188.505, 106.551, 114.739], ['C', ' CA ', 187.356, 107.34, 114.376], ['C', ' C ', 187.667, 108.8, 114.663], ['C', ' O ', 187.318, 109.676, 113.874], ['C', ' CB ', 186.134, 106.855, 115.13], ['C', ' CG ', 184.779, 107.461, 114.8], ['C', ' CD1', 184.446, 107.272, 113.311], ['C', ' CD2', 183.757, 106.728, 115.651], ['C', ' H ', 188.507, 105.868, 115.503], ['C', ' HA ', 187.194, 107.219, 113.309], ['C', ' HB ', 186.061, 105.772, 115.018], ['C', ' HB ', 186.307, 107.07, 116.183], ['C', ' HG ', 184.768, 108.527, 115.033], ['C', ' HD1', 183.48, 107.673, 113.125], ['C', ' HD1', 185.165, 107.789, 112.682], ['C', ' HD1', 184.446, 106.208, 113.065], ['C', ' HD2', 182.762, 107.101, 115.476], ['C', ' HD2', 183.794, 105.673, 115.398], ['C', ' HD2', 184.006, 106.852, 116.704]]
[['C', ' N ', 188.332, 109.066, 115.788], ['C', ' CA ', 188.703, 110.429, 116.132], ['C', ' C ', 189.726, 110.953, 115.134], ['C', ' O ', 189.683, 112.12, 114.752], ['C', ' CB ', 189.237, 110.489, 117.538], ['C', ' H ', 188.586, 108.298, 116.393], ['C', ' HA ', 187.821, 111.056, 116.053], ['C', ' HB ', 189.495, 111.516, 117.783], ['C', ' HB ', 188.486, 110.125, 118.237], ['C', ' HB ', 190.128, 109.863, 117.615]]
[['C', ' N ', 190.628, 110.081, 114.689], ['C', ' CA ', 191.615, 110.432, 113.693], ['C', ' C ', 190.963, 110.819, 112.409], ['C', ' O ', 191.348, 111.798, 111.796], ['C', ' CB ', 192.586, 109.301, 113.436], ['C', ' CG ', 193.503, 109.567, 112.286], ['C', ' CD1', 194.419, 110.575, 112.373], ['C', ' CD2', 193.459, 108.768, 111.158], ['C', ' CE1', 195.284, 110.809, 111.361], ['C', ' CE2', 194.351, 108.997, 110.127], ['C', ' CZ ', 195.259, 110.029, 110.239], ['C', ' OH ', 196.185, 110.286, 109.263], ['C', ' H ', 190.663, 109.145, 115.085], ['C', ' HA ', 192.171, 111.296, 114.057], ['C', ' HB ', 193.176, 109.11, 114.325], ['C', ' HB ', 192.036, 108.403, 113.219], ['C', ' HD1', 194.454, 111.2, 113.258], ['C', ' HD2', 192.736, 107.953, 111.087], ['C', ' HE1', 196.011, 111.615, 111.444], ['C', ' HE2', 194.337, 108.364, 109.238], ['C', ' HH ', 196.496, 109.449, 108.862]]
[['C', ' N ', 190.019, 110.01, 111.96], ['C', ' CA ', 189.301, 110.271, 110.741], ['C', ' C ', 188.511, 111.573, 110.844], ['C', ' O ', 188.4, 112.337, 109.877], ['C', ' CB ', 188.39, 109.104, 110.459], ['C', ' H ', 189.799, 109.167, 112.488], ['C', ' HA ', 190.028, 110.375, 109.939], ['C', ' HB ', 187.894, 109.25, 109.55], ['C', ' HB ', 188.982, 108.203, 110.4], ['C', ' HB ', 187.669, 109.004, 111.267]]
[['C', ' N ', 187.988, 111.86, 112.038], ['C', ' CA ', 187.25, 113.09, 112.247], ['C', ' C ', 188.223, 114.258, 112.047], ['C', ' O ', 187.936, 115.252, 111.358], ['C', ' CB ', 186.643, 113.071, 113.66], ['C', ' CG ', 185.772, 114.238, 114.119], ['C', ' CD1', 184.57, 114.371, 113.232], ['C', ' CD2', 185.329, 113.969, 115.544], ['C', ' H ', 188.044, 111.169, 112.79], ['C', ' HA ', 186.47, 113.139, 111.522], ['C', ' HB ', 186.065, 112.154, 113.766], ['C', ' HB ', 187.46, 113.022, 114.36], ['C', ' HG ', 186.341, 115.17, 114.077], ['C', ' HD1', 183.942, 115.197, 113.576], ['C', ' HD1', 184.879, 114.575, 112.22], ['C', ' HD1', 184.005, 113.447, 113.261], ['C', ' HD2', 184.716, 114.786, 115.873], ['C', ' HD2', 184.754, 113.048, 115.586], ['C', ' HD2', 186.206, 113.879, 116.184]]
[['C', ' N ', 189.411, 114.127, 112.615], ['C', ' CA ', 190.423, 115.12, 112.381], ['C', ' C ', 190.8, 115.031, 110.915], ['C', ' O ', 190.71, 113.984, 110.291], ['C', ' CB ', 191.642, 114.918, 113.268], ['C', ' CG ', 191.412, 115.309, 114.723], ['C', ' OD1', 190.44, 115.972, 115.026], ['C', ' OD2', 192.236, 114.952, 115.528], ['C', ' H ', 189.601, 113.333, 113.234], ['C', ' HA ', 190.008, 116.107, 112.577], ['C', ' HB ', 191.931, 113.867, 113.232], ['C', ' HB ', 192.477, 115.496, 112.873]]
[['C', ' N ', 191.166, 116.14, 110.33], ['C', ' CA ', 191.566, 116.189, 108.927], ['C', ' C ', 190.422, 115.917, 107.927], ['C', ' O ', 190.668, 115.912, 106.72], ['C', ' CB ', 192.725, 115.219, 108.638], ['C', ' CG ', 193.918, 115.349, 109.586], ['C', ' CD ', 194.551, 116.704, 109.554], ['C', ' OE1', 194.453, 117.366, 108.551], ['C', ' OE2', 195.123, 117.088, 110.545], ['C', ' H ', 191.202, 116.989, 110.876], ['C', ' HA ', 191.933, 117.198, 108.728], ['C', ' HB ', 192.387, 114.187, 108.636], ['C', ' HB ', 193.101, 115.419, 107.636], ['C', ' HG ', 193.612, 115.123, 110.601], ['C', ' HG ', 194.66, 114.606, 109.298]]
[['C', ' N ', 189.172, 115.784, 108.395], ['C', ' CA ', 188.029, 115.729, 107.491], ['C', ' C ', 187.682, 114.438, 106.747], ['C', ' O ', 187.07, 114.515, 105.676], ['C', ' H ', 188.981, 115.737, 109.404], ['C', ' HA ', 187.151, 116.006, 108.078], ['C', ' HA ', 188.145, 116.524, 106.758]]
[['C', ' N ', 188.071, 113.267, 107.234], ['C', ' CA ', 187.67, 112.059, 106.518], ['C', ' C ', 186.216, 111.855, 106.899], ['C', ' O ', 185.366, 111.497, 106.085], ['C', ' CB ', 188.5, 110.838, 106.916], ['C', ' CG1', 190.012, 111.083, 106.612], ['C', ' CG2', 187.947, 109.569, 106.24], ['C', ' CD1', 190.373, 111.389, 105.177], ['C', ' H ', 188.584, 113.205, 108.12], ['C', ' HA ', 187.721, 112.218, 105.446], ['C', ' HB ', 188.431, 110.721, 107.964], ['C', ' HG1', 190.348, 111.919, 107.229], ['C', ' HG1', 190.566, 110.208, 106.905], ['C', ' HG2', 188.513, 108.707, 106.551], ['C', ' HG2', 186.907, 109.417, 106.514], ['C', ' HG2', 188.007, 109.667, 105.16], ['C', ' HD1', 191.451, 111.537, 105.108], ['C', ' HD1', 190.087, 110.563, 104.532], ['C', ' HD1', 189.873, 112.298, 104.848]]
[['C', ' N ', 185.991, 112.043, 108.182], ['C', ' CA ', 184.724, 111.955, 108.859], ['C', ' C ', 184.383, 113.342, 109.37], ['C', ' O ', 185.232, 114.057, 109.869], ['C', ' CB ', 184.825, 110.86, 109.942], ['C', ' CG1', 185.13, 109.509, 109.254], ['C', ' CG2', 183.665, 110.795, 110.835], ['C', ' CD1', 184.098, 108.985, 108.306], ['C', ' H ', 186.807, 112.301, 108.742], ['C', ' HA ', 183.95, 111.695, 108.147], ['C', ' HB ', 185.683, 111.074, 110.552], ['C', ' HG1', 186.007, 109.625, 108.679], ['C', ' HG1', 185.299, 108.754, 110.019], ['C', ' HG2', 183.819, 110.02, 111.579], ['C', ' HG2', 183.552, 111.741, 111.337], ['C', ' HG2', 182.776, 110.577, 110.261], ['C', ' HD1', 184.449, 108.066, 107.881], ['C', ' HD1', 183.185, 108.807, 108.817], ['C', ' HD1', 183.924, 109.675, 107.499]]
[['C', ' N ', 183.168, 113.775, 109.149], ['C', ' CA ', 182.722, 115.088, 109.604], ['C', ' C ', 181.976, 115.018, 110.934], ['C', ' O ', 181.636, 116.04, 111.525], ['C', ' CB ', 181.898, 115.736, 108.51], ['C', ' CG ', 182.679, 116.112, 107.299], ['C', ' CD ', 181.8, 116.567, 106.183], ['C', ' OE1', 180.589, 116.585, 106.363], ['C', ' OE2', 182.332, 116.936, 105.159], ['C', ' H ', 182.519, 113.138, 108.687], ['C', ' HA ', 183.603, 115.71, 109.758], ['C', ' HB ', 181.174, 115.017, 108.148], ['C', ' HB ', 181.366, 116.61, 108.89], ['C', ' HG ', 183.351, 116.924, 107.566], ['C', ' HG ', 183.291, 115.28, 106.986]]
[['C', ' N ', 181.751, 113.802, 111.393], ['C', ' CA ', 181.066, 113.491, 112.638], ['C', ' C ', 180.801, 111.998, 112.659], ['C', ' O ', 180.844, 111.343, 111.616], ['C', ' H ', 182.084, 113.034, 110.831], ['C', ' HA ', 181.689, 113.771, 113.484], ['C', ' HA ', 180.14, 114.048, 112.719]]
[['C', ' N ', 180.427, 111.465, 113.8], ['C', ' CA ', 180.177, 110.034, 113.86], ['C', ' C ', 179.119, 109.674, 114.86], ['C', ' O ', 178.953, 110.341, 115.874], ['C', ' CB ', 181.45, 109.322, 114.201], ['C', ' H ', 180.372, 112.077, 114.619], ['C', ' HA ', 179.825, 109.716, 112.885], ['C', ' HB ', 181.26, 108.256, 114.211], ['C', ' HB ', 182.203, 109.558, 113.458], ['C', ' HB ', 181.793, 109.637, 115.174]]
[['C', ' N ', 178.421, 108.587, 114.599], ['C', ' CA ', 177.4, 108.131, 115.514], ['C', ' C ', 177.88, 107.022, 116.398], ['C', ' O ', 178.205, 105.909, 115.961], ['C', ' CB ', 176.147, 107.729, 114.752], ['C', ' CG1', 175.136, 107.18, 115.681], ['C', ' CG2', 175.558, 108.985, 114.087], ['C', ' H ', 178.637, 108.062, 113.748], ['C', ' HA ', 177.127, 108.961, 116.157], ['C', ' HB ', 176.389, 106.968, 114.01], ['C', ' HG1', 174.284, 106.923, 115.085], ['C', ' HG1', 175.501, 106.284, 116.183], ['C', ' HG1', 174.873, 107.929, 116.431], ['C', ' HG2', 174.65, 108.726, 113.557], ['C', ' HG2', 175.326, 109.711, 114.857], ['C', ' HG2', 176.279, 109.41, 113.394]]
[['C', ' N ', 177.873, 107.356, 117.673], ['C', ' CA ', 178.376, 106.523, 118.732], ['C', ' C ', 177.369, 106.387, 119.848], ['C', ' O ', 176.417, 107.162, 119.932], ['C', ' CB ', 179.688, 107.117, 119.272], ['C', ' CG1', 180.718, 107.189, 118.162], ['C', ' CG2', 179.44, 108.519, 119.831], ['C', ' H ', 177.48, 108.277, 117.897], ['C', ' HA ', 178.559, 105.541, 118.329], ['C', ' HB ', 180.079, 106.465, 120.053], ['C', ' HG1', 181.63, 107.574, 118.567], ['C', ' HG1', 180.901, 106.205, 117.762], ['C', ' HG1', 180.373, 107.842, 117.363], ['C', ' HG2', 180.368, 108.937, 120.214], ['C', ' HG2', 179.057, 109.17, 119.041], ['C', ' HG2', 178.711, 108.473, 120.642]]
[['C', ' N ', 177.574, 105.404, 120.709], ['C', ' CA ', 176.706, 105.242, 121.862], ['C', ' C ', 177.26, 106.033, 123.024], ['C', ' O ', 178.273, 105.641, 123.611], ['C', ' CB ', 176.605, 103.781, 122.244], ['C', ' H ', 178.359, 104.783, 120.578], ['C', ' HA ', 175.717, 105.628, 121.618], ['C', ' HB ', 175.965, 103.688, 123.092], ['C', ' HB ', 176.207, 103.211, 121.422], ['C', ' HB ', 177.592, 103.406, 122.494]]
[['C', ' N ', 176.671, 107.176, 123.311], ['C', ' CA ', 177.206, 108.052, 124.325], ['C', ' C ', 176.522, 107.798, 125.645], ['C', ' O ', 175.783, 106.822, 125.785], ['C', ' H ', 175.812, 107.461, 122.827], ['C', ' HA ', 178.273, 107.879, 124.41], ['C', ' HA ', 177.058, 109.084, 124.015]]
[['C', ' N ', 176.784, 108.627, 126.656], ['C', ' CA ', 176.197, 108.556, 127.976], ['C', ' C ', 174.694, 108.724, 127.87], ['C', ' O ', 174.235, 109.527, 127.061], ['C', ' CB ', 176.835, 109.749, 128.69], ['C', ' CG ', 178.114, 110.024, 127.916], ['C', ' CD ', 177.767, 109.709, 126.488], ['C', ' HA ', 176.457, 107.599, 128.453], ['C', ' HB ', 176.137, 110.602, 128.69], ['C', ' HB ', 177.023, 109.495, 129.742], ['C', ' HG ', 178.423, 111.073, 128.054], ['C', ' HG ', 178.944, 109.402, 128.294], ['C', ' HD ', 177.301, 110.579, 126.0], ['C', ' HD ', 178.68, 109.384, 125.98]]
[['C', ' N ', 173.94, 108.006, 128.694], ['C', ' CA ', 172.485, 108.122, 128.692], ['C', ' C ', 171.957, 108.879, 129.909], ['C', ' O ', 172.701, 109.564, 130.614], ['C', ' H ', 174.366, 107.349, 129.338], ['C', ' HA ', 172.162, 108.635, 127.791], ['C', ' HA ', 172.047, 107.122, 128.661]]
[['C', ' N ', 170.651, 108.73, 130.163], ['C', ' CA ', 169.944, 109.382, 131.274], ['C', ' C ', 170.092, 108.602, 132.577], ['C', ' O ', 169.679, 109.052, 133.647], ['C', ' CB ', 168.455, 109.527, 130.942], ['C', ' CG ', 167.624, 108.221, 131.032], ['C', ' CD ', 167.72, 107.353, 129.819], ['C', ' OE1', 168.604, 107.567, 129.026], ['C', ' OE2', 166.923, 106.451, 129.684], ['C', ' H ', 170.095, 108.152, 129.525], ['C', ' HA ', 170.374, 110.373, 131.42], ['C', ' HB ', 168.006, 110.247, 131.626], ['C', ' HB ', 168.346, 109.926, 129.934], ['C', ' HG ', 167.9, 107.64, 131.904], ['C', ' HG ', 166.582, 108.508, 131.162]]
[['C', ' N ', 170.639, 107.415, 132.445], ['C', ' CA ', 170.825, 106.43, 133.49], ['C', ' C ', 172.232, 105.892, 133.362], ['C', ' O ', 172.826, 105.981, 132.291], ['C', ' CB ', 169.765, 105.328, 133.364], ['C', ' CG ', 169.844, 104.196, 134.385], ['C', ' CD ', 169.739, 104.649, 135.814], ['C', ' OE1', 168.684, 104.54, 136.384], ['C', ' OE2', 170.735, 105.122, 136.334], ['C', ' H ', 170.944, 107.182, 131.512], ['C', ' HA ', 170.728, 106.912, 134.464], ['C', ' HB ', 168.775, 105.774, 133.443], ['C', ' HB ', 169.834, 104.879, 132.378], ['C', ' HG ', 169.019, 103.512, 134.186], ['C', ' HG ', 170.757, 103.633, 134.237]]
[['C', ' N ', 172.771, 105.362, 134.439], ['C', ' CA ', 174.112, 104.823, 134.403], ['C', ' C ', 174.173, 103.613, 133.513], ['C', ' O ', 173.265, 102.781, 133.523], ['C', ' CB ', 174.545, 104.433, 135.805], ['C', ' CG ', 174.822, 105.582, 136.633], ['C', ' CD1', 173.855, 106.09, 137.465], ['C', ' CD2', 176.06, 106.178, 136.597], ['C', ' CE1', 174.119, 107.184, 138.246], ['C', ' CE2', 176.329, 107.269, 137.377], ['C', ' CZ ', 175.355, 107.775, 138.202], ['C', ' H ', 172.205, 105.325, 135.293], ['C', ' HA ', 174.784, 105.585, 134.011], ['C', ' HB ', 173.762, 103.842, 136.284], ['C', ' HB ', 175.435, 103.828, 135.76], ['C', ' HD1', 172.866, 105.619, 137.503], ['C', ' HD2', 176.834, 105.773, 135.942], ['C', ' HE1', 173.344, 107.581, 138.901], ['C', ' HE2', 177.315, 107.737, 137.344], ['C', ' HZ ', 175.567, 108.643, 138.825]]
[['C', ' N ', 175.25, 103.518, 132.731], ['C', ' CA ', 175.542, 102.406, 131.818], ['C', ' C ', 174.626, 102.265, 130.611], ['C', ' O ', 175.101, 101.962, 129.521], ['C', ' CB ', 175.695, 101.142, 132.633], ['C', ' CG ', 176.967, 101.261, 133.303], ['C', ' CD1', 177.227, 101.652, 134.565], ['C', ' CD2', 178.22, 100.996, 132.705], ['C', ' NE1', 178.565, 101.683, 134.764], ['C', ' CE2', 179.183, 101.28, 133.642], ['C', ' CE3', 178.599, 100.548, 131.459], ['C', ' CZ2', 180.504, 101.14, 133.378], ['C', ' CZ3', 179.931, 100.398, 131.189], ['C', ' CH2', 180.862, 100.691, 132.128], ['C', ' H ', 175.923, 104.271, 132.774], ['C', ' HA ', 176.531, 102.605, 131.411], ['C', ' HB ', 174.91, 101.036, 133.362], ['C', ' HB ', 175.694, 100.264, 131.993], ['C', ' HD1', 176.486, 101.927, 135.301], ['C', ' HE1', 179.081, 101.967, 135.628], ['C', ' HE3', 177.85, 100.313, 130.713], ['C', ' HZ2', 181.252, 101.371, 134.119], ['C', ' HZ3', 180.221, 100.04, 130.204], ['C', ' HH2', 181.905, 100.57, 131.885]]
[['C', ' N ', 173.347, 102.48, 130.783], ['C', ' CA ', 172.434, 102.467, 129.669], ['C', ' C ', 172.94, 103.532, 128.669], ['C', ' O ', 173.082, 104.687, 129.048], ['C', ' CB ', 171.042, 102.804, 130.18], ['C', ' CG ', 169.942, 102.746, 129.182], ['C', ' CD ', 168.603, 102.982, 129.891], ['C', ' CE ', 167.415, 102.921, 128.938], ['C', ' NZ ', 167.337, 104.128, 128.046], ['C', ' H ', 173.048, 102.669, 131.733], ['C', ' HA ', 172.424, 101.467, 129.259], ['C', ' HB ', 170.785, 102.148, 131.001], ['C', ' HB ', 171.061, 103.816, 130.585], ['C', ' HG ', 170.105, 103.51, 128.417], ['C', ' HG ', 169.934, 101.764, 128.704], ['C', ' HD ', 168.469, 102.23, 130.672], ['C', ' HD ', 168.612, 103.97, 130.362], ['C', ' HE ', 167.504, 102.03, 128.318], ['C', ' HE ', 166.495, 102.856, 129.519], ['C', ' HZ ', 166.545, 104.056, 127.44], ['C', ' HZ ', 167.231, 104.982, 128.626], ['C', ' HZ ', 168.171, 104.213, 127.489]]
[['C', ' N ', 173.268, 103.172, 127.427], ['C', ' CA ', 173.781, 104.016, 126.367], ['C', ' C ', 172.728, 104.865, 125.71], ['C', ' O ', 171.555, 104.487, 125.689], ['C', ' CB ', 174.305, 102.998, 125.389], ['C', ' CG ', 173.417, 101.825, 125.595], ['C', ' CD ', 173.104, 101.811, 127.028], ['C', ' HA ', 174.595, 104.646, 126.762], ['C', ' HB ', 174.207, 103.41, 124.385], ['C', ' HB ', 175.366, 102.797, 125.572], ['C', ' HG ', 172.497, 101.924, 124.993], ['C', ' HG ', 173.91, 100.895, 125.271], ['C', ' HD ', 172.056, 101.49, 127.132], ['C', ' HD ', 173.826, 101.172, 127.547]]
[['C', ' N ', 173.164, 105.934, 125.078], ['C', ' CA ', 172.308, 106.742, 124.235], ['C', ' C ', 172.989, 107.174, 122.942], ['C', ' O ', 173.927, 107.973, 122.98], ['C', ' CB ', 171.863, 107.978, 124.986], ['C', ' CG ', 171.121, 109.011, 124.16], ['C', ' CD ', 169.823, 108.543, 123.576], ['C', ' OE1', 168.946, 108.036, 124.275], ['C', ' NE2', 169.687, 108.704, 122.262], ['C', ' H ', 174.145, 106.203, 125.206], ['C', ' HA ', 171.418, 106.165, 124.027], ['C', ' HB ', 171.22, 107.68, 125.812], ['C', ' HB ', 172.737, 108.464, 125.403], ['C', ' HG ', 170.898, 109.851, 124.812], ['C', ' HG ', 171.754, 109.36, 123.341], ['C', ' HE2', 168.847, 108.421, 121.803], ['C', ' HE2', 170.467, 109.09, 121.707]]
[['C', ' N ', 172.508, 106.753, 121.772], ['C', ' CA ', 173.051, 107.152, 120.498], ['C', ' C ', 173.1, 108.662, 120.379], ['C', ' O ', 172.117, 109.356, 120.657], ['C', ' CB ', 172.019, 106.595, 119.533], ['C', ' CG ', 171.467, 105.383, 120.238], ['C', ' CD ', 171.423, 105.755, 121.689], ['C', ' HA ', 174.033, 106.697, 120.337], ['C', ' HB ', 171.246, 107.352, 119.343], ['C', ' HB ', 172.492, 106.409, 118.577], ['C', ' HG ', 170.475, 105.139, 119.829], ['C', ' HG ', 172.1, 104.51, 120.049], ['C', ' HD ', 170.449, 106.172, 121.943], ['C', ' HD ', 171.667, 104.851, 122.284]]
[['C', ' N ', 174.224, 109.156, 119.909], ['C', ' CA ', 174.426, 110.576, 119.712], ['C', ' C ', 175.401, 110.777, 118.585], ['C', ' O ', 176.124, 109.841, 118.23], ['C', ' CB ', 174.896, 111.232, 121.004], ['C', ' CG ', 176.232, 110.725, 121.571], ['C', ' SD ', 177.714, 111.415, 120.77], ['C', ' CE ', 177.69, 113.163, 121.14], ['C', ' H ', 174.994, 108.507, 119.721], ['C', ' HA ', 173.48, 111.029, 119.416], ['C', ' HB ', 174.95, 112.3, 120.863], ['C', ' HB ', 174.143, 111.048, 121.776], ['C', ' HG ', 176.272, 110.961, 122.629], ['C', ' HG ', 176.266, 109.635, 121.467], ['C', ' HE ', 178.547, 113.642, 120.691], ['C', ' HE ', 176.795, 113.619, 120.731], ['C', ' HE ', 177.721, 113.314, 122.217]]
[['C', ' N ', 175.442, 111.968, 118.004], ['C', ' CA ', 176.445, 112.146, 116.981], ['C', ' C ', 177.495, 113.078, 117.507], ['C', ' O ', 177.193, 114.162, 118.001], ['C', ' CB ', 175.857, 112.687, 115.658], ['C', ' CG1', 175.258, 114.091, 115.798], ['C', ' CG2', 176.929, 112.671, 114.601], ['C', ' H ', 174.832, 112.72, 118.296], ['C', ' HA ', 176.913, 111.194, 116.769], ['C', ' HB ', 175.046, 112.033, 115.359], ['C', ' HG1', 174.843, 114.383, 114.841], ['C', ' HG1', 174.479, 114.101, 116.544], ['C', ' HG1', 176.016, 114.817, 116.072], ['C', ' HG2', 176.51, 112.996, 113.689], ['C', ' HG2', 177.755, 113.327, 114.87], ['C', ' HG2', 177.294, 111.672, 114.478]]
[['C', ' N ', 178.722, 112.638, 117.403], ['C', ' CA ', 179.848, 113.402, 117.83], ['C', ' C ', 180.326, 114.23, 116.676], ['C', ' O ', 180.443, 113.73, 115.558], ['C', ' CB ', 180.946, 112.479, 118.308], ['C', ' H ', 178.857, 111.722, 116.991], ['C', ' HA ', 179.539, 114.068, 118.628], ['C', ' HB ', 181.808, 113.056, 118.615], ['C', ' HB ', 180.588, 111.883, 119.148], ['C', ' HB ', 181.223, 111.828, 117.492]]
[['C', ' N ', 180.653, 115.481, 116.934], ['C', ' CA ', 181.225, 116.348, 115.909], ['C', ' C ', 182.542, 116.903, 116.408], ['C', ' O ', 183.062, 117.898, 115.904], ['C', ' CB ', 180.252, 117.447, 115.531], ['C', ' CG ', 178.997, 116.927, 114.849], ['C', ' SD ', 177.914, 118.233, 114.233], ['C', ' CE ', 177.231, 118.874, 115.74], ['C', ' H ', 180.486, 115.839, 117.891], ['C', ' HA ', 181.438, 115.758, 115.02], ['C', ' HB ', 179.972, 117.989, 116.428], ['C', ' HB ', 180.741, 118.15, 114.853], ['C', ' HG ', 179.295, 116.297, 114.009], ['C', ' HG ', 178.43, 116.309, 115.549], ['C', ' HE ', 176.541, 119.683, 115.51], ['C', ' HE ', 176.702, 118.077, 116.268], ['C', ' HE ', 178.025, 119.258, 116.374]]
[['C', ' N ', 183.043, 116.259, 117.437], ['C', ' CA ', 184.278, 116.597, 118.115], ['C', ' C ', 184.906, 115.372, 118.702], ['C', ' O ', 184.222, 114.476, 119.194], ['C', ' CB ', 184.072, 117.593, 119.222], ['C', ' OG ', 185.292, 117.785, 119.919], ['C', ' H ', 182.527, 115.448, 117.748], ['C', ' HA ', 184.97, 117.022, 117.386], ['C', ' HB ', 183.73, 118.539, 118.803], ['C', ' HB ', 183.302, 117.235, 119.907], ['C', ' HG ', 185.136, 118.518, 120.535]]
[['C', ' N ', 186.225, 115.326, 118.708], ['C', ' CA ', 186.889, 114.179, 119.289], ['C', ' C ', 186.597, 114.076, 120.783], ['C', ' O ', 186.509, 112.972, 121.324], ['C', ' CB ', 188.372, 114.278, 119.041], ['C', ' OG ', 188.91, 115.37, 119.722], ['C', ' H ', 186.772, 116.083, 118.315], ['C', ' HA ', 186.513, 113.281, 118.801], ['C', ' HB ', 188.859, 113.363, 119.37], ['C', ' HB ', 188.557, 114.384, 117.969], ['C', ' HG ', 189.846, 115.39, 119.493]]
[['C', ' N ', 186.269, 115.196, 121.43], ['C', ' CA ', 185.98, 115.196, 122.86], ['C', ' C ', 184.755, 114.356, 123.179], ['C', ' O ', 184.598, 113.839, 124.289], ['C', ' CB ', 185.69, 116.613, 123.342], ['C', ' CG ', 186.898, 117.536, 123.373], ['C', ' OD1', 188.009, 117.078, 123.291], ['C', ' OD2', 186.681, 118.717, 123.463], ['C', ' H ', 186.308, 116.092, 120.941], ['C', ' HA ', 186.839, 114.788, 123.392], ['C', ' HB ', 184.935, 117.057, 122.694], ['C', ' HB ', 185.265, 116.57, 124.344]]
[['C', ' N ', 183.854, 114.258, 122.216], ['C', ' CA ', 182.61, 113.553, 122.375], ['C', ' C ', 182.809, 112.07, 122.128], ['C', ' O ', 182.013, 111.246, 122.583], ['C', ' CB ', 181.582, 114.186, 121.464], ['C', ' CG ', 181.201, 115.611, 121.893], ['C', ' CD ', 180.37, 116.358, 120.884], ['C', ' OE1', 180.337, 115.928, 119.752], ['C', ' OE2', 179.778, 117.345, 121.237], ['C', ' H ', 184.051, 114.647, 121.291], ['C', ' HA ', 182.269, 113.689, 123.398], ['C', ' HB ', 181.988, 114.259, 120.472], ['C', ' HB ', 180.698, 113.566, 121.425], ['C', ' HG ', 180.647, 115.553, 122.83], ['C', ' HG ', 182.114, 116.174, 122.083]]
[['C', ' N ', 183.863, 111.714, 121.39], ['C', ' CA ', 184.115, 110.324, 121.116], ['C', ' C ', 184.794, 109.795, 122.358], ['C', ' O ', 184.65, 108.625, 122.71], ['C', ' CB ', 185.001, 110.161, 119.878], ['C', ' CG ', 184.395, 110.64, 118.523], ['C', ' CD1', 185.443, 110.534, 117.459], ['C', ' CD2', 183.22, 109.797, 118.139], ['C', ' H ', 184.53, 112.399, 121.044], ['C', ' HA ', 183.176, 109.796, 120.986], ['C', ' HB ', 185.921, 110.723, 120.043], ['C', ' HB ', 185.262, 109.106, 119.773], ['C', ' HG ', 184.088, 111.688, 118.607], ['C', ' HD1', 185.041, 110.873, 116.507], ['C', ' HD1', 186.278, 111.156, 117.741], ['C', ' HD1', 185.77, 109.499, 117.363], ['C', ' HD2', 182.831, 110.136, 117.189], ['C', ' HD2', 183.543, 108.766, 118.047], ['C', ' HD2', 182.439, 109.87, 118.886]]
[['C', ' N ', 185.549, 110.677, 123.023], ['C', ' CA ', 186.172, 110.305, 124.273], ['C', ' C ', 185.082, 110.171, 125.327], ['C', ' O ', 185.007, 109.171, 126.027], ['C', ' CB ', 187.221, 111.326, 124.707], ['C', ' CG ', 188.495, 111.322, 123.872], ['C', ' CD ', 189.488, 112.401, 124.346], ['C', ' CE ', 190.79, 112.362, 123.532], ['C', ' NZ ', 191.748, 113.482, 123.88], ['C', ' H ', 185.697, 111.604, 122.617], ['C', ' HA ', 186.657, 109.337, 124.154], ['C', ' HB ', 186.792, 112.327, 124.645], ['C', ' HB ', 187.491, 111.153, 125.744], ['C', ' HG ', 188.968, 110.341, 123.945], ['C', ' HG ', 188.236, 111.503, 122.826], ['C', ' HD ', 189.033, 113.389, 124.241], ['C', ' HD ', 189.733, 112.237, 125.398], ['C', ' HE ', 191.286, 111.425, 123.726], ['C', ' HE ', 190.546, 112.423, 122.471], ['C', ' HZ ', 192.588, 113.393, 123.316], ['C', ' HZ ', 191.319, 114.374, 123.694], ['C', ' HZ ', 192.043, 113.467, 124.872]]
[['C', ' N ', 184.124, 111.097, 125.353], ['C', ' CA ', 183.033, 111.001, 126.316], ['C', ' C ', 182.234, 109.711, 126.135], ['C', ' O ', 181.776, 109.107, 127.104], ['C', ' CB ', 182.109, 112.185, 126.167], ['C', ' H ', 184.208, 111.941, 124.781], ['C', ' HA ', 183.467, 111.002, 127.315], ['C', ' HB ', 181.314, 112.119, 126.907], ['C', ' HB ', 182.673, 113.107, 126.311], ['C', ' HB ', 181.677, 112.176, 125.171]]
[['C', ' N ', 182.094, 109.276, 124.889], ['C', ' CA ', 181.369, 108.069, 124.528], ['C', ' C ', 182.226, 106.795, 124.65], ['C', ' O ', 181.745, 105.704, 124.33], ['C', ' CB ', 180.85, 108.205, 123.106], ['C', ' H ', 182.449, 109.865, 124.132], ['C', ' HA ', 180.532, 107.969, 125.212], ['C', ' HB ', 180.272, 107.32, 122.836], ['C', ' HB ', 180.22, 109.091, 123.029], ['C', ' HB ', 181.699, 108.306, 122.432]]
[['C', ' N ', 183.493, 106.933, 125.043], ['C', ' CA ', 184.439, 105.828, 125.153], ['C', ' C ', 184.029, 104.834, 126.213], ['C', ' O ', 183.5, 105.197, 127.262], ['C', ' CB ', 185.816, 106.347, 125.498], ['C', ' H ', 183.836, 107.857, 125.308], ['C', ' HA ', 184.468, 105.314, 124.193], ['C', ' HB ', 186.522, 105.523, 125.56], ['C', ' HB ', 186.137, 107.051, 124.739], ['C', ' HB ', 185.754, 106.851, 126.451]]
[['C', ' N ', 184.322, 103.572, 125.955], ['C', ' CA ', 184.037, 102.504, 126.895], ['C', ' C ', 183.052, 101.568, 126.236], ['C', ' O ', 182.382, 101.946, 125.275], ['C', ' H ', 184.734, 103.334, 125.067], ['C', ' HA ', 184.956, 101.977, 127.157], ['C', ' HA ', 183.615, 102.913, 127.812]]
[['C', ' N ', 182.948, 100.351, 126.729], ['C', ' CA ', 182.033, 99.414, 126.109], ['C', ' C ', 180.852, 99.182, 127.002], ['C', ' O ', 180.997, 98.901, 128.187], ['C', ' CB ', 182.721, 98.076, 125.785], ['C', ' OG1', 183.804, 98.296, 124.868], ['C', ' CG2', 181.724, 97.132, 125.124], ['C', ' H ', 183.492, 100.072, 127.532], ['C', ' HA ', 181.667, 99.835, 125.174], ['C', ' HB ', 183.107, 97.628, 126.701], ['C', ' HG1', 184.371, 97.523, 124.862], ['C', ' HG2', 182.222, 96.195, 124.888], ['C', ' HG2', 180.888, 96.93, 125.786], ['C', ' HG2', 181.35, 97.581, 124.207]]
[['C', ' N ', 179.683, 99.341, 126.428], ['C', ' CA ', 178.44, 99.121, 127.118], ['C', ' C ', 177.978, 97.79, 126.578], ['C', ' O ', 178.199, 97.508, 125.403], ['C', ' CB ', 177.468, 100.281, 126.862], ['C', ' CG ', 177.752, 101.553, 127.736], ['C', ' CD ', 178.898, 102.478, 127.228], ['C', ' CE ', 178.447, 103.405, 126.113], ['C', ' NZ ', 179.559, 104.306, 125.645], ['C', ' H ', 179.669, 99.594, 125.449], ['C', ' HA ', 178.615, 99.021, 128.19], ['C', ' HB ', 177.497, 100.56, 125.812], ['C', ' HB ', 176.45, 99.96, 127.084], ['C', ' HG ', 176.841, 102.151, 127.776], ['C', ' HG ', 177.989, 101.249, 128.732], ['C', ' HD ', 179.238, 103.091, 128.061], ['C', ' HD ', 179.746, 101.915, 126.875], ['C', ' HE ', 178.091, 102.827, 125.265], ['C', ' HE ', 177.629, 104.029, 126.483], ['C', ' HZ ', 179.19, 104.915, 124.908], ['C', ' HZ ', 179.912, 104.881, 126.391], ['C', ' HZ ', 180.326, 103.754, 125.26]]
[['C', ' N ', 177.353, 96.977, 127.412], ['C', ' CA ', 176.947, 95.632, 126.999], ['C', ' C ', 175.466, 95.439, 126.821], ['C', ' O ', 174.98, 94.303, 126.851], ['C', ' CB ', 177.548, 94.619, 127.96], ['C', ' CG ', 179.024, 94.653, 127.84], ['C', ' CD1', 179.735, 95.454, 128.665], ['C', ' CD2', 179.673, 93.914, 126.871], ['C', ' CE1', 181.07, 95.539, 128.531], ['C', ' CE2', 181.042, 94.004, 126.755], ['C', ' CZ ', 181.73, 94.828, 127.602], ['C', ' OH ', 183.097, 94.981, 127.512], ['C', ' H ', 177.206, 97.286, 128.364], ['C', ' HA ', 177.393, 95.441, 126.021], ['C', ' HB ', 177.273, 94.86, 128.988], ['C', ' HB ', 177.195, 93.613, 127.732], ['C', ' HD1', 179.231, 96.055, 129.421], ['C', ' HD2', 179.106, 93.271, 126.195], ['C', ' HE1', 181.623, 96.195, 129.157], ['C', ' HE2', 181.569, 93.434, 125.991], ['C', ' HH ', 183.434, 95.432, 128.344]]
[['C', ' N ', 174.764, 96.544, 126.664], ['C', ' CA ', 173.342, 96.521, 126.413], ['C', ' C ', 173.042, 97.134, 125.068], ['C', ' O ', 173.938, 97.393, 124.265], ['C', ' CB ', 172.498, 97.163, 127.521], ['C', ' OG1', 171.125, 96.868, 127.262], ['C', ' CG2', 172.706, 98.613, 127.602], ['C', ' H ', 175.255, 97.425, 126.672], ['C', ' HA ', 173.039, 95.487, 126.336], ['C', ' HB ', 172.757, 96.714, 128.455], ['C', ' HG1', 171.023, 95.901, 127.431], ['C', ' HG2', 172.092, 99.018, 128.395], ['C', ' HG2', 173.754, 98.807, 127.816], ['C', ' HG2', 172.432, 99.083, 126.668]]
[['C', ' N ', 171.776, 97.306, 124.797], ['C', ' CA ', 171.334, 97.784, 123.516], ['C', ' C ', 171.34, 99.27, 123.353], ['C', ' O ', 170.789, 100.014, 124.161], ['C', ' CB ', 169.943, 97.255, 123.264], ['C', ' CG ', 170.031, 95.848, 123.039], ['C', ' CD1', 169.979, 94.968, 124.083], ['C', ' CD2', 170.222, 95.379, 121.782], ['C', ' CE1', 170.128, 93.651, 123.858], ['C', ' CE2', 170.369, 94.076, 121.56], ['C', ' CZ ', 170.329, 93.213, 122.585], ['C', ' H ', 171.12, 97.104, 125.535], ['C', ' HA ', 172.002, 97.366, 122.761], ['C', ' HB ', 169.298, 97.441, 124.124], ['C', ' HB ', 169.509, 97.733, 122.387], ['C', ' HD1', 169.841, 95.336, 125.081], ['C', ' HD2', 170.276, 96.073, 120.938], ['C', ' HE1', 170.104, 92.945, 124.677], ['C', ' HE2', 170.535, 93.722, 120.552], ['C', ' HZ ', 170.478, 92.176, 122.39]]
[['C', ' N ', 171.908, 99.675, 122.236], ['C', ' CA ', 172.001, 101.053, 121.826], ['C', ' C ', 171.702, 101.083, 120.346], ['C', ' O ', 172.545, 100.668, 119.549], ['C', ' CB ', 173.385, 101.598, 121.982], ['C', ' OG ', 173.393, 102.926, 121.591], ['C', ' H ', 172.332, 98.97, 121.65], ['C', ' HA ', 171.312, 101.649, 122.411], ['C', ' HB ', 173.725, 101.498, 122.974], ['C', ' HB ', 174.07, 101.032, 121.352], ['C', ' HG ', 174.311, 103.202, 121.575]]
[['C', ' N ', 170.535, 101.535, 119.904], ['C', ' CA ', 170.121, 101.535, 118.521], ['C', ' C ', 170.825, 102.679, 117.823], ['C', ' O ', 170.221, 103.669, 117.443], ['C', ' CB ', 168.615, 101.725, 118.64], ['C', ' CG ', 168.452, 102.559, 119.881], ['C', ' CD ', 169.545, 102.087, 120.827], ['C', ' HA ', 170.367, 100.568, 118.055], ['C', ' HB ', 168.223, 102.224, 117.742], ['C', ' HB ', 168.123, 100.742, 118.705], ['C', ' HG ', 168.561, 103.61, 119.624], ['C', ' HG ', 167.441, 102.443, 120.299], ['C', ' HD ', 169.944, 102.965, 121.359], ['C', ' HD ', 169.166, 101.306, 121.51]]
[['C', ' N ', 172.133, 102.548, 117.667], ['C', ' CA ', 172.966, 103.614, 117.136], ['C', ' C ', 172.624, 103.984, 115.719], ['C', ' O ', 172.673, 105.147, 115.339], ['C', ' CB ', 174.42, 103.211, 117.174], ['C', ' CG ', 175.024, 103.217, 118.53], ['C', ' OD1', 174.619, 103.925, 119.461], ['C', ' ND2', 176.018, 102.387, 118.665], ['C', ' H ', 172.556, 101.689, 118.016], ['C', ' HA ', 172.826, 104.489, 117.742], ['C', ' HB ', 174.523, 102.205, 116.757], ['C', ' HB ', 174.997, 103.88, 116.539], ['C', ' HD2', 176.49, 102.294, 119.535], ['C', ' HD2', 176.308, 101.828, 117.886]]
[['C', ' N ', 172.178, 103.027, 114.948], ['C', ' CA ', 171.894, 103.27, 113.553], ['C', ' C ', 170.84, 104.327, 113.338], ['C', ' O ', 170.97, 105.153, 112.447], ['C', ' CB ', 171.491, 101.97, 112.871], ['C', ' CG1', 170.992, 102.205, 111.502], ['C', ' CG2', 172.672, 101.066, 112.841], ['C', ' H ', 172.121, 102.09, 115.325], ['C', ' HA ', 172.814, 103.617, 113.082], ['C', ' HB ', 170.713, 101.522, 113.412], ['C', ' HG1', 170.735, 101.269, 111.079], ['C', ' HG1', 170.113, 102.835, 111.525], ['C', ' HG1', 171.759, 102.664, 110.905], ['C', ' HG2', 172.4, 100.113, 112.372], ['C', ' HG2', 173.463, 101.532, 112.277], ['C', ' HG2', 173.005, 100.887, 113.852]]
[['C', ' N ', 169.808, 104.366, 114.152], ['C', ' CA ', 168.729, 105.302, 113.895], ['C', ' C ', 169.161, 106.742, 113.979], ['C', ' O ', 168.543, 107.613, 113.373], ['C', ' CB ', 167.563, 105.047, 114.831], ['C', ' CG ', 167.711, 105.546, 116.227], ['C', ' SD ', 166.334, 105.027, 117.214], ['C', ' CE ', 166.633, 105.877, 118.739], ['C', ' H ', 169.755, 103.719, 114.926], ['C', ' HA ', 168.39, 105.154, 112.897], ['C', ' HB ', 166.662, 105.48, 114.406], ['C', ' HB ', 167.395, 103.98, 114.903], ['C', ' HG ', 168.617, 105.186, 116.668], ['C', ' HG ', 167.741, 106.634, 116.234], ['C', ' HE ', 165.837, 105.633, 119.457], ['C', ' HE ', 167.589, 105.585, 119.146], ['C', ' HE ', 166.631, 106.951, 118.564]]
[['C', ' N ', 170.246, 107.017, 114.675], ['C', ' CA ', 170.75, 108.359, 114.832], ['C', ' C ', 171.361, 108.891, 113.538], ['C', ' O ', 171.478, 110.108, 113.354], ['C', ' CB ', 171.704, 108.392, 116.007], ['C', ' CG ', 172.321, 109.706, 116.29], ['C', ' SD ', 171.145, 110.905, 116.773], ['C', ' CE ', 172.011, 112.33, 116.196], ['C', ' H ', 170.787, 106.261, 115.1], ['C', ' HA ', 169.908, 109.003, 115.075], ['C', ' HB ', 171.155, 108.11, 116.899], ['C', ' HB ', 172.445, 107.657, 115.875], ['C', ' HG ', 173.03, 109.579, 117.102], ['C', ' HG ', 172.871, 110.075, 115.429], ['C', ' HE ', 171.427, 113.202, 116.417], ['C', ' HE ', 172.955, 112.39, 116.702], ['C', ' HE ', 172.173, 112.258, 115.116]]
[['C', ' N ', 171.714, 107.999, 112.614], ['C', ' CA ', 172.343, 108.395, 111.369], ['C', ' C ', 171.39, 109.275, 110.561], ['C', ' O ', 171.829, 110.117, 109.776], ['C', ' CB ', 172.707, 107.16, 110.537], ['C', ' CG ', 173.835, 106.204, 111.057], ['C', ' CD1', 173.849, 104.956, 110.201], ['C', ' CD2', 175.196, 106.849, 110.974], ['C', ' H ', 171.525, 107.004, 112.764], ['C', ' HA ', 173.239, 108.957, 111.594], ['C', ' HB ', 171.821, 106.562, 110.488], ['C', ' HB ', 172.967, 107.478, 109.527], ['C', ' HG ', 173.618, 105.924, 112.091], ['C', ' HD1', 174.613, 104.273, 110.564], ['C', ' HD1', 172.882, 104.481, 110.264], ['C', ' HD1', 174.058, 105.216, 109.165], ['C', ' HD2', 175.953, 106.151, 111.338], ['C', ' HD2', 175.417, 107.111, 109.938], ['C', ' HD2', 175.22, 107.73, 111.576]]
[['C', ' N ', 170.066, 109.095, 110.706], ['C', ' CA ', 169.169, 109.896, 109.885], ['C', ' C ', 169.288, 111.382, 110.186], ['C', ' O ', 169.111, 112.218, 109.289], ['C', ' CB ', 167.702, 109.495, 110.113], ['C', ' CG ', 167.101, 109.934, 111.491], ['C', ' CD ', 165.69, 109.396, 111.704], ['C', ' CE ', 165.045, 109.887, 113.031], ['C', ' NZ ', 165.705, 109.342, 114.249], ['C', ' H ', 169.672, 108.421, 111.372], ['C', ' HA ', 169.423, 109.731, 108.851], ['C', ' HB ', 167.085, 109.936, 109.333], ['C', ' HB ', 167.596, 108.42, 110.027], ['C', ' HG ', 167.745, 109.626, 112.299], ['C', ' HG ', 167.01, 111.017, 111.516], ['C', ' HD ', 165.059, 109.705, 110.873], ['C', ' HD ', 165.718, 108.315, 111.721], ['C', ' HE ', 165.086, 110.973, 113.072], ['C', ' HE ', 164.006, 109.568, 113.04], ['C', ' HZ ', 165.223, 109.679, 115.073], ['C', ' HZ ', 165.648, 108.332, 114.213], ['C', ' HZ ', 166.671, 109.64, 114.29]]
[['C', ' N ', 169.571, 111.713, 111.457], ['C', ' CA ', 169.619, 113.084, 111.921], ['C', ' C ', 171.03, 113.586, 111.756], ['C', ' O ', 171.306, 114.761, 111.49], ['C', ' CB ', 169.182, 113.14, 113.379], ['C', ' CG ', 169.005, 114.518, 113.926], ['C', ' CD ', 168.43, 114.49, 115.34], ['C', ' CE ', 168.169, 115.899, 115.828], ['C', ' NZ ', 167.514, 115.94, 117.174], ['C', ' H ', 169.758, 110.991, 112.151], ['C', ' HA ', 168.946, 113.684, 111.319], ['C', ' HB ', 168.238, 112.612, 113.488], ['C', ' HB ', 169.916, 112.618, 113.993], ['C', ' HG ', 169.942, 115.03, 113.929], ['C', ' HG ', 168.326, 115.07, 113.273], ['C', ' HD ', 167.493, 113.934, 115.35], ['C', ' HD ', 169.13, 114.003, 116.016], ['C', ' HE ', 169.104, 116.454, 115.873], ['C', ' HE ', 167.514, 116.376, 115.109], ['C', ' HZ ', 167.319, 116.927, 117.415], ['C', ' HZ ', 166.631, 115.454, 117.125], ['C', ' HZ ', 168.096, 115.521, 117.874]]
[['C', ' N ', 171.96, 112.673, 111.928], ['C', ' CA ', 173.331, 113.045, 111.816], ['C', ' C ', 173.589, 113.581, 110.41], ['C', ' O ', 174.341, 114.545, 110.249], ['C', ' CB ', 174.191, 111.866, 112.156], ['C', ' H ', 171.709, 111.716, 112.181], ['C', ' HA ', 173.537, 113.833, 112.532], ['C', ' HB ', 175.205, 112.145, 112.098], ['C', ' HB ', 173.96, 111.532, 113.164], ['C', ' HB ', 173.99, 111.075, 111.464]]
[['C', ' N ', 172.943, 112.998, 109.393], ['C', ' CA ', 173.171, 113.559, 108.079], ['C', ' C ', 172.255, 114.764, 107.885], ['C', ' O ', 172.718, 115.828, 107.489], ['C', ' CB ', 172.895, 112.568, 106.941], ['C', ' CG1', 173.089, 113.269, 105.584], ['C', ' CG2', 173.788, 111.409, 107.05], ['C', ' H ', 172.369, 112.161, 109.549], ['C', ' HA ', 174.209, 113.882, 108.01], ['C', ' HB ', 171.87, 112.236, 107.004], ['C', ' HG1', 172.882, 112.56, 104.782], ['C', ' HG1', 172.441, 114.127, 105.471], ['C', ' HG1', 174.129, 113.608, 105.51], ['C', ' HG2', 173.589, 110.706, 106.24], ['C', ' HG2', 174.829, 111.744, 106.995], ['C', ' HG2', 173.602, 110.925, 107.994]]
[['C', ' N ', 170.955, 114.616, 108.137], ['C', ' CA ', 170.049, 115.734, 107.948], ['C', ' C ', 169.746, 116.361, 109.27], ['C', ' O ', 169.246, 115.682, 110.151], ['C', ' CB ', 168.766, 115.318, 107.288], ['C', ' CG ', 168.879, 115.034, 105.798], ['C', ' CD ', 169.373, 113.677, 105.558], ['C', ' NE ', 168.569, 112.723, 106.232], ['C', ' CZ ', 167.469, 112.188, 105.747], ['C', ' NH1', 167.09, 112.493, 104.538], ['C', ' NH2', 166.777, 111.352, 106.499], ['C', ' H ', 170.573, 113.729, 108.471], ['C', ' HA ', 170.524, 116.463, 107.319], ['C', ' HB ', 168.36, 114.457, 107.806], ['C', ' HB ', 168.041, 116.123, 107.402], ['C', ' HG ', 167.9, 115.148, 105.338], ['C', ' HG ', 169.578, 115.74, 105.351], ['C', ' HD ', 169.372, 113.461, 104.496], ['C', ' HD ', 170.343, 113.57, 105.9], ['C', ' HE ', 168.842, 112.464, 107.192], ['C', ' HH1', 167.624, 113.134, 103.978], ['C', ' HH1', 166.264, 112.065, 104.157], ['C', ' HH2', 167.103, 111.136, 107.432], ['C', ' HH2', 165.897, 110.926, 106.16]]
[['C', ' N ', 169.916, 117.676, 109.349], ['C', ' CA ', 169.754, 118.51, 110.539], ['C', ' C ', 171.139, 118.849, 111.087], ['C', ' O ', 171.48, 120.032, 111.248], ['C', ' CB ', 168.975, 117.796, 111.645], ['C', ' CG ', 168.496, 118.679, 112.67], ['C', ' CD ', 167.388, 119.466, 112.067], ['C', ' OE1', 166.451, 118.844, 111.565], ['C', ' NE2', 167.467, 120.763, 112.093], ['C', ' H ', 170.255, 118.143, 108.521], ['C', ' HA ', 169.26, 119.437, 110.263], ['C', ' HB ', 168.086, 117.319, 111.248], ['C', ' HB ', 169.6, 117.044, 112.129], ['C', ' HG ', 168.116, 118.101, 113.502], ['C', ' HG ', 169.284, 119.361, 112.995], ['C', ' HE2', 166.725, 121.326, 111.707], ['C', ' HE2', 168.261, 121.198, 112.541]]
[['C', ' N ', 171.961, 117.838, 111.345], ['C', ' CA ', 173.326, 118.141, 111.739], ['C', ' C ', 174.196, 118.548, 110.547], ['C', ' O ', 175.144, 119.307, 110.707], ['C', ' CB ', 173.958, 117.009, 112.508], ['C', ' CG ', 173.503, 116.94, 113.893], ['C', ' CD1', 172.574, 116.042, 114.283], ['C', ' CD2', 174.034, 117.798, 114.788], ['C', ' CE1', 172.169, 116.003, 115.575], ['C', ' CE2', 173.641, 117.766, 116.088], ['C', ' CZ ', 172.708, 116.865, 116.481], ['C', ' OH ', 172.3, 116.819, 117.786], ['C', ' H ', 171.64, 116.862, 111.272], ['C', ' HA ', 173.282, 118.983, 112.419], ['C', ' HB ', 173.717, 116.087, 112.03], ['C', ' HB ', 175.032, 117.123, 112.507], ['C', ' HD1', 172.155, 115.365, 113.578], ['C', ' HD2', 174.774, 118.512, 114.462], ['C', ' HE1', 171.425, 115.294, 115.886], ['C', ' HE2', 174.074, 118.461, 116.81], ['C', ' HH ', 172.759, 117.499, 118.289]]
[['C', ' N ', 173.867, 118.079, 109.345], ['C', ' CA ', 174.633, 118.437, 108.154], ['C', ' C ', 175.951, 117.728, 108.003], ['C', ' O ', 176.902, 118.301, 107.468], ['C', ' H ', 173.084, 117.445, 109.242], ['C', ' HA ', 174.034, 118.205, 107.282], ['C', ' HA ', 174.815, 119.502, 108.131]]
[['C', ' N ', 176.044, 116.502, 108.471], ['C', ' CA ', 177.298, 115.818, 108.359], ['C', ' C ', 177.247, 114.956, 107.106], ['C', ' O ', 176.467, 114.018, 107.021], ['C', ' CB ', 177.465, 114.956, 109.6], ['C', ' CG1', 177.382, 115.849, 110.85], ['C', ' CG2', 178.792, 114.33, 109.55], ['C', ' CD1', 177.168, 115.099, 112.105], ['C', ' H ', 175.257, 116.022, 108.923], ['C', ' HA ', 178.113, 116.538, 108.275], ['C', ' HB ', 176.692, 114.203, 109.649], ['C', ' HG1', 178.306, 116.412, 110.946], ['C', ' HG1', 176.564, 116.548, 110.744], ['C', ' HG2', 178.977, 113.755, 110.411], ['C', ' HG2', 178.891, 113.698, 108.676], ['C', ' HG2', 179.488, 115.121, 109.516], ['C', ' HD1', 177.106, 115.779, 112.932], ['C', ' HD1', 176.229, 114.56, 112.021], ['C', ' HD1', 177.962, 114.408, 112.282]]
[['C', ' N ', 178.089, 115.254, 106.124], ['C', ' CA ', 178.036, 114.559, 104.842], ['C', ' C ', 179.001, 113.379, 104.77], ['C', ' O ', 179.159, 112.744, 103.726], ['C', ' CB ', 178.313, 115.541, 103.703], ['C', ' CG ', 177.263, 116.666, 103.572], ['C', ' CD ', 177.501, 117.589, 102.373], ['C', ' OE1', 178.271, 117.227, 101.515], ['C', ' OE2', 176.899, 118.645, 102.315], ['C', ' H ', 178.777, 116.012, 106.233], ['C', ' HA ', 177.026, 114.172, 104.71], ['C', ' HB ', 179.284, 116.014, 103.87], ['C', ' HB ', 178.367, 115.009, 102.758], ['C', ' HG ', 176.276, 116.213, 103.482], ['C', ' HG ', 177.274, 117.262, 104.489]]
[['C', ' N ', 179.715, 113.144, 105.849], ['C', ' CA ', 180.686, 112.066, 105.918], ['C', ' C ', 180.678, 111.393, 107.283], ['C', ' O ', 181.469, 111.743, 108.158], ['C', ' CB ', 182.081, 112.598, 105.652], ['C', ' CG ', 182.296, 113.214, 104.289], ['C', ' CD ', 183.717, 113.686, 104.149], ['C', ' CE ', 183.967, 114.335, 102.828], ['C', ' NZ ', 185.339, 114.902, 102.762], ['C', ' H ', 179.533, 113.725, 106.654], ['C', ' HA ', 180.426, 111.315, 105.173], ['C', ' HB ', 182.319, 113.34, 106.386], ['C', ' HB ', 182.803, 111.79, 105.768], ['C', ' HG ', 182.057, 112.493, 103.511], ['C', ' HG ', 181.646, 114.081, 104.176], ['C', ' HD ', 183.963, 114.39, 104.941], ['C', ' HD ', 184.383, 112.835, 104.237], ['C', ' HE ', 183.851, 113.593, 102.041], ['C', ' HE ', 183.242, 115.136, 102.672], ['C', ' HZ ', 185.487, 115.331, 101.865], ['C', ' HZ ', 185.437, 115.604, 103.49], ['C', ' HZ ', 186.023, 114.169, 102.905]]
[['C', ' N ', 179.761, 110.485, 107.515], ['C', ' CA ', 179.657, 109.878, 108.823], ['C', ' C ', 180.461, 108.649, 109.062], ['C', ' O ', 180.671, 107.795, 108.179], ['C', ' CB ', 178.21, 109.516, 109.157], ['C', ' CG ', 177.274, 110.648, 109.324], ['C', ' CD1', 175.905, 110.149, 109.393], ['C', ' CD2', 177.567, 111.328, 110.641], ['C', ' H ', 179.107, 110.224, 106.79], ['C', ' HA ', 180.01, 110.607, 109.532], ['C', ' HB ', 177.824, 108.887, 108.358], ['C', ' HB ', 178.207, 108.932, 110.082], ['C', ' HG ', 177.379, 111.347, 108.487], ['C', ' HD1', 175.247, 110.99, 109.529], ['C', ' HD1', 175.66, 109.628, 108.465], ['C', ' HD1', 175.809, 109.48, 110.223], ['C', ' HD2', 176.894, 112.153, 110.767], ['C', ' HD2', 177.443, 110.623, 111.461], ['C', ' HD2', 178.556, 111.686, 110.659]]
[['C', ' N ', 180.861, 108.541, 110.311], ['C', ' CA ', 181.463, 107.333, 110.777], ['C', ' C ', 180.573, 106.74, 111.857], ['C', ' O ', 179.611, 107.373, 112.307], ['C', ' H ', 180.735, 109.34, 110.943], ['C', ' HA ', 181.561, 106.633, 109.955], ['C', ' HA ', 182.459, 107.531, 111.156]]
[['C', ' N ', 180.882, 105.52, 112.234], ['C', ' CA ', 180.188, 104.799, 113.305], ['C', ' C ', 181.016, 103.586, 113.679], ['C', ' O ', 181.808, 103.182, 112.851], ['C', ' CB ', 178.762, 104.412, 112.919], ['C', ' OG1', 178.131, 103.864, 114.07], ['C', ' CG2', 178.756, 103.397, 111.782], ['C', ' H ', 181.649, 105.077, 111.72], ['C', ' HA ', 180.126, 105.442, 114.186], ['C', ' HB ', 178.214, 105.3, 112.612], ['C', ' HG1', 178.1, 104.578, 114.783], ['C', ' HG2', 177.733, 103.147, 111.543], ['C', ' HG2', 179.242, 103.829, 110.905], ['C', ' HG2', 179.286, 102.498, 112.08]]
[['C', ' N ', 180.807, 102.981, 114.856], ['C', ' CA ', 181.037, 101.979, 115.896], ['C', ' C ', 179.926, 100.94, 116.042], ['C', ' O ', 179.689, 100.434, 117.132], ['C', ' CB ', 181.239, 102.652, 117.249], ['C', ' CG1', 182.478, 103.493, 117.203], ['C', ' CG2', 180.047, 103.468, 117.585], ['C', ' H ', 181.459, 102.321, 114.421], ['C', ' HA ', 181.961, 101.458, 115.664], ['C', ' HB ', 181.385, 101.899, 118.002], ['C', ' HG1', 182.649, 103.964, 118.172], ['C', ' HG1', 183.325, 102.873, 116.947], ['C', ' HG1', 182.35, 104.255, 116.45], ['C', ' HG2', 180.211, 103.932, 118.55], ['C', ' HG2', 179.909, 104.23, 116.82], ['C', ' HG2', 179.154, 102.849, 117.635]]
[['C', ' N ', 179.231, 100.654, 114.964], ['C', ' CA ', 178.15, 99.676, 114.979], ['C', ' C ', 178.605, 98.257, 115.363], ['C', ' O ', 179.678, 97.791, 114.995], ['C', ' CB ', 177.493, 99.631, 113.615], ['C', ' H ', 179.462, 101.14, 114.11], ['C', ' HA ', 177.417, 99.998, 115.719], ['C', ' HB ', 176.678, 98.943, 113.621], ['C', ' HB ', 177.13, 100.621, 113.351], ['C', ' HB ', 178.212, 99.311, 112.901]]
[['C', ' N ', 177.751, 97.568, 116.084], ['C', ' CA ', 177.973, 96.174, 116.469], ['C', ' C ', 177.569, 95.387, 115.195], ['C', ' O ', 176.814, 95.955, 114.416], ['C', ' CB ', 177.092, 95.928, 117.718], ['C', ' CG1', 177.466, 94.721, 118.469], ['C', ' CG2', 175.714, 95.804, 117.266], ['C', ' CD1', 176.907, 94.611, 119.843], ['C', ' H ', 176.884, 98.054, 116.376], ['C', ' HA ', 179.027, 96.008, 116.7], ['C', ' HB ', 177.177, 96.788, 118.386], ['C', ' HG1', 177.092, 93.872, 117.929], ['C', ' HG1', 178.56, 94.678, 118.548], ['C', ' HG2', 175.028, 95.684, 118.09], ['C', ' HG2', 175.466, 96.656, 116.744], ['C', ' HG2', 175.634, 94.97, 116.63], ['C', ' HD1', 177.246, 93.687, 120.301], ['C', ' HD1', 177.253, 95.451, 120.445], ['C', ' HD1', 175.837, 94.607, 119.81]]
[['C', ' N ', 177.984, 94.141, 114.869], ['C', ' CA ', 177.569, 93.452, 113.655], ['C', ' C ', 176.061, 93.381, 113.467], ['C', ' O ', 175.551, 93.601, 112.366], ['C', ' CB ', 178.145, 92.059, 113.871], ['C', ' CG ', 178.447, 91.999, 115.295], ['C', ' CD ', 178.881, 93.385, 115.634], ['C', ' HA ', 178.07, 93.901, 112.804], ['C', ' HB ', 177.404, 91.299, 113.586], ['C', ' HB ', 179.005, 91.885, 113.25], ['C', ' HG ', 177.556, 91.668, 115.835], ['C', ' HG ', 179.234, 91.231, 115.461], ['C', ' HD ', 178.838, 93.558, 116.643], ['C', ' HD ', 179.886, 93.535, 115.262]]
[['C', ' N ', 175.337, 93.313, 114.57], ['C', ' CA ', 173.884, 93.259, 114.587], ['C', ' C ', 173.273, 94.511, 113.93], ['C', ' O ', 172.103, 94.53, 113.552], ['C', ' CB ', 173.417, 93.247, 116.038], ['C', ' SG ', 174.192, 91.988, 117.078], ['C', ' H ', 175.826, 93.134, 115.436], ['C', ' HA ', 173.551, 92.363, 114.054], ['C', ' HB ', 173.561, 94.212, 116.484], ['C', ' HB ', 172.367, 93.067, 116.06], ['C', ' HG ', 173.387, 90.963, 116.724]]
[['C', ' N ', 174.072, 95.578, 113.88], ['C', ' CA ', 173.763, 96.89, 113.342], ['C', ' C ', 174.515, 97.166, 112.055], ['C', ' O ', 173.968, 97.751, 111.117], ['C', ' CB ', 174.123, 97.936, 114.374], ['C', ' CG ', 173.296, 97.88, 115.573], ['C', ' CD ', 173.793, 98.731, 116.666], ['C', ' OE1', 175.013, 99.046, 116.76], ['C', ' NE2', 172.876, 99.082, 117.554], ['C', ' H ', 175.025, 95.453, 114.214], ['C', ' HA ', 172.693, 96.943, 113.14], ['C', ' HB ', 175.131, 97.768, 114.692], ['C', ' HB ', 174.081, 98.911, 113.944], ['C', ' HG ', 172.334, 98.269, 115.298], ['C', ' HG ', 173.193, 96.858, 115.928], ['C', ' HE2', 173.131, 99.639, 118.365], ['C', ' HE2', 171.886, 98.773, 117.472]]
[['C', ' N ', 175.74, 96.654, 111.968], ['C', ' CA ', 176.615, 96.856, 110.818], ['C', ' C ', 175.902, 96.345, 109.613], ['C', ' O ', 175.883, 96.988, 108.558], ['C', ' CB ', 177.901, 96.048, 110.967], ['C', ' OG1', 178.632, 96.497, 112.115], ['C', ' CG2', 178.765, 96.137, 109.75], ['C', ' H ', 176.11, 96.17, 112.774], ['C', ' HA ', 176.827, 97.918, 110.7], ['C', ' HB ', 177.634, 95.022, 111.083], ['C', ' HG1', 178.102, 96.369, 112.922], ['C', ' HG2', 179.64, 95.524, 109.908], ['C', ' HG2', 178.236, 95.783, 108.885], ['C', ' HG2', 179.058, 97.134, 109.581]]
[['C', ' N ', 175.304, 95.174, 109.77], ['C', ' CA ', 174.575, 94.608, 108.678], ['C', ' C ', 173.379, 95.456, 108.367], ['C', ' O ', 173.014, 95.552, 107.213], ['C', ' CB ', 174.161, 93.183, 109.007], ['C', ' CG ', 173.108, 93.027, 110.106], ['C', ' SD ', 172.65, 91.304, 110.404], ['C', ' CE ', 174.13, 90.622, 111.158], ['C', ' H ', 175.402, 94.676, 110.661], ['C', ' HA ', 175.214, 94.608, 107.801], ['C', ' HB ', 173.812, 92.693, 108.12], ['C', ' HB ', 175.045, 92.655, 109.342], ['C', ' HG ', 173.473, 93.448, 111.036], ['C', ' HG ', 172.203, 93.557, 109.838], ['C', ' HE ', 173.974, 89.572, 111.407], ['C', ' HE ', 174.968, 90.694, 110.472], ['C', ' HE ', 174.372, 91.169, 112.065]]
[['C', ' N ', 172.801, 96.123, 109.352], ['C', ' CA ', 171.638, 96.944, 109.125], ['C', ' C ', 171.986, 98.089, 108.204], ['C', ' O ', 171.188, 98.483, 107.353], ['C', ' H ', 173.156, 96.053, 110.296], ['C', ' HA ', 170.832, 96.349, 108.705], ['C', ' HA ', 171.309, 97.333, 110.087]]
[['C', ' N ', 173.181, 98.618, 108.373], ['C', ' CA ', 173.615, 99.722, 107.557], ['C', ' C ', 173.826, 99.263, 106.142], ['C', ' O ', 173.363, 99.92, 105.215], ['C', ' CB ', 174.897, 100.348, 108.098], ['C', ' CG1', 174.583, 101.008, 109.447], ['C', ' CG2', 175.46, 101.358, 107.069], ['C', ' CD1', 175.797, 101.403, 110.245], ['C', ' H ', 173.761, 98.242, 109.13], ['C', ' HA ', 172.837, 100.484, 107.559], ['C', ' HB ', 175.632, 99.564, 108.281], ['C', ' HG1', 173.98, 101.895, 109.267], ['C', ' HG1', 173.997, 100.311, 110.047], ['C', ' HG2', 176.367, 101.809, 107.443], ['C', ' HG2', 175.691, 100.868, 106.126], ['C', ' HG2', 174.716, 102.134, 106.891], ['C', ' HD1', 175.485, 101.857, 111.182], ['C', ' HD1', 176.394, 100.519, 110.461], ['C', ' HD1', 176.397, 102.117, 109.695]]
[['C', ' N ', 174.506, 98.132, 105.969], ['C', ' CA ', 174.767, 97.644, 104.625], ['C', ' C ', 173.487, 97.214, 103.948], ['C', ' O ', 173.391, 97.199, 102.724], ['C', ' CB ', 175.718, 96.492, 104.614], ['C', ' CG ', 177.065, 96.772, 105.134], ['C', ' CD ', 177.669, 97.963, 104.597], ['C', ' NE ', 178.993, 98.066, 105.041], ['C', ' CZ ', 179.766, 99.144, 104.974], ['C', ' NH1', 179.353, 100.277, 104.444], ['C', ' NH2', 180.954, 99.018, 105.48], ['C', ' H ', 174.87, 97.639, 106.792], ['C', ' HA ', 175.185, 98.456, 104.038], ['C', ' HB ', 175.295, 95.668, 105.185], ['C', ' HB ', 175.842, 96.171, 103.602], ['C', ' HG ', 177.066, 96.825, 106.223], ['C', ' HG ', 177.696, 95.978, 104.802], ['C', ' HD ', 177.653, 97.962, 103.507], ['C', ' HD ', 177.144, 98.82, 104.993], ['C', ' HE ', 179.413, 97.236, 105.477], ['C', ' HH1', 178.403, 100.359, 104.053], ['C', ' HH1', 179.978, 101.074, 104.424], ['C', ' HH2', 181.179, 98.093, 105.879], ['C', ' HH2', 181.631, 99.808, 105.499]]
[['C', ' N ', 172.541, 96.764, 104.747], ['C', ' CA ', 171.222, 96.378, 104.312], ['C', ' C ', 170.379, 97.59, 103.857], ['C', ' O ', 169.538, 97.445, 102.965], ['C', ' CB ', 170.613, 95.497, 105.403], ['C', ' CG ', 171.264, 94.052, 105.409], ['C', ' CD ', 170.752, 93.101, 106.46], ['C', ' CE ', 171.434, 91.728, 106.301], ['C', ' NZ ', 170.919, 90.694, 107.259], ['C', ' H ', 172.743, 96.654, 105.743], ['C', ' HA ', 171.337, 95.749, 103.436], ['C', ' HB ', 170.82, 95.949, 106.352], ['C', ' HB ', 169.585, 95.46, 105.352], ['C', ' HG ', 171.046, 93.6, 104.482], ['C', ' HG ', 172.34, 94.118, 105.474], ['C', ' HD ', 171.026, 93.497, 107.433], ['C', ' HD ', 169.676, 93.001, 106.41], ['C', ' HE ', 171.297, 91.371, 105.286], ['C', ' HE ', 172.493, 91.86, 106.476], ['C', ' HZ ', 171.451, 89.81, 107.114], ['C', ' HZ ', 171.053, 91.007, 108.208], ['C', ' HZ ', 169.944, 90.517, 107.112]]
[['C', ' N ', 170.578, 98.778, 104.479], ['C', ' CA ', 169.9, 100.008, 104.03], ['C', ' C ', 170.597, 100.54, 102.789], ['C', ' O ', 169.997, 101.178, 101.929], ['C', ' CB ', 169.878, 101.065, 105.111], ['C', ' CG ', 168.995, 100.705, 106.264], ['C', ' SD ', 168.993, 101.887, 107.573], ['C', ' CE ', 168.047, 103.157, 106.814], ['C', ' H ', 171.209, 98.815, 105.281], ['C', ' HA ', 168.876, 99.763, 103.756], ['C', ' HB ', 170.892, 101.199, 105.5], ['C', ' HB ', 169.564, 102.0, 104.675], ['C', ' HG ', 167.979, 100.618, 105.902], ['C', ' HG ', 169.272, 99.742, 106.663], ['C', ' HE ', 167.878, 103.956, 107.483], ['C', ' HE ', 168.565, 103.539, 105.947], ['C', ' HE ', 167.11, 102.743, 106.53]]
[['C', ' N ', 171.881, 100.265, 102.694], ['C', ' CA ', 172.646, 100.593, 101.524], ['C', ' C ', 172.274, 99.441, 100.632], ['C', ' O ', 171.503, 98.595, 101.061], ['C', ' CB ', 174.146, 100.627, 101.805], ['C', ' CG ', 174.577, 101.702, 102.747], ['C', ' CD ', 176.055, 101.667, 103.075], ['C', ' OE1', 176.635, 100.626, 103.418], ['C', ' NE2', 176.677, 102.819, 102.96], ['C', ' H ', 172.346, 99.819, 103.488], ['C', ' HA ', 172.303, 101.523, 101.082], ['C', ' HB ', 174.45, 99.674, 102.213], ['C', ' HB ', 174.688, 100.767, 100.876], ['C', ' HG ', 174.391, 102.638, 102.262], ['C', ' HG ', 174.009, 101.654, 103.663], ['C', ' HE2', 177.655, 102.912, 103.143], ['C', ' HE2', 176.152, 103.644, 102.666]]
[['C', ' N ', 172.732, 99.407, 99.396], ['C', ' CA ', 172.413, 98.324, 98.446], ['C', ' C ', 170.943, 98.435, 97.994], ['C', ' O ', 170.694, 98.68, 96.816], ['C', ' CB ', 172.68, 96.911, 99.033], ['C', ' OG1', 174.031, 96.828, 99.491], ['C', ' CG2', 172.539, 95.881, 97.897], ['C', ' H ', 173.35, 100.14, 99.091], ['C', ' HA ', 173.044, 98.437, 97.563], ['C', ' HB ', 171.989, 96.656, 99.829], ['C', ' HG1', 174.088, 97.265, 100.359], ['C', ' HG2', 172.749, 94.885, 98.278], ['C', ' HG2', 171.545, 95.908, 97.492], ['C', ' HG2', 173.246, 96.119, 97.106]]
[['C', ' N ', 169.998, 98.36, 98.935], ['C', ' CA ', 168.567, 98.515, 98.707], ['C', ' C ', 167.937, 99.63, 99.532], ['C', ' O ', 167.128, 99.358, 100.426], ['C', ' CB ', 167.826, 97.257, 99.076], ['C', ' CG ', 168.159, 96.143, 98.294], ['C', ' CD1', 169.091, 95.264, 98.722], ['C', ' CD2', 167.509, 95.972, 97.118], ['C', ' CE1', 169.387, 94.208, 97.95], ['C', ' CE2', 167.792, 94.919, 96.357], ['C', ' CZ ', 168.733, 94.038, 96.762], ['C', ' OH ', 169.031, 92.987, 95.986], ['C', ' H ', 170.319, 98.144, 99.873], ['C', ' HA ', 168.402, 98.708, 97.652], ['C', ' HB ', 168.023, 97.013, 100.123], ['C', ' HB ', 166.774, 97.428, 98.98], ['C', ' HD1', 169.603, 95.418, 99.674], ['C', ' HD2', 166.758, 96.693, 96.795], ['C', ' HE1', 170.143, 93.507, 98.266], ['C', ' HE2', 167.273, 94.781, 95.411], ['C', ' HH ', 168.471, 93.019, 95.185]]
[['C', ' N ', 168.196, 100.898, 99.212], ['C', ' CA ', 167.748, 102.054, 99.947], ['C', ' C ', 166.291, 102.432, 99.726], ['C', ' O ', 165.98, 103.571, 99.346], ['C', ' CB ', 168.694, 103.121, 99.394], ['C', ' CG ', 168.969, 102.702, 98.001], ['C', ' CD ', 169.079, 101.223, 98.087], ['C', ' HA ', 167.924, 101.886, 101.018], ['C', ' HB ', 168.25, 104.12, 99.44], ['C', ' HB ', 169.594, 103.144, 100.004], ['C', ' HG ', 168.167, 103.035, 97.334], ['C', ' HG ', 169.895, 103.181, 97.642], ['C', ' HD ', 168.778, 100.772, 97.146], ['C', ' HD ', 170.111, 100.993, 98.347]]
[['C', ' N ', 165.385, 101.526, 100.065], ['C', ' CA ', 163.984, 101.827, 99.859], ['C', ' C ', 163.547, 102.719, 100.976], ['C', ' O ', 163.641, 102.344, 102.143], ['C', ' CB ', 163.078, 100.596, 99.982], ['C', ' CG ', 163.176, 99.548, 98.989], ['C', ' CD1', 163.961, 98.453, 99.222], ['C', ' CD2', 162.459, 99.611, 97.823], ['C', ' CE1', 164.032, 97.451, 98.304], ['C', ' CE2', 162.553, 98.596, 96.899], ['C', ' CZ ', 163.339, 97.523, 97.15], ['C', ' H ', 165.706, 100.623, 100.408], ['C', ' HA ', 163.846, 102.329, 98.903], ['C', ' HB ', 163.21, 100.143, 100.962], ['C', ' HB ', 162.059, 100.951, 99.933], ['C', ' HD1', 164.532, 98.378, 100.157], ['C', ' HD2', 161.812, 100.48, 97.625], ['C', ' HE1', 164.642, 96.598, 98.489], ['C', ' HE2', 162.004, 98.643, 95.97], ['C', ' HZ ', 163.41, 96.722, 96.425]]
[['C', ' N ', 163.118, 103.912, 100.62], ['C', ' CA ', 162.655, 104.892, 101.585], ['C', ' C ', 163.73, 105.509, 102.487], ['C', ' O ', 163.4, 105.958, 103.579], ['C', ' H ', 163.066, 104.1, 99.635], ['C', ' HA ', 162.135, 105.691, 101.051], ['C', ' HA ', 161.908, 104.421, 102.213]]
[['C', ' N ', 165.002, 105.55, 102.085], ['C', ' CA ', 165.99, 106.103, 103.027], ['C', ' C ', 166.666, 107.351, 102.478], ['C', ' O ', 167.763, 107.707, 102.91], ['C', ' CB ', 167.048, 105.055, 103.37], ['C', ' CG1', 166.343, 103.864, 103.992], ['C', ' CG2', 167.823, 104.69, 102.197], ['C', ' H ', 165.289, 105.177, 101.173], ['C', ' HA ', 165.484, 106.379, 103.952], ['C', ' HB ', 167.722, 105.456, 104.124], ['C', ' HG1', 167.065, 103.11, 104.249], ['C', ' HG1', 165.799, 104.187, 104.874], ['C', ' HG1', 165.646, 103.434, 103.279], ['C', ' HG2', 168.563, 103.936, 102.467], ['C', ' HG2', 167.147, 104.301, 101.49], ['C', ' HG2', 168.338, 105.55, 101.772]]
[['C', ' N ', 166.049, 107.963, 101.485], ['C', ' CA ', 166.586, 109.147, 100.829], ['C', ' C ', 168.033, 108.953, 100.417], ['C', ' O ', 168.335, 108.042, 99.66], ['C', ' CB ', 166.441, 110.356, 101.722], ['C', ' CG ', 165.009, 110.73, 102.069], ['C', ' CD ', 164.269, 111.233, 100.921], ['C', ' NE ', 164.884, 112.454, 100.41], ['C', ' CZ ', 164.78, 112.891, 99.158], ['C', ' NH1', 164.106, 112.224, 98.277], ['C', ' NH2', 165.352, 114.003, 98.77], ['C', ' H ', 165.139, 107.602, 101.234], ['C', ' HA ', 166.024, 109.32, 99.917], ['C', ' HB ', 166.962, 110.184, 102.664], ['C', ' HB ', 166.893, 111.223, 101.242], ['C', ' HG ', 164.481, 109.872, 102.491], ['C', ' HG ', 165.027, 111.518, 102.776], ['C', ' HD ', 164.209, 110.496, 100.135], ['C', ' HD ', 163.256, 111.478, 101.252], ['C', ' HE ', 165.423, 113.026, 101.052], ['C', ' HH1', 163.63, 111.374, 98.514], ['C', ' HH1', 164.064, 112.607, 97.323], ['C', ' HH2', 165.912, 114.598, 99.423], ['C', ' HH2', 165.212, 114.265, 97.788]]
[['C', ' N ', 168.932, 109.799, 100.905], ['C', ' CA ', 170.326, 109.718, 100.504], ['C', ' C ', 171.22, 109.159, 101.59], ['C', ' O ', 172.44, 109.204, 101.461], ['C', ' CB ', 170.84, 111.097, 100.125], ['C', ' CG ', 170.102, 111.724, 98.992], ['C', ' CD1', 169.271, 112.81, 99.21], ['C', ' CD2', 170.228, 111.237, 97.706], ['C', ' CE1', 168.6, 113.396, 98.167], ['C', ' CE2', 169.552, 111.822, 96.66], ['C', ' CZ ', 168.739, 112.904, 96.889], ['C', ' H ', 168.654, 110.52, 101.548], ['C', ' HA ', 170.401, 109.06, 99.634], ['C', ' HB ', 170.777, 111.76, 100.986], ['C', ' HB ', 171.891, 111.023, 99.843], ['C', ' HD1', 169.156, 113.215, 100.218], ['C', ' HD2', 170.881, 110.375, 97.519], ['C', ' HE1', 167.964, 114.259, 98.36], ['C', ' HE2', 169.666, 111.431, 95.645], ['C', ' HZ ', 168.208, 113.37, 96.054]]
[['C', ' N ', 170.627, 108.563, 102.623], ['C', ' CA ', 171.35, 108.061, 103.798], ['C', ' C ', 172.205, 106.85, 103.528], ['C', ' O ', 172.953, 106.419, 104.398], ['C', ' CB ', 170.359, 107.678, 104.894], ['C', ' CG ', 169.55, 108.803, 105.531], ['C', ' CD1', 168.466, 108.192, 106.45], ['C', ' CD2', 170.496, 109.71, 106.328], ['C', ' H ', 169.604, 108.472, 102.618], ['C', ' HA ', 172.02, 108.845, 104.14], ['C', ' HB ', 169.659, 106.957, 104.48], ['C', ' HB ', 170.92, 107.195, 105.679], ['C', ' HG ', 169.046, 109.382, 104.757], ['C', ' HD1', 167.883, 108.972, 106.899], ['C', ' HD1', 167.807, 107.552, 105.855], ['C', ' HD1', 168.914, 107.62, 107.223], ['C', ' HD2', 169.936, 110.501, 106.787], ['C', ' HD2', 171.002, 109.133, 107.105], ['C', ' HD2', 171.234, 110.15, 105.679]]
[['C', ' N ', 172.031, 106.236, 102.365], ['C', ' CA ', 172.882, 105.135, 101.968], ['C', ' C ', 174.29, 105.691, 101.77], ['C', ' O ', 175.301, 105.025, 101.985], ['C', ' CB ', 172.365, 104.492, 100.702], ['C', ' H ', 171.346, 106.603, 101.72], ['C', ' HA ', 172.907, 104.404, 102.774], ['C', ' HB ', 173.017, 103.678, 100.409], ['C', ' HB ', 171.372, 104.118, 100.889], ['C', ' HB ', 172.332, 105.236, 99.898]]
[['C', ' N ', 174.369, 106.927, 101.305], ['C', ' CA ', 175.637, 107.578, 101.112], ['C', ' C ', 175.91, 108.34, 102.376], ['C', ' O ', 175.12, 108.328, 103.312], ['C', ' CB ', 175.63, 108.535, 99.909], ['C', ' CG ', 177.077, 109.017, 99.457], ['C', ' OD1', 178.077, 108.479, 99.966], ['C', ' OD2', 177.163, 109.948, 98.687], ['C', ' H ', 173.538, 107.494, 101.131], ['C', ' HA ', 176.417, 106.833, 100.973], ['C', ' HB ', 175.145, 108.041, 99.064], ['C', ' HB ', 175.024, 109.409, 100.155]]
[['C', ' N ', 177.024, 109.01, 102.392], ['C', ' CA ', 177.465, 109.842, 103.477], ['C', ' C ', 177.854, 109.008, 104.676], ['C', ' O ', 177.918, 109.512, 105.784], ['C', ' CB ', 176.359, 110.842, 103.904], ['C', ' CG ', 175.607, 111.58, 102.741], ['C', ' CD ', 176.56, 112.241, 101.753], ['C', ' CE ', 175.838, 112.991, 100.656], ['C', ' NZ ', 176.777, 113.34, 99.53], ['C', ' H ', 177.624, 108.893, 101.581], ['C', ' HA ', 178.345, 110.396, 103.158], ['C', ' HB ', 175.62, 110.342, 104.524], ['C', ' HB ', 176.798, 111.606, 104.529], ['C', ' HG ', 174.942, 110.9, 102.217], ['C', ' HG ', 174.994, 112.359, 103.186], ['C', ' HD ', 177.182, 112.943, 102.277], ['C', ' HD ', 177.199, 111.501, 101.284], ['C', ' HE ', 175.023, 112.379, 100.266], ['C', ' HE ', 175.428, 113.912, 101.07], ['C', ' HZ ', 176.284, 113.843, 98.81], ['C', ' HZ ', 177.551, 113.905, 99.87], ['C', ' HZ ', 177.146, 112.461, 99.141]]
[['C', ' N ', 178.112, 107.723, 104.469], ['C', ' CA ', 178.648, 106.875, 105.505], ['C', ' C ', 179.97, 106.482, 104.925], ['C', ' O ', 180.014, 105.801, 103.904], ['C', ' CB ', 177.773, 105.649, 105.787], ['C', ' CG1', 176.36, 106.134, 106.19], ['C', ' CG2', 178.441, 104.795, 106.913], ['C', ' CD1', 175.316, 105.052, 106.288], ['C', ' H ', 177.981, 107.334, 103.546], ['C', ' HA ', 178.807, 107.436, 106.424], ['C', ' HB ', 177.669, 105.055, 104.88], ['C', ' HG1', 176.425, 106.652, 107.145], ['C', ' HG1', 176.005, 106.844, 105.436], ['C', ' HG2', 177.844, 103.918, 107.128], ['C', ' HG2', 179.434, 104.47, 106.59], ['C', ' HG2', 178.54, 105.4, 107.821], ['C', ' HD1', 174.358, 105.504, 106.555], ['C', ' HD1', 175.216, 104.551, 105.319], ['C', ' HD1', 175.592, 104.337, 107.043]]
[['C', ' N ', 181.044, 106.952, 105.511], ['C', ' CA ', 182.325, 106.706, 104.886], ['C', ' C ', 183.15, 105.709, 105.669], ['C', ' O ', 184.023, 105.059, 105.105], ['C', ' CB ', 183.079, 108.012, 104.668], ['C', ' CG ', 182.323, 109.08, 103.81], ['C', ' CD ', 181.948, 108.629, 102.363], ['C', ' CE ', 181.396, 109.845, 101.547], ['C', ' NZ ', 180.859, 109.49, 100.129], ['C', ' H ', 180.944, 107.463, 106.388], ['C', ' HA ', 182.161, 106.259, 103.909], ['C', ' HB ', 183.287, 108.462, 105.622], ['C', ' HB ', 184.035, 107.807, 104.189], ['C', ' HG ', 181.401, 109.333, 104.326], ['C', ' HG ', 182.935, 109.981, 103.753], ['C', ' HD ', 182.823, 108.217, 101.86], ['C', ' HD ', 181.173, 107.862, 102.403], ['C', ' HE ', 180.6, 110.328, 102.115], ['C', ' HE ', 182.218, 110.55, 101.431], ['C', ' HZ ', 180.558, 110.34, 99.677], ['C', ' HZ ', 181.588, 109.065, 99.581], ['C', ' HZ ', 180.03, 108.855, 100.137]]
[['C', ' N ', 182.921, 105.615, 106.977], ['C', ' CA ', 183.71, 104.653, 107.73], ['C', ' C ', 182.923, 103.928, 108.776], ['C', ' O ', 182.584, 104.484, 109.831], ['C', ' CB ', 184.883, 105.352, 108.413], ['C', ' CG ', 185.78, 104.497, 109.299], ['C', ' CD1', 186.452, 103.387, 108.47], ['C', ' CD2', 186.812, 105.421, 109.971], ['C', ' H ', 182.204, 106.189, 107.417], ['C', ' HA ', 184.087, 103.911, 107.029], ['C', ' HB ', 185.505, 105.817, 107.647], ['C', ' HB ', 184.477, 106.13, 109.053], ['C', ' HG ', 185.192, 104.018, 110.056], ['C', ' HD1', 187.09, 102.794, 109.12], ['C', ' HD1', 185.711, 102.737, 108.026], ['C', ' HD1', 187.051, 103.832, 107.679], ['C', ' HD2', 187.463, 104.837, 110.625], ['C', ' HD2', 187.406, 105.911, 109.205], ['C', ' HD2', 186.293, 106.177, 110.562]]
[['C', ' N ', 182.72, 102.64, 108.535], ['C', ' CA ', 181.972, 101.844, 109.469], ['C', ' C ', 182.985, 100.983, 110.213], ['C', ' O ', 183.604, 100.066, 109.642], ['C', ' CB ', 180.96, 100.973, 108.718], ['C', ' CG ', 179.754, 100.398, 109.506], ['C', ' CD1', 178.82, 99.747, 108.493], ['C', ' CD2', 180.191, 99.429, 110.585], ['C', ' H ', 183.023, 102.213, 107.646], ['C', ' HA ', 181.461, 102.485, 110.183], ['C', ' HB ', 180.564, 101.565, 107.894], ['C', ' HB ', 181.498, 100.132, 108.28], ['C', ' HG ', 179.199, 101.205, 109.966], ['C', ' HD1', 177.942, 99.353, 108.996], ['C', ' HD1', 178.51, 100.481, 107.752], ['C', ' HD1', 179.339, 98.933, 107.996], ['C', ' HD2', 179.324, 99.043, 111.077], ['C', ' HD2', 180.738, 98.619, 110.157], ['C', ' HD2', 180.805, 99.915, 111.32]]
[['C', ' N ', 183.161, 101.299, 111.48], ['C', ' CA ', 184.071, 100.602, 112.342], ['C', ' C ', 183.174, 99.673, 113.117], ['C', ' O ', 182.262, 100.127, 113.8], ['C', ' CB ', 184.761, 101.558, 113.338], ['C', ' CG1', 185.72, 100.772, 114.207], ['C', ' CG2', 185.438, 102.692, 112.606], ['C', ' H ', 182.638, 102.06, 111.871], ['C', ' HA ', 184.789, 100.056, 111.762], ['C', ' HB ', 184.014, 101.983, 114.002], ['C', ' HG1', 186.182, 101.444, 114.916], ['C', ' HG1', 185.182, 99.989, 114.745], ['C', ' HG1', 186.492, 100.318, 113.598], ['C', ' HG2', 185.907, 103.367, 113.323], ['C', ' HG2', 186.192, 102.303, 111.932], ['C', ' HG2', 184.685, 103.231, 112.045]]
[['C', ' N ', 183.381, 98.379, 112.959], ['C', ' CA ', 182.526, 97.405, 113.603], ['C', ' C ', 183.09, 96.957, 114.941], ['C', ' O ', 184.307, 96.963, 115.136], ['C', ' H ', 184.163, 98.102, 112.381], ['C', ' HA ', 181.546, 97.838, 113.727], ['C', ' HA ', 182.404, 96.55, 112.949]]
[['C', ' N ', 182.228, 96.503, 115.835], ['C', ' CA ', 182.669, 95.973, 117.13], ['C', ' C ', 182.222, 94.534, 117.327], ['C', ' O ', 181.049, 94.235, 117.214], ['C', ' CB ', 182.18, 96.868, 118.279], ['C', ' CG1', 182.784, 98.273, 118.075], ['C', ' CG2', 182.571, 96.266, 119.638], ['C', ' CD1', 182.303, 99.34, 119.016], ['C', ' H ', 181.231, 96.597, 115.608], ['C', ' HA ', 183.757, 95.977, 117.155], ['C', ' HB ', 181.097, 96.965, 118.225], ['C', ' HG1', 183.862, 98.187, 118.143], ['C', ' HG1', 182.528, 98.619, 117.077], ['C', ' HG2', 182.22, 96.896, 120.446], ['C', ' HG2', 182.118, 95.277, 119.756], ['C', ' HG2', 183.658, 96.172, 119.697], ['C', ' HD1', 182.79, 100.275, 118.758], ['C', ' HD1', 181.22, 99.452, 118.918], ['C', ' HD1', 182.548, 99.091, 120.041]]
[['C', ' N ', 183.125, 93.639, 117.69], ['C', ' CA ', 182.753, 92.222, 117.819], ['C', ' C ', 181.637, 92.008, 118.843], ['C', ' O ', 181.645, 92.593, 119.931], ['C', ' CB ', 183.945, 91.379, 118.243], ['C', ' CG ', 185.129, 91.344, 117.286], ['C', ' CD1', 185.08, 91.899, 116.021], ['C', ' CD2', 186.295, 90.78, 117.723], ['C', ' CE1', 186.195, 91.891, 115.25], ['C', ' CE2', 187.398, 90.788, 116.941], ['C', ' CZ ', 187.344, 91.343, 115.718], ['C', ' OH ', 188.44, 91.385, 114.948], ['C', ' H ', 184.099, 93.935, 117.802], ['C', ' HA ', 182.377, 91.874, 116.86], ['C', ' HB ', 184.302, 91.722, 119.211], ['C', ' HB ', 183.593, 90.379, 118.37], ['C', ' HD1', 184.18, 92.359, 115.635], ['C', ' HD2', 186.344, 90.344, 118.721], ['C', ' HE1', 186.177, 92.338, 114.269], ['C', ' HE2', 188.329, 90.355, 117.308], ['C', ' HH ', 189.203, 91.133, 115.467]]
[['C', ' N ', 180.675, 91.152, 118.489], ['C', ' CA ', 179.515, 90.886, 119.346], ['C', ' C ', 179.354, 89.483, 119.798], ['C', ' O ', 179.074, 88.602, 118.997], ['C', ' CB ', 178.224, 91.158, 118.596], ['C', ' SG ', 176.647, 90.884, 119.513], ['C', ' H ', 180.782, 90.677, 117.584], ['C', ' HA ', 179.582, 91.533, 120.218], ['C', ' HB ', 178.251, 92.131, 118.259], ['C', ' HB ', 178.2, 90.514, 117.729], ['C', ' HG ', 175.831, 91.176, 118.493]]
[['C', ' N ', 179.449, 89.265, 121.084], ['C', ' CA ', 179.184, 87.919, 121.523], ['C', ' C ', 177.692, 87.795, 121.719], ['C', ' O ', 177.055, 86.864, 121.215], ['C', ' CB ', 179.902, 87.575, 122.818], ['C', ' CG ', 179.712, 86.125, 123.21], ['C', ' SD ', 180.36, 84.982, 121.966], ['C', ' CE ', 182.096, 84.986, 122.307], ['C', ' H ', 179.691, 90.028, 121.7], ['C', ' HA ', 179.481, 87.218, 120.748], ['C', ' HB ', 180.955, 87.799, 122.753], ['C', ' HB ', 179.49, 88.178, 123.628], ['C', ' HG ', 180.216, 85.934, 124.156], ['C', ' HG ', 178.646, 85.914, 123.35], ['C', ' HE ', 182.587, 84.335, 121.599], ['C', ' HE ', 182.494, 85.985, 122.218], ['C', ' HE ', 182.272, 84.621, 123.32]]
[['C', ' N ', 177.14, 88.773, 122.44], ['C', ' CA ', 175.732, 88.84, 122.781], ['C', ' C ', 175.454, 90.09, 123.609], ['C', ' O ', 176.199, 90.372, 124.545], ['C', ' CB ', 175.342, 87.577, 123.56], ['C', ' CG ', 176.096, 87.371, 124.901], ['C', ' CD ', 175.835, 86.009, 125.515], ['C', ' OE1', 175.195, 85.236, 124.86], ['C', ' OE2', 176.342, 85.716, 126.586], ['C', ' H ', 177.737, 89.508, 122.78], ['C', ' HA ', 175.148, 88.896, 121.86], ['C', ' HB ', 174.298, 87.641, 123.799], ['C', ' HB ', 175.46, 86.689, 122.958], ['C', ' HG ', 177.164, 87.504, 124.754], ['C', ' HG ', 175.758, 88.126, 125.596]]
[['C', ' N ', 174.389, 90.835, 123.301], ['C', ' CA ', 174.016, 91.949, 124.18], ['C', ' C ', 172.936, 91.559, 125.145], ['C', ' O ', 172.074, 90.719, 124.848], ['C', ' CB ', 173.584, 93.197, 123.463], ['C', ' CG ', 174.626, 93.985, 122.924], ['C', ' OD1', 175.762, 93.959, 123.409], ['C', ' ND2', 174.284, 94.759, 121.943], ['C', ' H ', 173.821, 90.597, 122.501], ['C', ' HA ', 174.882, 92.215, 124.791], ['C', ' HB ', 172.966, 92.908, 122.638], ['C', ' HB ', 172.993, 93.822, 124.135], ['C', ' HD2', 174.957, 95.378, 121.544], ['C', ' HD2', 173.34, 94.756, 121.604]]
[['C', ' N ', 172.938, 92.235, 126.279], ['C', ' CA ', 171.984, 91.99, 127.325], ['C', ' C ', 171.047, 93.159, 127.46], ['C', ' O ', 171.508, 94.285, 127.514], ['C', ' CB ', 172.749, 91.83, 128.613], ['C', ' CG ', 173.583, 90.673, 128.583], ['C', ' CD1', 174.896, 90.774, 128.205], ['C', ' CD2', 173.07, 89.461, 128.892], ['C', ' CE1', 175.673, 89.666, 128.15], ['C', ' CE2', 173.835, 88.349, 128.834], ['C', ' CZ ', 175.14, 88.452, 128.463], ['C', ' H ', 173.671, 92.94, 126.436], ['C', ' HA ', 171.466, 91.069, 127.107], ['C', ' HB ', 173.385, 92.701, 128.748], ['C', ' HB ', 172.094, 91.767, 129.453], ['C', ' HD1', 175.311, 91.755, 127.94], ['C', ' HD2', 172.032, 89.391, 129.182], ['C', ' HE1', 176.717, 89.744, 127.842], ['C', ' HE2', 173.413, 87.368, 129.075], ['C', ' HZ ', 175.762, 87.553, 128.403]]
[['C', ' N ', 169.748, 92.984, 127.517], ['C', ' CA ', 168.84, 94.061, 127.735], ['C', ' C ', 169.22, 94.718, 129.029], ['C', ' O ', 169.597, 94.02, 129.981], ['C', ' CB ', 167.494, 93.358, 127.812], ['C', ' CG ', 167.695, 92.092, 127.032], ['C', ' CD ', 169.123, 91.693, 127.295], ['C', ' HA ', 168.871, 94.775, 126.902], ['C', ' HB ', 167.22, 93.185, 128.87], ['C', ' HB ', 166.71, 94.001, 127.381], ['C', ' HG ', 166.976, 91.324, 127.357], ['C', ' HG ', 167.496, 92.283, 125.965], ['C', ' HD ', 169.203, 91.051, 128.179], ['C', ' HD ', 169.494, 91.21, 126.391]]
[['C', ' N ', 169.101, 96.023, 129.097], ['C', ' CA ', 169.377, 96.69, 130.341], ['C', ' C ', 168.287, 96.063, 131.176], ['C', ' O ', 167.186, 95.886, 130.663], ['C', ' CB ', 169.26, 98.194, 130.209], ['C', ' CG ', 169.781, 98.945, 131.369], ['C', ' CD1', 171.141, 99.16, 131.462], ['C', ' CD2', 168.942, 99.429, 132.325], ['C', ' CE1', 171.651, 99.869, 132.501], ['C', ' CE2', 169.456, 100.136, 133.368], ['C', ' CZ ', 170.806, 100.364, 133.455], ['C', ' OH ', 171.313, 101.088, 134.502], ['C', ' H ', 168.81, 96.561, 128.288], ['C', ' HA ', 170.355, 96.406, 130.731], ['C', ' HB ', 169.8, 98.523, 129.32], ['C', ' HB ', 168.215, 98.465, 130.072], ['C', ' HD1', 171.809, 98.772, 130.698], ['C', ' HD2', 167.867, 99.258, 132.255], ['C', ' HE1', 172.722, 100.048, 132.57], ['C', ' HE2', 168.789, 100.535, 134.13], ['C', ' HH ', 172.117, 101.573, 134.208]]
[['C', ' N ', 168.572, 95.732, 132.426], ['C', ' CA ', 167.719, 94.923, 133.323], ['C', ' C ', 168.403, 93.567, 133.474], ['C', ' O ', 168.519, 93.064, 134.598], ['C', ' CB ', 166.276, 94.625, 132.822], ['C', ' OG1', 165.568, 95.828, 132.594], ['C', ' CG2', 165.527, 93.828, 133.881], ['C', ' H ', 169.472, 96.013, 132.768], ['C', ' HA ', 167.658, 95.399, 134.298], ['C', ' HB ', 166.303, 94.03, 131.905], ['C', ' HG1', 165.946, 96.2, 131.785], ['C', ' HG2', 164.518, 93.628, 133.526], ['C', ' HG2', 166.025, 92.882, 134.076], ['C', ' HG2', 165.481, 94.408, 134.801]]
[['C', ' N ', 168.839, 92.937, 132.376], ['C', ' CA ', 169.591, 91.702, 132.534], ['C', ' C ', 170.923, 92.062, 133.126], ['C', ' O ', 171.393, 91.414, 134.063], ['C', ' CB ', 169.829, 90.976, 131.23], ['C', ' OG ', 168.675, 90.374, 130.7], ['C', ' H ', 168.736, 93.339, 131.445], ['C', ' HA ', 169.062, 91.04, 133.22], ['C', ' HB ', 170.189, 91.687, 130.517], ['C', ' HB ', 170.605, 90.276, 131.373], ['C', ' HG ', 168.994, 89.788, 129.949]]
[['C', ' N ', 171.496, 93.169, 132.653], ['C', ' CA ', 172.783, 93.549, 133.213], ['C', ' C ', 172.612, 93.901, 134.665], ['C', ' O ', 173.391, 93.487, 135.511], ['C', ' CB ', 173.38, 94.787, 132.538], ['C', ' CG ', 173.857, 94.694, 131.114], ['C', ' CD1', 174.268, 96.079, 130.688], ['C', ' CD2', 175.028, 93.726, 130.993], ['C', ' H ', 171.048, 93.648, 131.866], ['C', ' HA ', 173.464, 92.705, 133.15], ['C', ' HB ', 172.634, 95.576, 132.571], ['C', ' HB ', 174.214, 95.115, 133.117], ['C', ' HG ', 173.04, 94.364, 130.466], ['C', ' HD1', 174.612, 96.047, 129.66], ['C', ' HD1', 173.42, 96.756, 130.77], ['C', ' HD1', 175.079, 96.433, 131.327], ['C', ' HD2', 175.363, 93.689, 129.958], ['C', ' HD2', 175.846, 94.055, 131.628], ['C', ' HD2', 174.719, 92.748, 131.289]]
[['C', ' N ', 171.53, 94.583, 134.994], ['C', ' CA ', 171.346, 94.968, 136.374], ['C', ' C ', 171.162, 93.741, 137.227], ['C', ' O ', 171.749, 93.634, 138.295], ['C', ' CB ', 170.133, 95.864, 136.536], ['C', ' CG ', 170.274, 97.224, 135.959], ['C', ' CD ', 168.992, 97.97, 136.039], ['C', ' OE1', 167.95, 97.418, 135.7], ['C', ' NE2', 169.035, 99.201, 136.506], ['C', ' H ', 170.877, 94.852, 134.284], ['C', ' HA ', 172.234, 95.496, 136.718], ['C', ' HB ', 169.269, 95.382, 136.088], ['C', ' HB ', 169.921, 95.982, 137.599], ['C', ' HG ', 171.002, 97.757, 136.539], ['C', ' HG ', 170.59, 97.166, 134.92], ['C', ' HE2', 168.193, 99.74, 136.588], ['C', ' HE2', 169.908, 99.607, 136.778]]
[['C', ' N ', 170.442, 92.748, 136.733], ['C', ' CA ', 170.244, 91.559, 137.529], ['C', ' C ', 171.566, 90.891, 137.849], ['C', ' O ', 171.865, 90.605, 139.018], ['C', ' CB ', 169.364, 90.537, 136.783], ['C', ' OG1', 168.068, 91.106, 136.53], ['C', ' CG2', 169.206, 89.272, 137.634], ['C', ' H ', 169.945, 92.849, 135.85], ['C', ' HA ', 169.757, 91.838, 138.463], ['C', ' HB ', 169.827, 90.278, 135.83], ['C', ' HG1', 168.155, 91.826, 135.864], ['C', ' HG2', 168.579, 88.566, 137.109], ['C', ' HG2', 170.173, 88.812, 137.827], ['C', ' HG2', 168.736, 89.534, 138.587]]
[['C', ' N ', 172.428, 90.726, 136.859], ['C', ' CA ', 173.629, 90.023, 137.227], ['C', ' C ', 174.759, 90.914, 137.72], ['C', ' O ', 175.727, 90.426, 138.292], ['C', ' CB ', 174.049, 89.017, 136.172], ['C', ' CG ', 174.268, 89.464, 134.793], ['C', ' CD1', 175.413, 90.132, 134.432], ['C', ' CD2', 173.346, 89.132, 133.81], ['C', ' CE1', 175.621, 90.47, 133.135], ['C', ' CE2', 173.566, 89.475, 132.519], ['C', ' CZ ', 174.705, 90.141, 132.183], ['C', ' H ', 172.2, 91.005, 135.893], ['C', ' HA ', 173.37, 89.395, 138.066], ['C', ' HB ', 174.923, 88.543, 136.513], ['C', ' HB ', 173.287, 88.24, 136.133], ['C', ' HD1', 176.16, 90.383, 135.188], ['C', ' HD2', 172.438, 88.585, 134.079], ['C', ' HE1', 176.522, 90.995, 132.857], ['C', ' HE2', 172.845, 89.215, 131.756], ['C', ' HZ ', 174.888, 90.409, 131.15]]
[['C', ' N ', 174.628, 92.214, 137.62], ['C', ' CA ', 175.637, 93.052, 138.214], ['C', ' C ', 175.241, 93.401, 139.649], ['C', ' O ', 176.044, 93.227, 140.572], ['C', ' CB ', 175.87, 94.289, 137.361], ['C', ' CG1', 176.45, 93.812, 136.022], ['C', ' CG2', 176.755, 95.29, 138.065], ['C', ' CD1', 176.505, 94.845, 135.006], ['C', ' H ', 173.874, 92.638, 137.071], ['C', ' HA ', 176.573, 92.501, 138.249], ['C', ' HB ', 174.908, 94.758, 137.152], ['C', ' HG1', 177.444, 93.422, 136.182], ['C', ' HG1', 175.828, 93.008, 135.635], ['C', ' HG2', 176.899, 96.167, 137.456], ['C', ' HG2', 176.286, 95.596, 138.987], ['C', ' HG2', 177.714, 94.834, 138.28], ['C', ' HD1', 176.902, 94.439, 134.084], ['C', ' HD1', 175.513, 95.216, 134.842], ['C', ' HD1', 177.117, 95.618, 135.341]]
[['C', ' N ', 173.986, 93.797, 139.855], ['C', ' CA ', 173.523, 94.21, 141.161], ['C', ' C ', 173.058, 93.079, 142.081], ['C', ' O ', 173.09, 93.261, 143.297], ['C', ' CB ', 172.385, 95.189, 140.983], ['C', ' SG ', 172.891, 96.635, 140.065], ['C', ' H ', 173.338, 93.871, 139.08], ['C', ' HA ', 174.335, 94.725, 141.654], ['C', ' HB ', 171.546, 94.719, 140.481], ['C', ' HB ', 172.046, 95.514, 141.964], ['C', ' HG ', 174.171, 96.637, 140.533]]
[['C', ' N ', 172.624, 91.917, 141.557], ['C', ' CA ', 172.19, 90.863, 142.472], ['C', ' C ', 173.199, 89.724, 142.538], ['C', ' O ', 173.508, 89.239, 143.624], ['C', ' CB ', 170.815, 90.298, 142.084], ['C', ' CG ', 169.656, 91.299, 142.156], ['C', ' CD ', 168.307, 90.679, 141.792], ['C', ' OE1', 168.291, 89.535, 141.403], ['C', ' OE2', 167.307, 91.35, 141.913], ['C', ' H ', 172.558, 91.746, 140.553], ['C', ' HA ', 172.1, 91.282, 143.472], ['C', ' HB ', 170.848, 89.893, 141.083], ['C', ' HB ', 170.572, 89.472, 142.749], ['C', ' HG ', 169.604, 91.708, 143.164], ['C', ' HG ', 169.87, 92.12, 141.47]]
[['C', ' N ', 173.777, 89.333, 141.399], ['C', ' CA ', 174.742, 88.223, 141.446], ['C', ' C ', 176.072, 88.658, 142.06], ['C', ' O ', 176.702, 87.901, 142.796], ['C', ' CB ', 175.041, 87.654, 140.061], ['C', ' CG ', 173.917, 86.93, 139.325], ['C', ' CD ', 173.629, 85.569, 139.883], ['C', ' CE ', 172.628, 84.834, 138.996], ['C', ' NZ ', 172.356, 83.464, 139.49], ['C', ' H ', 173.456, 89.758, 140.527], ['C', ' HA ', 174.332, 87.435, 142.075], ['C', ' HB ', 175.414, 88.422, 139.431], ['C', ' HB ', 175.847, 86.935, 140.171], ['C', ' HG ', 173.004, 87.525, 139.397], ['C', ' HG ', 174.186, 86.827, 138.276], ['C', ' HD ', 174.553, 84.989, 139.938], ['C', ' HD ', 173.211, 85.658, 140.885], ['C', ' HE ', 171.693, 85.395, 138.968], ['C', ' HE ', 173.03, 84.768, 137.981], ['C', ' HZ ', 171.699, 83.008, 138.871], ['C', ' HZ ', 173.228, 82.953, 139.493], ['C', ' HZ ', 171.975, 83.5, 140.424]]
[['C', ' N ', 176.506, 89.876, 141.751], ['C', ' CA ', 177.763, 90.386, 142.281], ['C', ' C ', 177.547, 91.318, 143.465], ['C', ' O ', 178.451, 91.523, 144.274], ['C', ' CB ', 178.562, 91.065, 141.173], ['C', ' CG ', 178.923, 90.168, 139.985], ['C', ' CD1', 179.622, 90.997, 138.947], ['C', ' CD2', 179.813, 89.016, 140.435], ['C', ' H ', 175.966, 90.444, 141.11], ['C', ' HA ', 178.336, 89.552, 142.666], ['C', ' HB ', 178.001, 91.898, 140.794], ['C', ' HB ', 179.481, 91.44, 141.593], ['C', ' HG ', 178.009, 89.766, 139.539], ['C', ' HD1', 179.868, 90.379, 138.085], ['C', ' HD1', 178.956, 91.794, 138.642], ['C', ' HD1', 180.532, 91.417, 139.355], ['C', ' HD2', 180.046, 88.417, 139.595], ['C', ' HD2', 180.732, 89.398, 140.869], ['C', ' HD2', 179.31, 88.391, 141.159]]
[['C', ' N ', 176.346, 91.873, 143.584], ['C', ' CA ', 176.028, 92.789, 144.671], ['C', ' C ', 176.464, 94.244, 144.494], ['C', ' O ', 176.625, 94.957, 145.486], ['C', ' H ', 175.627, 91.644, 142.915], ['C', ' HA ', 174.951, 92.764, 144.834], ['C', ' HA ', 176.473, 92.402, 145.585]]
[['C', ' N ', 176.69, 94.706, 143.269], ['C', ' CA ', 177.128, 96.089, 143.126], ['C', ' C ', 176.181, 96.928, 142.278], ['C', ' O ', 175.821, 96.558, 141.168], ['C', ' CB ', 178.563, 96.134, 142.572], ['C', ' CG1', 178.661, 95.45, 141.235], ['C', ' CG2', 179.001, 97.556, 142.452], ['C', ' H ', 176.52, 94.117, 142.448], ['C', ' HA ', 177.159, 96.544, 144.114], ['C', ' HB ', 179.215, 95.604, 143.264], ['C', ' HG1', 179.685, 95.492, 140.891], ['C', ' HG1', 178.352, 94.41, 141.322], ['C', ' HG1', 178.038, 95.952, 140.521], ['C', ' HG2', 179.992, 97.614, 142.1], ['C', ' HG2', 178.37, 98.074, 141.755], ['C', ' HG2', 178.949, 98.033, 143.423]]
[['C', ' N ', 175.856, 98.108, 142.773], ['C', ' CA ', 174.974, 99.037, 142.081], ['C', ' C ', 175.598, 99.501, 140.762], ['C', ' O ', 176.813, 99.546, 140.611], ['C', ' CB ', 174.675, 100.21, 142.97], ['C', ' OG ', 174.047, 99.802, 144.148], ['C', ' H ', 176.194, 98.345, 143.695], ['C', ' HA ', 174.036, 98.532, 141.868], ['C', ' HB ', 175.574, 100.752, 143.194], ['C', ' HB ', 174.016, 100.873, 142.44], ['C', ' HG ', 173.854, 100.614, 144.635]]
[['C', ' N ', 174.776, 99.853, 139.78], ['C', ' CA ', 175.309, 100.217, 138.461], ['C', ' C ', 176.171, 101.471, 138.498], ['C', ' O ', 177.149, 101.591, 137.763], ['C', ' CB ', 174.162, 100.452, 137.487], ['C', ' CG ', 173.328, 99.221, 137.169], ['C', ' SD ', 174.213, 97.81, 136.466], ['C', ' CE ', 174.511, 98.334, 134.806], ['C', ' H ', 173.779, 99.854, 139.946], ['C', ' HA ', 175.932, 99.395, 138.105], ['C', ' HB ', 173.491, 101.206, 137.898], ['C', ' HB ', 174.552, 100.852, 136.551], ['C', ' HG ', 172.824, 98.892, 138.068], ['C', ' HG ', 172.565, 99.522, 136.45], ['C', ' HE ', 175.015, 97.543, 134.263], ['C', ' HE ', 173.564, 98.548, 134.321], ['C', ' HE ', 175.129, 99.221, 134.816]]
[['C', ' N ', 175.85, 102.398, 139.387], ['C', ' CA ', 176.58, 103.656, 139.476], ['C', ' C ', 177.958, 103.476, 140.074], ['C', ' O ', 178.764, 104.404, 140.088], ['C', ' CB ', 175.796, 104.698, 140.278], ['C', ' CG ', 175.64, 104.426, 141.757], ['C', ' CD ', 174.482, 103.553, 142.056], ['C', ' OE1', 173.976, 102.927, 141.14], ['C', ' OE2', 174.097, 103.476, 143.194], ['C', ' H ', 175.039, 102.269, 139.995], ['C', ' HA ', 176.709, 104.04, 138.467], ['C', ' HB ', 176.276, 105.669, 140.171], ['C', ' HB ', 174.798, 104.783, 139.867], ['C', ' HG ', 176.537, 103.978, 142.154], ['C', ' HG ', 175.502, 105.38, 142.262]]
[['C', ' N ', 178.221, 102.306, 140.631], ['C', ' CA ', 179.492, 102.038, 141.244], ['C', ' C ', 180.421, 101.338, 140.28], ['C', ' O ', 181.565, 101.051, 140.63], ['C', ' CB ', 179.278, 101.18, 142.479], ['C', ' CG ', 178.412, 101.793, 143.59], ['C', ' CD1', 178.204, 100.755, 144.671], ['C', ' CD2', 179.072, 103.04, 144.164], ['C', ' H ', 177.54, 101.546, 140.588], ['C', ' HA ', 179.959, 102.978, 141.513], ['C', ' HB ', 178.777, 100.291, 142.153], ['C', ' HB ', 180.245, 100.904, 142.897], ['C', ' HG ', 177.444, 102.062, 143.187], ['C', ' HD1', 177.575, 101.171, 145.457], ['C', ' HD1', 177.717, 99.887, 144.246], ['C', ' HD1', 179.165, 100.464, 145.09], ['C', ' HD2', 178.439, 103.449, 144.951], ['C', ' HD2', 180.047, 102.781, 144.58], ['C', ' HD2', 179.196, 103.794, 143.393]]
[['C', ' N ', 179.945, 101.047, 139.071], ['C', ' CA ', 180.786, 100.333, 138.137], ['C', ' C ', 181.481, 101.287, 137.196], ['C', ' O ', 180.848, 102.116, 136.541], ['C', ' CB ', 179.987, 99.31, 137.337], ['C', ' CG1', 180.941, 98.614, 136.349], ['C', ' CG2', 179.319, 98.352, 138.303], ['C', ' H ', 178.998, 101.325, 138.792], ['C', ' HA ', 181.548, 99.792, 138.697], ['C', ' HB ', 179.213, 99.805, 136.753], ['C', ' HG1', 180.419, 97.888, 135.787], ['C', ' HG1', 181.372, 99.328, 135.661], ['C', ' HG1', 181.745, 98.123, 136.898], ['C', ' HG2', 178.748, 97.619, 137.748], ['C', ' HG2', 180.061, 97.861, 138.898], ['C', ' HG2', 178.648, 98.901, 138.962]]
[['C', ' N ', 182.798, 101.157, 137.144], ['C', ' CA ', 183.67, 101.966, 136.32], ['C', ' C ', 183.817, 101.401, 134.917], ['C', ' O ', 183.719, 102.13, 133.928], ['C', ' CB ', 185.036, 101.996, 136.979], ['C', ' CG ', 185.072, 102.724, 138.299], ['C', ' CD ', 186.337, 102.492, 139.02], ['C', ' OE1', 186.857, 101.4, 138.905], ['C', ' OE2', 186.789, 103.368, 139.705], ['C', ' H ', 183.221, 100.428, 137.715], ['C', ' HA ', 183.258, 102.973, 136.256], ['C', ' HB ', 185.376, 100.974, 137.146], ['C', ' HB ', 185.751, 102.472, 136.309], ['C', ' HG ', 184.95, 103.791, 138.124], ['C', ' HG ', 184.239, 102.385, 138.92]]
[['C', ' N ', 184.063, 100.095, 134.851], ['C', ' CA ', 184.289, 99.39, 133.586], ['C', ' C ', 183.682, 98.005, 133.547], ['C', ' O ', 183.526, 97.346, 134.577], ['C', ' CB ', 185.775, 99.314, 133.231], ['C', ' CG ', 186.398, 100.653, 132.915], ['C', ' CD ', 187.826, 100.543, 132.427], ['C', ' CE ', 188.35, 101.935, 132.048], ['C', ' NZ ', 189.769, 101.926, 131.61], ['C', ' H ', 184.105, 99.592, 135.741], ['C', ' HA ', 183.814, 99.963, 132.796], ['C', ' HB ', 186.332, 98.885, 134.044], ['C', ' HB ', 185.907, 98.663, 132.379], ['C', ' HG ', 185.796, 101.165, 132.161], ['C', ' HG ', 186.405, 101.26, 133.815], ['C', ' HD ', 188.455, 100.11, 133.206], ['C', ' HD ', 187.864, 99.899, 131.544], ['C', ' HE ', 187.741, 102.323, 131.227], ['C', ' HE ', 188.251, 102.6, 132.905], ['C', ' HZ ', 190.035, 102.91, 131.361], ['C', ' HZ ', 190.361, 101.597, 132.349], ['C', ' HZ ', 189.887, 101.331, 130.797]]
[['C', ' N ', 183.386, 97.526, 132.341], ['C', ' CA ', 182.868, 96.173, 132.171], ['C', ' C ', 183.541, 95.417, 131.014], ['C', ' O ', 183.872, 96.0, 129.974], ['C', ' CB ', 181.37, 96.237, 131.932], ['C', ' CG ', 180.573, 96.767, 133.042], ['C', ' SD ', 178.848, 96.829, 132.634], ['C', ' CE ', 178.288, 97.727, 134.045], ['C', ' H ', 183.522, 98.107, 131.52], ['C', ' HA ', 183.062, 95.616, 133.082], ['C', ' HB ', 181.173, 96.908, 131.113], ['C', ' HB ', 180.991, 95.246, 131.666], ['C', ' HG ', 180.713, 96.139, 133.924], ['C', ' HG ', 180.897, 97.773, 133.279], ['C', ' HE ', 177.233, 97.898, 133.972], ['C', ' HE ', 178.511, 97.179, 134.938], ['C', ' HE ', 178.793, 98.661, 134.092]]
[['C', ' N ', 183.657, 94.102, 131.175], ['C', ' CA ', 184.224, 93.206, 130.153], ['C', ' C ', 183.525, 91.857, 130.152], ['C', ' O ', 182.871, 91.496, 131.123], ['C', ' CB ', 185.744, 93.052, 130.352], ['C', ' CG ', 186.516, 92.413, 129.169], ['C', ' OD1', 185.894, 91.953, 128.217], ['C', ' OD2', 187.711, 92.356, 129.248], ['C', ' H ', 183.349, 93.724, 132.077], ['C', ' HA ', 184.075, 93.646, 129.181], ['C', ' HB ', 186.172, 94.036, 130.543], ['C', ' HB ', 185.942, 92.457, 131.211]]
[['C', ' N ', 183.631, 91.142, 129.043], ['C', ' CA ', 183.057, 89.808, 128.884], ['C', ' C ', 184.078, 88.744, 128.488], ['C', ' O ', 183.726, 87.574, 128.317], ['C', ' CB ', 181.926, 89.821, 127.841], ['C', ' CG1', 182.478, 90.238, 126.449], ['C', ' CG2', 180.85, 90.756, 128.312], ['C', ' CD1', 181.514, 90.034, 125.289], ['C', ' H ', 184.215, 91.539, 128.31], ['C', ' HA ', 182.633, 89.505, 129.836], ['C', ' HB ', 181.515, 88.816, 127.746], ['C', ' HG1', 182.755, 91.288, 126.484], ['C', ' HG1', 183.365, 89.653, 126.229], ['C', ' HG2', 180.014, 90.775, 127.624], ['C', ' HG2', 180.528, 90.412, 129.247], ['C', ' HG2', 181.246, 91.754, 128.418], ['C', ' HD1', 181.998, 90.345, 124.362], ['C', ' HD1', 181.256, 88.978, 125.228], ['C', ' HD1', 180.611, 90.619, 125.43]]
[['C', ' N ', 185.322, 89.142, 128.257], ['C', ' CA ', 186.291, 88.172, 127.786], ['C', ' C ', 186.937, 87.342, 128.887], ['C', ' O ', 186.626, 87.46, 130.075], ['C', ' H ', 185.596, 90.126, 128.369], ['C', ' HA ', 185.809, 87.511, 127.068], ['C', ' HA ', 187.07, 88.706, 127.241]]
[['C', ' N ', 187.835, 86.449, 128.466], ['C', ' CA ', 188.575, 85.547, 129.351], ['C', ' C ', 187.675, 84.573, 130.103], ['C', ' O ', 188.075, 83.997, 131.114], ['C', ' CB ', 189.367, 86.356, 130.364], ['C', ' CG ', 190.281, 87.36, 129.757], ['C', ' CD ', 190.983, 88.13, 130.815], ['C', ' CE ', 191.83, 89.198, 130.211], ['C', ' NZ ', 192.459, 90.025, 131.229], ['C', ' H ', 188.029, 86.404, 127.474], ['C', ' HA ', 189.267, 84.961, 128.744], ['C', ' HB ', 188.707, 86.857, 131.051], ['C', ' HB ', 189.981, 85.678, 130.955], ['C', ' HG ', 191.014, 86.853, 129.131], ['C', ' HG ', 189.718, 88.055, 129.141], ['C', ' HD ', 190.247, 88.601, 131.466], ['C', ' HD ', 191.604, 87.464, 131.411], ['C', ' HE ', 192.605, 88.743, 129.599], ['C', ' HE ', 191.208, 89.834, 129.581], ['C', ' HZ ', 193.017, 90.741, 130.758], ['C', ' HZ ', 191.759, 90.477, 131.792], ['C', ' HZ ', 193.058, 89.475, 131.816]]
[['C', ' N ', 186.468, 84.364, 129.6], ['C', ' CA ', 185.543, 83.423, 130.203], ['C', ' C ', 184.763, 83.978, 131.398], ['C', ' O ', 184.138, 83.194, 132.129], ['C', ' H ', 186.194, 84.871, 128.771], ['C', ' HA ', 184.835, 83.095, 129.442], ['C', ' HA ', 186.093, 82.537, 130.515]]
[['C', ' N ', 184.816, 85.297, 131.632], ['C', ' CA ', 184.112, 85.903, 132.763], ['C', ' C ', 183.473, 87.238, 132.417], ['C', ' O ', 183.944, 87.96, 131.549], ['C', ' CB ', 185.066, 86.115, 133.938], ['C', ' CG ', 185.692, 84.857, 134.513], ['C', ' CD ', 186.629, 85.191, 135.661], ['C', ' CE ', 187.243, 83.952, 136.301], ['C', ' NZ ', 188.179, 83.23, 135.385], ['C', ' H ', 185.365, 85.906, 131.017], ['C', ' HA ', 183.313, 85.241, 133.08], ['C', ' HB ', 185.869, 86.75, 133.624], ['C', ' HB ', 184.537, 86.635, 134.736], ['C', ' HG ', 184.91, 84.184, 134.856], ['C', ' HG ', 186.263, 84.363, 133.734], ['C', ' HD ', 187.427, 85.836, 135.302], ['C', ' HD ', 186.087, 85.717, 136.422], ['C', ' HE ', 187.791, 84.262, 137.189], ['C', ' HE ', 186.444, 83.273, 136.598], ['C', ' HZ ', 188.562, 82.426, 135.861], ['C', ' HZ ', 187.681, 82.918, 134.562], ['C', ' HZ ', 188.932, 83.845, 135.11]]
[['C', ' N ', 182.408, 87.585, 133.125], ['C', ' CA ', 181.836, 88.912, 133.002], ['C', ' C ', 182.47, 89.712, 134.14], ['C', ' O ', 182.336, 89.369, 135.322], ['C', ' CB ', 180.307, 88.901, 133.092], ['C', ' CG ', 179.696, 90.233, 132.819], ['C', ' CD1', 179.214, 90.511, 131.569], ['C', ' CD2', 179.642, 91.22, 133.773], ['C', ' CE1', 178.699, 91.747, 131.254], ['C', ' CE2', 179.125, 92.46, 133.463], ['C', ' CZ ', 178.662, 92.722, 132.203], ['C', ' H ', 182.016, 86.932, 133.803], ['C', ' HA ', 182.13, 89.357, 132.057], ['C', ' HB ', 179.907, 88.187, 132.374], ['C', ' HB ', 180.007, 88.59, 134.041], ['C', ' HD1', 179.248, 89.727, 130.816], ['C', ' HD2', 180.025, 91.019, 134.776], ['C', ' HE1', 178.327, 91.947, 130.246], ['C', ' HE2', 179.09, 93.239, 134.21], ['C', ' HZ ', 178.262, 93.704, 131.963]]
[['C', ' N ', 183.234, 90.722, 133.784], ['C', ' CA ', 184.019, 91.469, 134.755], ['C', ' C ', 183.353, 92.78, 135.06], ['C', ' O ', 182.929, 93.494, 134.147], ['C', ' CB ', 185.364, 91.815, 134.137], ['C', ' CG ', 186.155, 90.648, 133.73], ['C', ' CD1', 185.982, 89.982, 132.571], ['C', ' CD2', 187.251, 90.007, 134.383], ['C', ' NE1', 186.857, 88.984, 132.467], ['C', ' CE2', 187.648, 88.969, 133.562], ['C', ' CE3', 187.915, 90.219, 135.562], ['C', ' CZ2', 188.673, 88.132, 133.897], ['C', ' CZ3', 188.95, 89.389, 135.903], ['C', ' CH2', 189.318, 88.366, 135.091], ['C', ' H ', 183.238, 90.967, 132.8], ['C', ' HA ', 184.132, 90.891, 135.671], ['C', ' HB ', 185.2, 92.443, 133.283], ['C', ' HB ', 185.943, 92.389, 134.852], ['C', ' HD1', 185.232, 90.206, 131.817], ['C', ' HE1', 186.881, 88.335, 131.637], ['C', ' HE3', 187.63, 91.005, 136.209], ['C', ' HZ2', 188.981, 87.308, 133.258], ['C', ' HZ3', 189.462, 89.57, 136.846], ['C', ' HH2', 190.141, 87.719, 135.392]]
[['C', ' N ', 183.326, 93.141, 136.332], ['C', ' CA ', 182.819, 94.427, 136.752], ['C', ' C ', 183.869, 95.142, 137.598], ['C', ' O ', 184.195, 94.703, 138.699], ['C', ' CB ', 181.515, 94.192, 137.541], ['C', ' CG1', 180.959, 95.417, 138.017], ['C', ' CG2', 180.505, 93.56, 136.651], ['C', ' H ', 183.641, 92.474, 137.043], ['C', ' HA ', 182.609, 95.038, 135.871], ['C', ' HB ', 181.725, 93.556, 138.395], ['C', ' HG1', 180.048, 95.215, 138.562], ['C', ' HG1', 181.655, 95.909, 138.657], ['C', ' HG1', 180.74, 96.026, 137.171], ['C', ' HG2', 179.593, 93.403, 137.198], ['C', ' HG2', 180.317, 94.226, 135.813], ['C', ' HG2', 180.871, 92.61, 136.289]]
[['C', ' N ', 184.375, 96.267, 137.123], ['C', ' CA ', 185.426, 96.993, 137.836], ['C', ' C ', 184.749, 98.033, 138.687], ['C', ' O ', 184.009, 98.858, 138.139], ['C', ' CB ', 186.379, 97.605, 136.829], ['C', ' CG ', 187.156, 96.558, 136.06], ['C', ' CD1', 186.61, 95.96, 134.923], ['C', ' CD2', 188.407, 96.195, 136.483], ['C', ' CE1', 187.311, 95.008, 134.238], ['C', ' CE2', 189.114, 95.239, 135.793], ['C', ' CZ ', 188.571, 94.644, 134.681], ['C', ' OH ', 189.285, 93.683, 134.01], ['C', ' H ', 184.052, 96.606, 136.212], ['C', ' HA ', 185.969, 96.316, 138.492], ['C', ' HB ', 185.818, 98.203, 136.133], ['C', ' HB ', 187.084, 98.261, 137.339], ['C', ' HD1', 185.631, 96.234, 134.575], ['C', ' HD2', 188.84, 96.659, 137.369], ['C', ' HE1', 186.876, 94.54, 133.354], ['C', ' HE2', 190.108, 94.946, 136.134], ['C', ' HH ', 188.769, 93.355, 133.268]]
[['C', ' N ', 184.986, 98.004, 140.009], ['C', ' CA ', 184.24, 98.886, 140.91], ['C', ' C ', 185.111, 99.658, 141.893], ['C', ' O ', 184.875, 99.542, 143.103], ['C', ' CB ', 183.312, 98.059, 141.806], ['C', ' OG1', 184.098, 97.196, 142.597], ['C', ' CG2', 182.446, 97.193, 140.955], ['C', ' H ', 185.653, 97.33, 140.416], ['C', ' HA ', 183.671, 99.605, 140.32], ['C', ' HB ', 182.701, 98.709, 142.436], ['C', ' HG1', 184.543, 97.762, 143.262], ['C', ' HG2', 181.825, 96.579, 141.584], ['C', ' HG2', 181.837, 97.821, 140.319], ['C', ' HG2', 183.062, 96.544, 140.353]]
[['C', ' N ', 186.145, 100.367, 141.432], ['C', ' CA ', 187.092, 101.104, 142.286], ['C', ' C ', 187.982, 100.187, 143.116], ['C', ' O ', 189.201, 100.162, 142.953], ['C', ' CB ', 186.392, 102.063, 143.267], ['C', ' CG ', 185.676, 103.215, 142.642], ['C', ' CD ', 184.984, 104.063, 143.682], ['C', ' OE1', 184.785, 103.612, 144.812], ['C', ' NE2', 184.622, 105.284, 143.316], ['C', ' H ', 186.306, 100.458, 140.421], ['C', ' HA ', 187.736, 101.696, 141.632], ['C', ' HB ', 185.703, 101.551, 143.911], ['C', ' HB ', 187.15, 102.492, 143.919], ['C', ' HG ', 186.399, 103.834, 142.117], ['C', ' HG ', 184.931, 102.835, 141.942], ['C', ' HE2', 184.162, 105.89, 143.968], ['C', ' HE2', 184.815, 105.603, 142.385]]
[['C', ' N ', 187.369, 99.459, 144.032], ['C', ' CA ', 188.059, 98.514, 144.879], ['C', ' C ', 187.95, 97.107, 144.306], ['C', ' O ', 186.928, 96.436, 144.475], ['C', ' CB ', 187.495, 98.553, 146.299], ['C', ' CG ', 188.252, 97.647, 147.274], ['C', ' OD1', 189.108, 96.913, 146.831], ['C', ' OD2', 187.974, 97.708, 148.452], ['C', ' H ', 186.361, 99.538, 144.095], ['C', ' HA ', 189.113, 98.785, 144.918], ['C', ' HB ', 187.526, 99.576, 146.674], ['C', ' HB ', 186.449, 98.245, 146.274]]
[['C', ' N ', 189.003, 96.68, 143.619], ['C', ' CA ', 189.082, 95.38, 142.967], ['C', ' C ', 188.065, 95.215, 141.824], ['C', ' O ', 187.293, 96.132, 141.503], ['C', ' CB ', 188.867, 94.286, 144.041], ['C', ' CG ', 189.445, 92.928, 143.686], ['C', ' OD1', 189.995, 92.835, 142.614], ['C', ' OD2', 189.338, 92.008, 144.459], ['C', ' H ', 189.802, 97.295, 143.552], ['C', ' HA ', 190.083, 95.271, 142.55], ['C', ' HB ', 189.288, 94.623, 144.995], ['C', ' HB ', 187.794, 94.147, 144.197]]
[['C', ' N ', 188.088, 94.035, 141.213], ['C', ' CA ', 187.166, 93.69, 140.149], ['C', ' C ', 186.342, 92.485, 140.566], ['C', ' O ', 186.864, 91.487, 141.058], ['C', ' CB ', 187.929, 93.408, 138.836], ['C', ' CG1', 188.878, 92.226, 138.976], ['C', ' CG2', 186.953, 93.175, 137.704], ['C', ' H ', 188.794, 93.369, 141.523], ['C', ' HA ', 186.487, 94.524, 139.985], ['C', ' HB ', 188.538, 94.274, 138.616], ['C', ' HG1', 189.421, 92.096, 138.042], ['C', ' HG1', 189.587, 92.42, 139.783], ['C', ' HG1', 188.332, 91.313, 139.19], ['C', ' HG2', 187.503, 93.03, 136.799], ['C', ' HG2', 186.332, 92.302, 137.893], ['C', ' HG2', 186.335, 94.03, 137.592]]
[['C', ' N ', 185.051, 92.563, 140.344], ['C', ' CA ', 184.194, 91.465, 140.697], ['C', ' C ', 183.948, 90.645, 139.464], ['C', ' O ', 183.783, 91.184, 138.367], ['C', ' CB ', 182.867, 91.998, 141.226], ['C', ' CG ', 182.938, 92.96, 142.417], ['C', ' CD1', 181.518, 93.426, 142.746], ['C', ' CD2', 183.595, 92.286, 143.609], ['C', ' H ', 184.671, 93.4, 139.901], ['C', ' HA ', 184.684, 90.832, 141.432], ['C', ' HB ', 182.375, 92.529, 140.42], ['C', ' HB ', 182.244, 91.156, 141.512], ['C', ' HG ', 183.524, 93.844, 142.136], ['C', ' HD1', 181.548, 94.136, 143.574], ['C', ' HD1', 181.094, 93.906, 141.875], ['C', ' HD1', 180.901, 92.575, 143.031], ['C', ' HD2', 183.632, 92.99, 144.441], ['C', ' HD2', 183.014, 91.41, 143.901], ['C', ' HD2', 184.612, 91.984, 143.362]]
[['C', ' N ', 183.876, 89.336, 139.604], ['C', ' CA ', 183.574, 88.572, 138.417], ['C', ' C ', 182.449, 87.615, 138.592], ['C', ' O ', 182.299, 86.957, 139.626], ['C', ' CB ', 184.758, 87.74, 137.973], ['C', ' OG1', 185.092, 86.821, 139.018], ['C', ' CG2', 185.932, 88.614, 137.659], ['C', ' H ', 184.031, 88.88, 140.494], ['C', ' HA ', 183.295, 89.248, 137.613], ['C', ' HB ', 184.473, 87.184, 137.087], ['C', ' HG1', 184.341, 86.222, 139.168], ['C', ' HG2', 186.761, 87.998, 137.33], ['C', ' HG2', 185.64, 89.295, 136.87], ['C', ' HG2', 186.232, 89.181, 138.537]]
[['C', ' N ', 181.738, 87.468, 137.505], ['C', ' CA ', 180.661, 86.539, 137.328], ['C', ' C ', 181.095, 85.525, 136.282], ['C', ' O ', 181.386, 85.918, 135.157], ['C', ' CB ', 179.467, 87.316, 136.815], ['C', ' CG ', 178.23, 86.582, 136.471], ['C', ' CD1', 177.6, 85.998, 137.721], ['C', ' CD2', 177.33, 87.538, 135.803], ['C', ' H ', 181.971, 88.113, 136.741], ['C', ' HA ', 180.432, 86.085, 138.282], ['C', ' HB ', 179.185, 88.04, 137.563], ['C', ' HB ', 179.778, 87.857, 135.972], ['C', ' HG ', 178.455, 85.762, 135.784], ['C', ' HD1', 176.678, 85.48, 137.456], ['C', ' HD1', 178.264, 85.301, 138.199], ['C', ' HD1', 177.376, 86.806, 138.408], ['C', ' HD2', 176.409, 87.026, 135.532], ['C', ' HD2', 177.122, 88.359, 136.49], ['C', ' HD2', 177.806, 87.93, 134.906]]
[['C', ' N ', 181.165, 84.231, 136.555], ['C', ' CA ', 181.592, 83.265, 135.575], ['C', ' C ', 180.719, 83.409, 134.349], ['C', ' O ', 179.503, 83.592, 134.454], ['C', ' CB ', 181.362, 81.943, 136.303], ['C', ' CG ', 181.489, 82.3, 137.766], ['C', ' CD ', 180.884, 83.684, 137.88], ['C', ' HA ', 182.652, 83.419, 135.327], ['C', ' HB ', 180.389, 81.525, 136.032], ['C', ' HB ', 182.114, 81.21, 135.979], ['C', ' HG ', 180.954, 81.556, 138.38], ['C', ' HG ', 182.543, 82.272, 138.078], ['C', ' HD ', 179.808, 83.622, 138.06], ['C', ' HD ', 181.425, 84.229, 138.672]]
[['C', ' N ', 181.316, 83.333, 133.183], ['C', ' CA ', 180.54, 83.514, 131.991], ['C', ' C ', 179.663, 82.303, 131.904], ['C', ' O ', 180.033, 81.235, 132.398], ['C', ' CB ', 181.437, 83.733, 130.783], ['C', ' CG ', 180.845, 84.339, 129.519], ['C', ' CD1', 180.425, 85.828, 129.792], ['C', ' CD2', 181.914, 84.306, 128.439], ['C', ' H ', 182.32, 83.145, 133.089], ['C', ' HA ', 179.899, 84.384, 132.126], ['C', ' HB ', 182.176, 84.431, 131.083], ['C', ' HB ', 181.922, 82.79, 130.528], ['C', ' HG ', 179.973, 83.772, 129.193], ['C', ' HD1', 180.027, 86.261, 128.874], ['C', ' HD1', 179.664, 85.892, 130.559], ['C', ' HD1', 181.305, 86.403, 130.108], ['C', ' HD2', 181.521, 84.743, 127.519], ['C', ' HD2', 182.785, 84.888, 128.771], ['C', ' HD2', 182.215, 83.276, 128.252]]
[['C', ' N ', 178.491, 82.497, 131.337], ['C', ' CA ', 177.412, 81.529, 131.196], ['C', ' C ', 176.514, 81.528, 132.431], ['C', ' O ', 175.407, 81.004, 132.389], ['C', ' CB ', 177.912, 80.114, 130.883], ['C', ' CG ', 178.76, 80.012, 129.602], ['C', ' CD ', 179.151, 78.576, 129.326], ['C', ' CE ', 180.037, 78.466, 128.098], ['C', ' NZ ', 180.473, 77.06, 127.854], ['C', ' H ', 178.335, 83.422, 130.952], ['C', ' HA ', 176.797, 81.841, 130.352], ['C', ' HB ', 178.44, 79.677, 131.723], ['C', ' HB ', 177.042, 79.479, 130.716], ['C', ' HG ', 178.188, 80.397, 128.76], ['C', ' HG ', 179.665, 80.603, 129.701], ['C', ' HD ', 179.689, 78.181, 130.189], ['C', ' HD ', 178.254, 77.979, 129.173], ['C', ' HE ', 179.489, 78.822, 127.227], ['C', ' HE ', 180.921, 79.09, 128.238], ['C', ' HZ ', 181.06, 77.024, 127.033], ['C', ' HZ ', 180.994, 76.724, 128.652], ['C', ' HZ ', 179.663, 76.473, 127.712]]
[['C', ' N ', 176.821, 82.367, 133.426], ['C', ' CA ', 175.861, 82.554, 134.518], ['C', ' C ', 174.88, 83.629, 134.043], ['C', ' O ', 173.891, 83.956, 134.698], ['C', ' CB ', 176.556, 82.946, 135.812], ['C', ' CG ', 177.473, 81.871, 136.357], ['C', ' CD ', 176.746, 80.641, 136.829], ['C', ' OE1', 175.834, 80.773, 137.606], ['C', ' OE2', 177.1, 79.564, 136.412], ['C', ' H ', 177.743, 82.819, 133.504], ['C', ' HA ', 175.315, 81.624, 134.686], ['C', ' HB ', 177.157, 83.826, 135.633], ['C', ' HB ', 175.816, 83.194, 136.571], ['C', ' HG ', 178.15, 81.578, 135.562], ['C', ' HG ', 178.061, 82.282, 137.169]]
[['C', ' N ', 175.184, 84.121, 132.84], ['C', ' CA ', 174.496, 85.099, 132.037], ['C', ' C ', 173.814, 84.383, 130.854], ['C', ' O ', 173.267, 85.023, 129.961], ['C', ' CB ', 175.495, 86.116, 131.467], ['C', ' OG1', 176.431, 85.446, 130.595], ['C', ' CG2', 176.266, 86.735, 132.588], ['C', ' H ', 176.047, 83.782, 132.455], ['C', ' HA ', 173.758, 85.613, 132.646], ['C', ' HB ', 174.97, 86.887, 130.931], ['C', ' HG1', 176.009, 85.298, 129.726], ['C', ' HG2', 176.974, 87.46, 132.186], ['C', ' HG2', 175.577, 87.234, 133.254], ['C', ' HG2', 176.81, 85.971, 133.138]]
[['C', ' N ', 173.869, 83.045, 130.824], ['C', ' CA ', 173.372, 82.242, 129.704], ['C', ' C ', 171.909, 82.458, 129.379], ['C', ' O ', 171.516, 82.389, 128.223], ['C', ' CB ', 173.587, 80.755, 129.96], ['C', ' CG ', 173.173, 79.893, 128.838], ['C', ' ND1', 173.906, 79.784, 127.677], ['C', ' CD2', 172.095, 79.097, 128.68], ['C', ' CE1', 173.297, 78.954, 126.855], ['C', ' NE2', 172.195, 78.521, 127.439], ['C', ' H ', 174.297, 82.534, 131.596], ['C', ' HA ', 173.935, 82.504, 128.807], ['C', ' HB ', 174.637, 80.567, 130.119], ['C', ' HB ', 173.055, 80.449, 130.858], ['C', ' HD1', 174.762, 80.253, 127.47], ['C', ' HD2', 171.245, 78.868, 129.323], ['C', ' HE1', 173.721, 78.733, 125.877]]
[['C', ' N ', 171.078, 82.632, 130.388], ['C', ' CA ', 169.653, 82.806, 130.156], ['C', ' C ', 169.23, 84.27, 130.051], ['C', ' O ', 168.037, 84.568, 130.099], ['C', ' H ', 171.44, 82.637, 131.331], ['C', ' HA ', 169.373, 82.282, 129.243], ['C', ' HA ', 169.103, 82.334, 130.968]]
[['C', ' N ', 170.192, 85.188, 129.98], ['C', ' CA ', 169.878, 86.603, 129.996], ['C', ' C ', 170.071, 87.46, 128.738], ['C', ' O ', 169.779, 88.668, 128.793], ['C', ' CB ', 170.697, 87.219, 131.103], ['C', ' CG ', 170.3, 86.811, 132.448], ['C', ' CD1', 170.88, 85.736, 133.054], ['C', ' CD2', 169.351, 87.545, 133.102], ['C', ' CE1', 170.512, 85.386, 134.32], ['C', ' CE2', 168.975, 87.205, 134.362], ['C', ' CZ ', 169.551, 86.127, 134.977], ['C', ' OH ', 169.17, 85.785, 136.248], ['C', ' H ', 171.174, 84.909, 129.915], ['C', ' HA ', 168.825, 86.69, 130.263], ['C', ' HB ', 171.744, 86.951, 130.966], ['C', ' HB ', 170.633, 88.245, 131.037], ['C', ' HD1', 171.623, 85.157, 132.537], ['C', ' HD2', 168.893, 88.406, 132.614], ['C', ' HE1', 170.975, 84.523, 134.804], ['C', ' HE2', 168.216, 87.794, 134.878], ['C', ' HH ', 168.47, 86.376, 136.543]]
[['C', ' N ', 170.573, 86.908, 127.629], ['C', ' CA ', 170.849, 87.733, 126.452], ['C', ' C ', 169.599, 87.886, 125.609], ['C', ' O ', 168.66, 87.095, 125.707], ['C', ' CB ', 171.992, 87.173, 125.604], ['C', ' CG ', 171.634, 86.09, 124.591], ['C', ' CD ', 171.412, 84.772, 125.166], ['C', ' OE1', 171.092, 84.7, 126.323], ['C', ' OE2', 171.559, 83.795, 124.451], ['C', ' H ', 170.782, 85.905, 127.569], ['C', ' HA ', 171.147, 88.725, 126.779], ['C', ' HB ', 172.447, 87.999, 125.062], ['C', ' HB ', 172.761, 86.763, 126.261], ['C', ' HG ', 170.763, 86.374, 124.008], ['C', ' HG ', 172.468, 86.011, 123.894]]
[['C', ' N ', 169.565, 88.915, 124.787], ['C', ' CA ', 168.415, 89.111, 123.926], ['C', ' C ', 168.276, 88.077, 122.828], ['C', ' O ', 169.234, 87.778, 122.107], ['C', ' CB ', 168.426, 90.489, 123.333], ['C', ' CG ', 167.226, 90.815, 122.514], ['C', ' CD ', 167.074, 92.247, 122.296], ['C', ' OE1', 167.134, 93.018, 123.256], ['C', ' NE2', 166.839, 92.677, 121.091], ['C', ' H ', 170.37, 89.55, 124.762], ['C', ' HA ', 167.526, 89.037, 124.553], ['C', ' HB ', 168.557, 91.229, 124.103], ['C', ' HB ', 169.265, 90.529, 122.67], ['C', ' HG ', 167.341, 90.37, 121.538], ['C', ' HG ', 166.326, 90.448, 123.002], ['C', ' HE2', 166.733, 93.658, 120.924], ['C', ' HE2', 166.722, 92.05, 120.3]]
[['C', ' N ', 167.029, 87.651, 122.616], ['C', ' CA ', 166.641, 86.621, 121.657], ['C', ' C ', 167.104, 86.893, 120.241], ['C', ' O ', 167.424, 85.967, 119.499], ['C', ' CB ', 165.139, 86.467, 121.636], ['C', ' H ', 166.314, 88.005, 123.238], ['C', ' HA ', 167.081, 85.69, 121.993], ['C', ' HB ', 164.867, 85.665, 120.946], ['C', ' HB ', 164.783, 86.225, 122.636], ['C', ' HB ', 164.681, 87.398, 121.3]]
[['C', ' N ', 167.198, 88.139, 119.848], ['C', ' CA ', 167.617, 88.434, 118.488], ['C', ' C ', 168.997, 87.849, 118.101], ['C', ' O ', 169.257, 87.717, 116.894], ['C', ' H ', 166.931, 88.899, 120.45], ['C', ' HA ', 166.858, 88.047, 117.806], ['C', ' HA ', 167.621, 89.514, 118.348]]
[['C', ' N ', 169.907, 87.524, 119.095], ['C', ' CA ', 171.21, 86.929, 118.812], ['C', ' C ', 171.256, 85.447, 119.125], ['C', ' O ', 172.306, 84.817, 119.038], ['C', ' CB ', 172.393, 87.665, 119.511], ['C', ' SG ', 172.958, 89.208, 118.698], ['C', ' H ', 169.636, 87.672, 120.068], ['C', ' HA ', 171.392, 86.998, 117.746], ['C', ' HB ', 172.104, 87.924, 120.535], ['C', ' HB ', 173.267, 87.013, 119.591]]
[['C', ' N ', 170.086, 84.825, 119.209], ['C', ' CA ', 170.09, 83.376, 119.285], ['C', ' C ', 170.507, 82.925, 117.898], ['C', ' O ', 171.035, 81.836, 117.706], ['C', ' CB ', 168.722, 82.802, 119.664], ['C', ' CG ', 168.263, 83.107, 121.076], ['C', ' CD ', 169.08, 82.404, 122.147], ['C', ' CE ', 168.518, 82.688, 123.542], ['C', ' NZ ', 169.369, 82.093, 124.615], ['C', ' H ', 169.202, 85.348, 119.26], ['C', ' HA ', 170.846, 83.044, 119.994], ['C', ' HB ', 167.967, 83.213, 118.989], ['C', ' HB ', 168.725, 81.722, 119.529], ['C', ' HG ', 168.412, 84.161, 121.225], ['C', ' HG ', 167.206, 82.879, 121.193], ['C', ' HD ', 169.09, 81.326, 121.965], ['C', ' HD ', 170.108, 82.769, 122.137], ['C', ' HE ', 168.474, 83.77, 123.692], ['C', ' HE ', 167.513, 82.277, 123.619], ['C', ' HZ ', 168.989, 82.318, 125.522], ['C', ' HZ ', 169.434, 81.096, 124.517], ['C', ' HZ ', 170.305, 82.508, 124.538]]
[['C', ' N ', 170.252, 83.793, 116.921], ['C', ' CA ', 170.593, 83.555, 115.545], ['C', ' C ', 171.641, 84.547, 114.952], ['C', ' O ', 171.647, 84.716, 113.729], ['C', ' CB ', 169.331, 83.543, 114.683], ['C', ' CG1', 168.59, 84.887, 114.75], ['C', ' CG2', 168.425, 82.411, 115.218], ['C', ' CD1', 167.5, 85.052, 113.7], ['C', ' H ', 169.799, 84.666, 117.161], ['C', ' HA ', 171.026, 82.559, 115.482], ['C', ' HB ', 169.6, 83.358, 113.653], ['C', ' HG1', 168.135, 85.004, 115.736], ['C', ' HG1', 169.313, 85.694, 114.608], ['C', ' HG2', 167.533, 82.335, 114.624], ['C', ' HG2', 168.95, 81.472, 115.186], ['C', ' HG2', 168.149, 82.612, 116.248], ['C', ' HD1', 167.055, 86.036, 113.815], ['C', ' HD1', 167.941, 84.967, 112.699], ['C', ' HD1', 166.731, 84.297, 113.813]]
[['C', ' N ', 172.492, 85.234, 115.795], ['C', ' CA ', 173.581, 86.116, 115.305], ['C', ' C ', 174.744, 85.165, 115.085], ['C', ' O ', 175.114, 84.4, 115.978], ['C', ' CB ', 174.043, 87.299, 116.269], ['C', ' SG ', 172.904, 88.766, 116.562], ['C', ' H ', 172.428, 85.036, 116.801], ['C', ' HA ', 173.29, 86.569, 114.354], ['C', ' HB ', 174.242, 86.876, 117.246], ['C', ' HB ', 174.998, 87.72, 115.911]]
[['C', ' N ', 175.296, 85.201, 113.893], ['C', ' CA ', 176.389, 84.312, 113.503], ['C', ' C ', 177.728, 85.04, 113.331], ['C', ' O ', 178.819, 84.485, 113.495], ['C', ' CB ', 175.933, 83.633, 112.209], ['C', ' CG ', 175.775, 84.614, 111.055], ['C', ' CD ', 175.139, 84.002, 109.829], ['C', ' CE ', 174.913, 85.11, 108.783], ['C', ' NZ ', 174.193, 84.648, 107.575], ['C', ' H ', 174.907, 85.854, 113.225], ['C', ' HA ', 176.513, 83.556, 114.279], ['C', ' HB ', 176.63, 82.866, 111.915], ['C', ' HB ', 174.97, 83.155, 112.374], ['C', ' HG ', 175.175, 85.466, 111.361], ['C', ' HG ', 176.758, 84.978, 110.757], ['C', ' HD ', 175.79, 83.233, 109.414], ['C', ' HD ', 174.174, 83.552, 110.084], ['C', ' HE ', 174.327, 85.904, 109.245], ['C', ' HE ', 175.878, 85.516, 108.48], ['C', ' HZ ', 174.063, 85.46, 106.935], ['C', ' HZ ', 174.706, 83.932, 107.108], ['C', ' HZ ', 173.259, 84.278, 107.823]]
[['C', ' N ', 177.649, 86.305, 113.001], ['C', ' CA ', 178.8, 87.101, 112.66], ['C', ' C ', 179.496, 87.757, 113.825], ['C', ' O ', 179.447, 88.969, 113.987], ['C', ' CB ', 178.391, 88.12, 111.614], ['C', ' CG ', 177.21, 88.91, 112.048], ['C', ' OD1', 176.443, 88.392, 112.864], ['C', ' OD2', 177.032, 89.991, 111.563], ['C', ' H ', 176.744, 86.763, 112.949], ['C', ' HA ', 179.525, 86.439, 112.186], ['C', ' HB ', 179.226, 88.8, 111.426], ['C', ' HB ', 178.164, 87.613, 110.671]]
[['C', ' N ', 180.208, 86.959, 114.616], ['C', ' CA ', 180.891, 87.506, 115.801], ['C', ' C ', 181.716, 88.691, 115.345], ['C', ' O ', 181.661, 89.801, 115.893], ['C', ' CB ', 181.832, 86.464, 116.439], ['C', ' CG ', 182.551, 86.99, 117.616], ['C', ' CD1', 181.881, 87.138, 118.78], ['C', ' CD2', 183.864, 87.319, 117.551], ['C', ' CE1', 182.505, 87.637, 119.869], ['C', ' CE2', 184.487, 87.81, 118.65], ['C', ' CZ ', 183.806, 87.976, 119.807], ['C', ' OH ', 184.428, 88.491, 120.916], ['C', ' H ', 180.165, 85.96, 114.397], ['C', ' HA ', 180.151, 87.85, 116.526], ['C', ' HB ', 181.308, 85.577, 116.735], ['C', ' HB ', 182.573, 86.156, 115.709], ['C', ' HD1', 180.834, 86.869, 118.836], ['C', ' HD2', 184.413, 87.199, 116.636], ['C', ' HE1', 181.965, 87.768, 120.782], ['C', ' HE2', 185.523, 88.082, 118.603], ['C', ' HH ', 183.796, 88.567, 121.635]]
[['C', ' N ', 182.456, 88.441, 114.287], ['C', ' CA ', 183.292, 89.417, 113.649], ['C', ' C ', 182.441, 90.204, 112.666], ['C', ' O ', 181.823, 89.624, 111.771], ['C', ' CB ', 184.432, 88.691, 112.933], ['C', ' CG1', 185.267, 89.631, 112.179], ['C', ' CG2', 185.261, 87.978, 113.957], ['C', ' H ', 182.395, 87.511, 113.901], ['C', ' HA ', 183.693, 90.088, 114.403], ['C', ' HB ', 184.017, 87.97, 112.226], ['C', ' HG1', 186.062, 89.07, 111.697], ['C', ' HG1', 184.664, 90.137, 111.425], ['C', ' HG1', 185.697, 90.36, 112.853], ['C', ' HG2', 186.057, 87.449, 113.478], ['C', ' HG2', 185.672, 88.702, 114.656], ['C', ' HG2', 184.649, 87.27, 114.487]]
[['C', ' N ', 182.492, 91.526, 112.745], ['C', ' CA ', 181.664, 92.368, 111.893], ['C', ' C ', 182.194, 92.422, 110.474], ['C', ' O ', 182.765, 93.407, 110.021], ['C', ' CB ', 181.578, 93.768, 112.478], ['C', ' H ', 183.043, 91.934, 113.482], ['C', ' HA ', 180.672, 91.929, 111.851], ['C', ' HB ', 180.929, 94.389, 111.86], ['C', ' HB ', 181.176, 93.722, 113.474], ['C', ' HB ', 182.556, 94.201, 112.513]]
[['C', ' N ', 181.919, 91.353, 109.756], ['C', ' CA ', 182.393, 91.097, 108.408], ['C', ' C ', 181.909, 92.093, 107.366], ['C', ' O ', 182.448, 92.157, 106.267], ['C', ' CB ', 182.023, 89.683, 107.994], ['C', ' CG ', 180.567, 89.419, 107.778], ['C', ' CD ', 180.316, 87.962, 107.462], ['C', ' OE1', 181.28, 87.236, 107.318], ['C', ' OE2', 179.169, 87.573, 107.317], ['C', ' H ', 181.438, 90.607, 110.26], ['C', ' HA ', 183.47, 91.142, 108.435], ['C', ' HB ', 182.55, 89.425, 107.077], ['C', ' HB ', 182.352, 88.996, 108.774], ['C', ' HG ', 179.999, 89.704, 108.665], ['C', ' HG ', 180.223, 90.018, 106.942]]
[['C', ' N ', 180.852, 92.816, 107.66], ['C', ' CA ', 180.352, 93.806, 106.724], ['C', ' C ', 180.879, 95.221, 107.015], ['C', ' O ', 180.518, 96.19, 106.342], ['C', ' CB ', 178.832, 93.76, 106.712], ['C', ' CG ', 178.169, 92.466, 106.187], ['C', ' CD1', 176.691, 92.584, 106.379], ['C', ' CD2', 178.476, 92.262, 104.697], ['C', ' H ', 180.415, 92.691, 108.56], ['C', ' HA ', 180.714, 93.547, 105.736], ['C', ' HB ', 178.49, 93.883, 107.726], ['C', ' HB ', 178.481, 94.564, 106.149], ['C', ' HG ', 178.522, 91.61, 106.755], ['C', ' HD1', 176.198, 91.677, 106.026], ['C', ' HD1', 176.501, 92.71, 107.432], ['C', ' HD1', 176.313, 93.44, 105.824], ['C', ' HD2', 177.976, 91.36, 104.355], ['C', ' HD2', 178.109, 93.114, 104.127], ['C', ' HD2', 179.542, 92.151, 104.532]]
[['C', ' N ', 181.695, 95.35, 108.044], ['C', ' CA ', 182.268, 96.621, 108.462], ['C', ' C ', 183.415, 96.935, 107.536], ['C', ' O ', 183.843, 96.045, 106.818], ['C', ' CB ', 182.73, 96.557, 109.893], ['C', ' H ', 181.981, 94.513, 108.558], ['C', ' HA ', 181.516, 97.399, 108.356], ['C', ' HB ', 183.153, 97.516, 110.177], ['C', ' HB ', 181.892, 96.325, 110.538], ['C', ' HB ', 183.485, 95.788, 109.985]]
[['C', ' N ', 183.925, 98.171, 107.514], ['C', ' CA ', 185.076, 98.438, 106.657], ['C', ' C ', 186.307, 97.987, 107.425], ['C', ' O ', 187.269, 97.451, 106.864], ['C', ' CB ', 185.155, 99.941, 106.367], ['C', ' CG ', 183.981, 100.438, 105.535], ['C', ' OD1', 183.858, 100.039, 104.409], ['C', ' OD2', 183.157, 101.186, 106.046], ['C', ' H ', 183.574, 98.914, 108.122], ['C', ' HA ', 184.997, 97.866, 105.729], ['C', ' HB ', 185.172, 100.485, 107.312], ['C', ' HB ', 186.076, 100.166, 105.843]]
[['C', ' N ', 186.244, 98.206, 108.725], ['C', ' CA ', 187.25, 97.798, 109.687], ['C', ' C ', 186.503, 97.334, 110.915], ['C', ' O ', 185.474, 97.913, 111.224], ['C', ' CB ', 188.243, 98.951, 109.976], ['C', ' CG1', 187.517, 100.143, 110.499], ['C', ' CG2', 189.302, 98.511, 111.019], ['C', ' H ', 185.416, 98.706, 109.066], ['C', ' HA ', 187.802, 96.959, 109.278], ['C', ' HB ', 188.732, 99.226, 109.049], ['C', ' HG1', 188.218, 100.948, 110.677], ['C', ' HG1', 186.772, 100.468, 109.776], ['C', ' HG1', 187.036, 99.888, 111.419], ['C', ' HG2', 190.0, 99.327, 111.194], ['C', ' HG2', 188.828, 98.248, 111.961], ['C', ' HG2', 189.847, 97.649, 110.644]]
[['C', ' N ', 186.983, 96.328, 111.616], ['C', ' CA ', 186.311, 95.943, 112.85], ['C', ' C ', 187.291, 95.572, 113.931], ['C', ' O ', 188.423, 95.163, 113.663], ['C', ' CB ', 185.371, 94.789, 112.615], ['C', ' OG ', 186.067, 93.659, 112.211], ['C', ' H ', 187.814, 95.84, 111.278], ['C', ' HA ', 185.743, 96.795, 113.21], ['C', ' HB ', 184.825, 94.576, 113.535], ['C', ' HB ', 184.649, 95.063, 111.859], ['C', ' HG ', 185.418, 92.959, 112.155]]
[['C', ' N ', 186.869, 95.751, 115.178], ['C', ' CA ', 187.725, 95.429, 116.3], ['C', ' C ', 187.07, 94.66, 117.442], ['C', ' O ', 185.843, 94.602, 117.582], ['C', ' CB ', 188.293, 96.709, 116.946], ['C', ' OG1', 187.228, 97.409, 117.593], ['C', ' CG2', 188.911, 97.642, 115.897], ['C', ' H ', 185.936, 96.132, 115.331], ['C', ' HA ', 188.521, 94.815, 115.916], ['C', ' HB ', 189.058, 96.438, 117.678], ['C', ' HG1', 186.88, 96.872, 118.313], ['C', ' HG2', 189.298, 98.529, 116.389], ['C', ' HG2', 189.71, 97.131, 115.393], ['C', ' HG2', 188.162, 97.94, 115.172]]
[['C', ' N ', 187.926, 94.174, 118.33], ['C', ' CA ', 187.526, 93.532, 119.588], ['C', ' C ', 188.782, 93.12, 120.318], ['C', ' O ', 189.85, 93.23, 119.754], ['C', ' H ', 188.917, 94.251, 118.069], ['C', ' HA ', 186.959, 94.237, 120.196], ['C', ' HA ', 186.89, 92.68, 119.413]]
[['C', ' N ', 188.696, 92.592, 121.524], ['C', ' CA ', 189.908, 92.265, 122.29], ['C', ' C ', 190.29, 90.795, 122.344], ['C', ' O ', 191.207, 90.403, 123.06], ['C', ' CB ', 189.737, 92.776, 123.691], ['C', ' OG ', 188.658, 92.151, 124.312], ['C', ' H ', 187.795, 92.468, 121.973], ['C', ' HA ', 190.74, 92.8, 121.843], ['C', ' HB ', 190.651, 92.599, 124.264], ['C', ' HB ', 189.573, 93.847, 123.667], ['C', ' HG ', 188.608, 92.547, 125.202]]
[['C', ' N ', 189.641, 89.976, 121.558], ['C', ' CA ', 189.837, 88.537, 121.656], ['C', ' C ', 191.26, 88.047, 121.414], ['C', ' O ', 191.733, 87.16, 122.111], ['C', ' CB ', 188.915, 87.849, 120.66], ['C', ' CG1', 189.203, 86.346, 120.592], ['C', ' CG2', 187.508, 88.109, 121.06], ['C', ' H ', 188.951, 90.369, 120.938], ['C', ' HA ', 189.545, 88.235, 122.663], ['C', ' HB ', 189.087, 88.259, 119.672], ['C', ' HG1', 188.53, 85.906, 119.903], ['C', ' HG1', 190.223, 86.137, 120.271], ['C', ' HG1', 189.042, 85.909, 121.575], ['C', ' HG2', 186.856, 87.641, 120.349], ['C', ' HG2', 187.326, 87.694, 122.05], ['C', ' HG2', 187.304, 89.174, 121.081]]
[['C', ' N ', 191.93, 88.589, 120.421], ['C', ' CA ', 193.288, 88.171, 120.079], ['C', ' C ', 194.351, 89.037, 120.741], ['C', ' O ', 195.508, 89.03, 120.326], ['C', ' H ', 191.488, 89.316, 119.879], ['C', ' HA ', 193.436, 87.132, 120.371], ['C', ' HA ', 193.413, 88.212, 118.998]]
[['C', ' N ', 193.971, 89.856, 121.718], ['C', ' CA ', 194.947, 90.76, 122.284], ['C', ' C ', 195.102, 90.718, 123.812], ['C', ' O ', 194.201, 90.294, 124.531], ['C', ' CB ', 194.58, 92.14, 121.849], ['C', ' OG ', 194.728, 92.297, 120.469], ['C', ' H ', 193.01, 89.875, 122.076], ['C', ' HA ', 195.896, 90.503, 121.831], ['C', ' HB ', 193.542, 92.322, 122.123], ['C', ' HB ', 195.152, 92.83, 122.358], ['C', ' HG ', 194.58, 93.227, 120.297]]
[['C', ' N ', 196.273, 91.114, 124.342], ['C', ' CA ', 196.559, 91.297, 125.749], ['C', ' C ', 195.849, 92.538, 126.241], ['C', ' O ', 195.56, 93.428, 125.446], ['C', ' CB ', 198.072, 91.451, 125.779], ['C', ' CG ', 198.408, 92.006, 124.453], ['C', ' CD ', 197.434, 91.358, 123.486], ['C', ' HA ', 196.232, 90.407, 126.309], ['C', ' HB ', 198.359, 92.129, 126.6], ['C', ' HB ', 198.551, 90.476, 125.977], ['C', ' HG ', 198.296, 93.079, 124.484], ['C', ' HG ', 199.454, 91.814, 124.235], ['C', ' HD ', 197.244, 92.073, 122.687], ['C', ' HD ', 197.809, 90.4, 123.11]]
[['C', ' N ', 195.669, 92.659, 127.539], ['C', ' CA ', 194.979, 93.824, 128.07], ['C', ' C ', 195.543, 95.138, 127.56], ['C', ' O ', 196.749, 95.393, 127.637], ['C', ' CB ', 195.142, 93.887, 129.586], ['C', ' CG ', 194.502, 92.768, 130.367], ['C', ' OD1', 193.808, 91.943, 129.815], ['C', ' OD2', 194.714, 92.739, 131.55], ['C', ' H ', 195.941, 91.914, 128.17], ['C', ' HA ', 193.919, 93.771, 127.794], ['C', ' HB ', 196.206, 93.901, 129.824], ['C', ' HB ', 194.727, 94.833, 129.941]]
[['C', ' N ', 194.644, 95.999, 127.084], ['C', ' CA ', 194.982, 97.323, 126.583], ['C', ' C ', 195.083, 97.377, 125.071], ['C', ' O ', 194.955, 98.453, 124.482], ['C', ' H ', 193.647, 95.716, 127.049], ['C', ' HA ', 194.23, 98.034, 126.927], ['C', ' HA ', 195.934, 97.627, 127.014]]
[['C', ' N ', 195.201, 96.221, 124.445], ['C', ' CA ', 195.323, 96.063, 123.006], ['C', ' C ', 194.065, 95.47, 122.432], ['C', ' O ', 193.378, 94.703, 123.101], ['C', ' CB ', 196.491, 95.143, 122.697], ['C', ' CG ', 197.801, 95.676, 122.97], ['C', ' CD1', 198.399, 95.78, 124.174], ['C', ' CD2', 198.75, 96.125, 122.01], ['C', ' NE1', 199.652, 96.282, 124.027], ['C', ' CE2', 199.881, 96.503, 122.706], ['C', ' CE3', 198.737, 96.223, 120.638], ['C', ' CZ2', 200.989, 96.989, 122.072], ['C', ' CZ3', 199.848, 96.703, 119.998], ['C', ' CH2', 200.943, 97.079, 120.696], ['C', ' H ', 195.251, 95.355, 124.997], ['C', ' HA ', 195.482, 97.024, 122.544], ['C', ' HB ', 196.407, 94.277, 123.318], ['C', ' HB ', 196.446, 94.823, 121.66], ['C', ' HD1', 197.943, 95.492, 125.129], ['C', ' HE1', 200.308, 96.445, 124.78], ['C', ' HE3', 197.867, 95.919, 120.078], ['C', ' HZ2', 201.883, 97.295, 122.617], ['C', ' HZ3', 199.834, 96.77, 118.924], ['C', ' HH2', 201.812, 97.46, 120.157]]
[['C', ' N ', 193.774, 95.748, 121.175], ['C', ' CA ', 192.628, 95.107, 120.557], ['C', ' C ', 192.981, 94.618, 119.162], ['C', ' O ', 193.959, 95.048, 118.558], ['C', ' CB ', 191.46, 96.062, 120.524], ['C', ' OG ', 191.748, 97.151, 119.736], ['C', ' H ', 194.323, 96.426, 120.637], ['C', ' HA ', 192.342, 94.245, 121.152], ['C', ' HB ', 190.58, 95.566, 120.142], ['C', ' HB ', 191.232, 96.393, 121.537], ['C', ' HG ', 190.998, 97.755, 119.837]]
[['C', ' N ', 192.234, 93.652, 118.684], ['C', ' CA ', 192.391, 93.084, 117.362], ['C', ' C ', 191.739, 94.003, 116.378], ['C', ' O ', 190.625, 94.46, 116.619], ['C', ' CB ', 191.732, 91.698, 117.292], ['C', ' OG1', 192.374, 90.833, 118.233], ['C', ' CG2', 191.833, 91.104, 115.876], ['C', ' H ', 191.463, 93.339, 119.246], ['C', ' HA ', 193.445, 92.997, 117.119], ['C', ' HB ', 190.68, 91.787, 117.566], ['C', ' HG1', 192.275, 91.214, 119.113], ['C', ' HG2', 191.368, 90.126, 115.861], ['C', ' HG2', 191.327, 91.745, 115.16], ['C', ' HG2', 192.869, 91.01, 115.593]]
[['C', ' N ', 192.423, 94.289, 115.284], ['C', ' CA ', 191.895, 95.122, 114.228], ['C', ' C ', 191.894, 94.389, 112.909], ['C', ' O ', 192.949, 93.986, 112.407], ['C', ' CB ', 192.797, 96.346, 114.032], ['C', ' CG1', 192.251, 97.26, 112.931], ['C', ' CG2', 192.965, 97.052, 115.292], ['C', ' H ', 193.354, 93.901, 115.182], ['C', ' HA ', 190.876, 95.414, 114.472], ['C', ' HB ', 193.765, 96.007, 113.702], ['C', ' HG1', 192.926, 98.102, 112.795], ['C', ' HG1', 192.17, 96.722, 111.988], ['C', ' HG1', 191.268, 97.627, 113.22], ['C', ' HG2', 193.625, 97.88, 115.107], ['C', ' HG2', 192.008, 97.408, 115.646], ['C', ' HG2', 193.406, 96.398, 116.048]]
[['C', ' N ', 190.737, 94.27, 112.302], ['C', ' CA ', 190.681, 93.631, 111.017], ['C', ' C ', 190.242, 94.62, 109.971], ['C', ' O ', 189.151, 95.185, 110.065], ['C', ' CB ', 189.686, 92.472, 110.986], ['C', ' CG1', 190.044, 91.435, 112.045], ['C', ' CG2', 189.728, 91.884, 109.578], ['C', ' CD1', 189.044, 90.332, 112.208], ['C', ' H ', 189.891, 94.596, 112.772], ['C', ' HA ', 191.67, 93.265, 110.745], ['C', ' HB ', 188.68, 92.822, 111.218], ['C', ' HG1', 190.945, 91.01, 111.829], ['C', ' HG1', 190.126, 91.941, 112.997], ['C', ' HG2', 189.086, 91.065, 109.5], ['C', ' HG2', 189.43, 92.619, 108.837], ['C', ' HG2', 190.715, 91.561, 109.346], ['C', ' HD1', 189.381, 89.667, 112.996], ['C', ' HD1', 188.084, 90.761, 112.48], ['C', ' HD1', 188.942, 89.766, 111.296]]
[['C', ' N ', 191.057, 94.815, 108.949], ['C', ' CA ', 190.672, 95.723, 107.884], ['C', ' C ', 190.165, 94.857, 106.748], ['C', ' O ', 190.807, 93.867, 106.35], ['C', ' CB ', 191.849, 96.598, 107.463], ['C', ' OG1', 192.931, 95.751, 107.085], ['C', ' CG2', 192.273, 97.489, 108.638], ['C', ' H ', 191.958, 94.32, 108.912], ['C', ' HA ', 189.861, 96.368, 108.217], ['C', ' HB ', 191.558, 97.203, 106.621], ['C', ' HG1', 193.613, 96.234, 106.615], ['C', ' HG2', 193.118, 98.104, 108.363], ['C', ' HG2', 191.441, 98.129, 108.919], ['C', ' HG2', 192.553, 96.867, 109.483]]
[['C', ' N ', 188.965, 95.178, 106.278], ['C', ' CA ', 188.27, 94.389, 105.282], ['C', ' C ', 187.483, 95.142, 104.218], ['C', ' O ', 186.287, 95.323, 104.382], ['C', ' CB ', 187.343, 93.45, 105.987], ['C', ' CG ', 186.41, 94.085, 106.966], ['C', ' CD ', 185.365, 93.175, 107.269], ['C', ' NE ', 185.882, 91.97, 107.817], ['C', ' CZ ', 186.135, 91.77, 109.098], ['C', ' NH1', 185.898, 92.724, 109.969], ['C', ' NH2', 186.621, 90.625, 109.46], ['C', ' H ', 188.488, 96.026, 106.606], ['C', ' HA ', 189.017, 93.792, 104.764], ['C', ' HB ', 186.76, 92.885, 105.264], ['C', ' HB ', 187.935, 92.747, 106.562], ['C', ' HG ', 186.963, 94.286, 107.882], ['C', ' HG ', 185.992, 95.0, 106.629], ['C', ' HD ', 184.649, 93.62, 107.959], ['C', ' HD ', 184.854, 92.931, 106.342], ['C', ' HE ', 186.108, 91.22, 107.148], ['C', ' HH1', 185.52, 93.608, 109.653], ['C', ' HH1', 186.11, 92.626, 110.96], ['C', ' HH2', 186.807, 89.918, 108.763], ['C', ' HH2', 186.827, 90.449, 110.428]]
[['C', ' N ', 188.119, 95.515, 103.119], ['C', ' CA ', 187.553, 96.335, 102.027], ['C', ' C ', 188.318, 97.611, 101.991], ['C', ' O ', 188.505, 98.266, 103.029], ['C', ' CB ', 186.035, 96.701, 102.141], ['C', ' OG1', 185.248, 95.524, 102.163], ['C', ' CG2', 185.577, 97.543, 100.95], ['C', ' H ', 189.095, 95.269, 103.049], ['C', ' HA ', 187.706, 95.822, 101.078], ['C', ' HB ', 185.856, 97.286, 103.05], ['C', ' HG1', 185.354, 95.165, 103.039], ['C', ' HG2', 184.517, 97.766, 101.065], ['C', ' HG2', 186.125, 98.476, 100.901], ['C', ' HG2', 185.726, 96.984, 100.026]]
[['C', ' N ', 188.773, 97.965, 100.788], ['C', ' CA ', 189.552, 99.161, 100.655], ['C', ' C ', 188.682, 100.287, 101.145], ['C', ' O ', 187.629, 100.563, 100.568], ['C', ' CB ', 189.912, 99.412, 99.192], ['C', ' CG ', 190.855, 98.355, 98.57], ['C', ' OD1', 191.324, 97.457, 99.26], ['C', ' OD2', 191.105, 98.462, 97.399], ['C', ' H ', 188.595, 97.386, 99.98], ['C', ' HA ', 190.449, 99.09, 101.261], ['C', ' HB ', 188.998, 99.447, 98.601], ['C', ' HB ', 190.385, 100.391, 99.108]]
[['C', ' N ', 189.156, 100.931, 102.191], ['C', ' CA ', 188.514, 102.012, 102.928], ['C', ' C ', 188.971, 101.899, 104.359], ['C', ' O ', 189.449, 102.87, 104.955], ['C', ' CB ', 186.983, 101.961, 102.893], ['C', ' H ', 190.058, 100.585, 102.532], ['C', ' HA ', 188.855, 102.964, 102.528], ['C', ' HB ', 186.589, 102.776, 103.499], ['C', ' HB ', 186.594, 102.076, 101.897], ['C', ' HB ', 186.633, 101.014, 103.305]]
[['C', ' N ', 188.762, 100.705, 104.926], ['C', ' CA ', 189.12, 100.431, 106.306], ['C', ' C ', 190.618, 100.353, 106.464], ['C', ' O ', 191.18, 100.799, 107.468], ['C', ' H ', 188.392, 99.933, 104.356], ['C', ' HA ', 188.71, 101.201, 106.958], ['C', ' HA ', 188.678, 99.485, 106.604]]
[['C', ' N ', 191.277, 99.802, 105.451], ['C', ' CA ', 192.706, 99.636, 105.501], ['C', ' C ', 193.345, 100.955, 105.24], ['C', ' O ', 194.372, 101.262, 105.814], ['C', ' CB ', 193.144, 98.663, 104.434], ['C', ' CG ', 192.694, 99.172, 103.109], ['C', ' OD1', 191.63, 99.838, 103.087], ['C', ' OD2', 193.379, 98.962, 102.136], ['C', ' H ', 190.772, 99.484, 104.622], ['C', ' HA ', 193.009, 99.295, 106.483], ['C', ' HB ', 194.23, 98.562, 104.443], ['C', ' HB ', 192.708, 97.683, 104.607]]
[['C', ' N ', 192.689, 101.749, 104.422], ['C', ' CA ', 193.183, 103.042, 104.05], ['C', ' C ', 193.186, 103.938, 105.254], ['C', ' O ', 194.22, 104.505, 105.593], ['C', ' CB ', 192.32, 103.625, 102.959], ['C', ' OG ', 192.774, 104.891, 102.586], ['C', ' H ', 191.871, 101.35, 103.983], ['C', ' HA ', 194.203, 102.937, 103.684], ['C', ' HB ', 192.322, 102.956, 102.101], ['C', ' HB ', 191.297, 103.699, 103.312], ['C', ' HG ', 192.202, 105.176, 101.872]]
[['C', ' N ', 192.082, 104.008, 105.981], ['C', ' CA ', 192.11, 104.893, 107.119], ['C', ' C ', 193.025, 104.388, 108.217], ['C', ' O ', 193.647, 105.182, 108.917], ['C', ' CB ', 190.702, 105.182, 107.66], ['C', ' CG1', 190.723, 106.355, 108.693], ['C', ' CG2', 190.092, 103.955, 108.281], ['C', ' CD1', 191.129, 107.704, 108.158], ['C', ' H ', 191.232, 103.516, 105.689], ['C', ' HA ', 192.517, 105.833, 106.764], ['C', ' HB ', 190.071, 105.492, 106.829], ['C', ' HG1', 189.729, 106.444, 109.095], ['C', ' HG1', 191.393, 106.125, 109.496], ['C', ' HG2', 189.115, 104.195, 108.619], ['C', ' HG2', 190.039, 103.168, 107.547], ['C', ' HG2', 190.659, 103.613, 109.115], ['C', ' HD1', 191.08, 108.435, 108.958], ['C', ' HD1', 192.143, 107.689, 107.776], ['C', ' HD1', 190.461, 107.982, 107.371]]
[['C', ' N ', 193.104, 103.068, 108.41], ['C', ' CA ', 193.976, 102.574, 109.446], ['C', ' C ', 195.434, 102.802, 109.032], ['C', ' O ', 196.234, 103.271, 109.822], ['C', ' CB ', 193.671, 101.116, 109.76], ['C', ' CG ', 194.346, 100.636, 110.995], ['C', ' CD1', 193.894, 101.069, 112.234], ['C', ' CD2', 195.405, 99.773, 110.95], ['C', ' CE1', 194.488, 100.663, 113.392], ['C', ' CE2', 196.006, 99.358, 112.118], ['C', ' CZ ', 195.544, 99.809, 113.336], ['C', ' H ', 192.546, 102.408, 107.863], ['C', ' HA ', 193.804, 103.146, 110.348], ['C', ' HB ', 192.591, 100.985, 109.876], ['C', ' HB ', 193.985, 100.496, 108.921], ['C', ' HD1', 193.061, 101.747, 112.275], ['C', ' HD2', 195.776, 99.423, 109.985], ['C', ' HE1', 194.12, 101.024, 114.358], ['C', ' HE2', 196.853, 98.682, 112.079], ['C', ' HZ ', 196.026, 99.485, 114.243]]
[['C', ' N ', 195.778, 102.547, 107.771], ['C', ' CA ', 197.137, 102.744, 107.272], ['C', ' C ', 197.527, 104.214, 107.154], ['C', ' O ', 198.712, 104.53, 107.143], ['C', ' CB ', 197.356, 102.042, 105.943], ['C', ' CG ', 197.398, 100.553, 106.077], ['C', ' CD ', 197.606, 99.867, 104.746], ['C', ' CE ', 197.546, 98.37, 104.932], ['C', ' NZ ', 198.673, 97.862, 105.764], ['C', ' H ', 195.094, 102.176, 107.126], ['C', ' HA ', 197.818, 102.297, 107.996], ['C', ' HB ', 196.56, 102.316, 105.25], ['C', ' HB ', 198.296, 102.376, 105.509], ['C', ' HG ', 198.219, 100.302, 106.742], ['C', ' HG ', 196.477, 100.199, 106.531], ['C', ' HD ', 196.816, 100.172, 104.053], ['C', ' HD ', 198.571, 100.144, 104.325], ['C', ' HE ', 196.61, 98.125, 105.434], ['C', ' HE ', 197.565, 97.872, 103.964], ['C', ' HZ ', 198.547, 96.854, 105.89], ['C', ' HZ ', 199.556, 98.047, 105.321], ['C', ' HZ ', 198.654, 98.292, 106.668]]
[['C', ' N ', 196.556, 105.127, 107.092], ['C', ' CA ', 196.86, 106.557, 107.114], ['C', ' C ', 197.189, 106.981, 108.54], ['C', ' O ', 197.595, 108.119, 108.778], ['C', ' CB ', 195.709, 107.398, 106.58], ['C', ' CG ', 195.468, 107.285, 105.1], ['C', ' CD ', 194.194, 107.977, 104.697], ['C', ' OE1', 193.402, 108.382, 105.553], ['C', ' NE2', 193.985, 108.124, 103.4], ['C', ' H ', 195.582, 104.836, 106.963], ['C', ' HA ', 197.74, 106.738, 106.498], ['C', ' HB ', 194.792, 107.092, 107.089], ['C', ' HB ', 195.88, 108.447, 106.817], ['C', ' HG ', 196.287, 107.798, 104.602], ['C', ' HG ', 195.453, 106.266, 104.777], ['C', ' HE2', 193.155, 108.577, 103.074], ['C', ' HE2', 194.654, 107.779, 102.739]]
[['C', ' N ', 196.945, 106.077, 109.475], ['C', ' CA ', 197.206, 106.173, 110.876], ['C', ' C ', 198.298, 105.129, 111.058], ['C', ' O ', 198.798, 104.614, 110.062], ['C', ' CB ', 195.972, 105.938, 111.714], ['C', ' H ', 196.619, 105.157, 109.192], ['C', ' HA ', 197.621, 107.156, 111.106], ['C', ' HB ', 196.241, 106.011, 112.747], ['C', ' HB ', 195.245, 106.683, 111.488], ['C', ' HB ', 195.556, 104.957, 111.498]]
[['C', ' N ', 198.755, 104.88, 112.279], ['C', ' CA ', 199.89, 103.971, 112.584], ['C', ' C ', 201.15, 104.795, 112.264], ['C', ' O ', 202.011, 104.997, 113.12], ['C', ' CB ', 199.857, 102.613, 111.834], ['C', ' CG1', 201.119, 101.838, 112.163], ['C', ' CG2', 198.593, 101.827, 112.236], ['C', ' H ', 198.315, 105.384, 113.026], ['C', ' HA ', 199.901, 103.754, 113.651], ['C', ' HB ', 199.868, 102.762, 110.772], ['C', ' HG1', 201.107, 100.887, 111.636], ['C', ' HG1', 201.996, 102.406, 111.857], ['C', ' HG1', 201.16, 101.661, 113.239], ['C', ' HG2', 198.579, 100.878, 111.706], ['C', ' HG2', 198.594, 101.639, 113.3], ['C', ' HG2', 197.701, 102.397, 111.967]]
[['C', ' N ', 201.241, 105.3, 111.033], ['C', ' CA ', 202.216, 106.327, 110.746], ['C', ' C ', 201.416, 107.44, 111.364], ['C', ' O ', 200.308, 107.137, 111.777], ['C', ' CB ', 202.451, 106.556, 109.261], ['C', ' CG ', 201.261, 107.147, 108.491], ['C', ' CD ', 201.613, 107.395, 107.069], ['C', ' OE1', 202.641, 106.914, 106.652], ['C', ' OE2', 200.897, 108.099, 106.397], ['C', ' H ', 200.551, 105.01, 110.34], ['C', ' HA ', 203.147, 106.179, 111.292], ['C', ' HB ', 203.3, 107.223, 109.127], ['C', ' HB ', 202.703, 105.606, 108.789], ['C', ' HG ', 200.424, 106.441, 108.531], ['C', ' HG ', 200.926, 108.078, 108.933]]
[['C', ' N ', 201.856, 108.698, 111.447], ['C', ' CA ', 200.957, 109.613, 112.174], ['C', ' C ', 200.601, 108.876, 113.472], ['C', ' O ', 199.43, 108.604, 113.746], ['C', ' CB ', 199.706, 109.963, 111.359], ['C', ' H ', 202.747, 108.983, 111.068], ['C', ' HA ', 201.498, 110.526, 112.421], ['C', ' HB ', 199.067, 110.621, 111.946], ['C', ' HB ', 200.001, 110.468, 110.441], ['C', ' HB ', 199.137, 109.077, 111.095]]
[['C', ' N ', 201.651, 108.514, 114.223], ['C', ' CA ', 201.659, 107.567, 115.349], ['C', ' C ', 200.673, 107.693, 116.504], ['C', ' O ', 201.065, 107.739, 117.675], ['C', ' H ', 202.548, 108.863, 113.922], ['C', ' HA ', 201.542, 106.568, 114.929], ['C', ' HA ', 202.663, 107.568, 115.769]]
[['C', ' N ', 199.393, 107.612, 116.165], ['C', ' CA ', 198.3, 107.533, 117.106], ['C', ' C ', 198.057, 106.08, 117.457], ['C', ' O ', 197.287, 105.769, 118.359], ['C', ' CB ', 197.031, 108.099, 116.486], ['C', ' CG ', 197.061, 109.572, 116.087], ['C', ' CD1', 195.785, 109.882, 115.401], ['C', ' CD2', 197.25, 110.466, 117.309], ['C', ' H ', 199.177, 107.665, 115.179], ['C', ' HA ', 198.557, 108.071, 118.011], ['C', ' HB ', 196.811, 107.52, 115.588], ['C', ' HB ', 196.212, 107.955, 117.189], ['C', ' HG ', 197.875, 109.748, 115.386], ['C', ' HD1', 195.792, 110.923, 115.091], ['C', ' HD1', 195.692, 109.237, 114.531], ['C', ' HD1', 194.947, 109.709, 116.076], ['C', ' HD2', 197.254, 111.509, 116.991], ['C', ' HD2', 196.433, 110.306, 118.015], ['C', ' HD2', 198.196, 110.246, 117.796]]
[['C', ' N ', 198.684, 105.178, 116.708], ['C', ' CA ', 198.558, 103.75, 116.944], ['C', ' C ', 199.883, 103.061, 116.901], ['C', ' O ', 200.778, 103.434, 116.143], ['C', ' CB ', 197.7, 103.004, 115.931], ['C', ' CG ', 196.377, 103.438, 115.855], ['C', ' CD1', 195.924, 104.044, 114.748], ['C', ' CD2', 195.57, 103.302, 116.913], ['C', ' CE1', 194.658, 104.499, 114.697], ['C', ' CE2', 194.325, 103.766, 116.879], ['C', ' CZ ', 193.874, 104.354, 115.77], ['C', ' H ', 199.307, 105.517, 115.994], ['C', ' HA ', 198.136, 103.602, 117.933], ['C', ' HB ', 198.134, 103.098, 114.966], ['C', ' HB ', 197.695, 101.941, 116.182], ['C', ' HD1', 196.586, 104.146, 113.901], ['C', ' HD2', 195.948, 102.822, 117.799], ['C', ' HE1', 194.277, 104.984, 113.801], ['C', ' HE2', 193.686, 103.667, 117.75], ['C', ' HZ ', 192.91, 104.703, 115.746]]
[['C', ' N ', 199.959, 101.981, 117.634], ['C', ' CA ', 201.079, 101.08, 117.525], ['C', ' C ', 200.463, 99.747, 117.207], ['C', ' O ', 199.326, 99.479, 117.604], ['C', ' CB ', 201.953, 101.08, 118.772], ['C', ' CG ', 201.284, 100.734, 120.066], ['C', ' CD ', 202.287, 100.758, 121.189], ['C', ' OE1', 203.439, 100.962, 120.901], ['C', ' OE2', 201.914, 100.583, 122.33], ['C', ' H ', 199.191, 101.789, 118.285], ['C', ' HA ', 201.704, 101.373, 116.68], ['C', ' HB ', 202.774, 100.378, 118.631], ['C', ' HB ', 202.393, 102.071, 118.891], ['C', ' HG ', 200.494, 101.459, 120.27], ['C', ' HG ', 200.827, 99.764, 119.989]]
[['C', ' N ', 201.172, 98.919, 116.457], ['C', ' CA ', 200.568, 97.669, 116.032], ['C', ' C ', 201.536, 96.514, 115.855], ['C', ' O ', 202.728, 96.717, 115.602], ['C', ' CB ', 199.779, 97.926, 114.743], ['C', ' OG1', 199.085, 96.769, 114.389], ['C', ' CG2', 200.674, 98.324, 113.617], ['C', ' H ', 202.11, 99.162, 116.168], ['C', ' HA ', 199.859, 97.367, 116.789], ['C', ' HB ', 199.061, 98.725, 114.921], ['C', ' HG1', 198.471, 96.543, 115.118], ['C', ' HG2', 200.072, 98.502, 112.727], ['C', ' HG2', 201.208, 99.232, 113.881], ['C', ' HG2', 201.389, 97.529, 113.415]]
[['C', ' N ', 201.002, 95.303, 116.001], ['C', ' CA ', 201.75, 94.061, 115.853], ['C', ' C ', 200.996, 93.113, 114.906], ['C', ' O ', 199.772, 93.052, 114.952], ['C', ' CB ', 201.849, 93.36, 117.214], ['C', ' CG ', 202.479, 94.15, 118.354], ['C', ' CD ', 203.954, 94.344, 118.183], ['C', ' CE ', 204.552, 95.04, 119.392], ['C', ' NZ ', 206.017, 95.28, 119.224], ['C', ' H ', 199.997, 95.277, 116.2], ['C', ' HA ', 202.732, 94.298, 115.47], ['C', ' HB ', 200.857, 93.07, 117.532], ['C', ' HB ', 202.42, 92.434, 117.1], ['C', ' HG ', 202.006, 95.126, 118.415], ['C', ' HG ', 202.293, 93.631, 119.289], ['C', ' HD ', 204.44, 93.375, 118.043], ['C', ' HD ', 204.143, 94.959, 117.302], ['C', ' HE ', 204.049, 95.997, 119.539], ['C', ' HE ', 204.394, 94.419, 120.275], ['C', ' HZ ', 206.383, 95.743, 120.045], ['C', ' HZ ', 206.492, 94.395, 119.096], ['C', ' HZ ', 206.171, 95.865, 118.412]]
[['C', ' N ', 201.653, 92.279, 114.095], ['C', ' CA ', 200.987, 91.292, 113.265], ['C', ' C ', 200.183, 90.431, 114.202], ['C', ' O ', 200.701, 90.068, 115.252], ['C', ' CB ', 202.156, 90.514, 112.668], ['C', ' CG ', 203.31, 91.495, 112.692], ['C', ' CD ', 203.111, 92.306, 113.962], ['C', ' HA ', 200.356, 91.774, 112.506], ['C', ' HB ', 202.352, 89.61, 113.267], ['C', ' HB ', 201.895, 90.165, 111.654], ['C', ' HG ', 204.27, 90.939, 112.706], ['C', ' HG ', 203.313, 92.11, 111.783], ['C', ' HD ', 203.597, 91.819, 114.831], ['C', ' HD ', 203.496, 93.313, 113.768]]
[['C', ' N ', 198.988, 90.009, 113.825], ['C', ' CA ', 198.168, 89.217, 114.74], ['C', ' C ', 198.775, 87.869, 115.127], ['C', ' O ', 198.351, 87.241, 116.092], ['C', ' CB ', 196.761, 89.04, 114.181], ['C', ' CG1', 195.718, 88.652, 115.284], ['C', ' CG2', 196.754, 88.008, 113.06], ['C', ' CD1', 195.461, 89.743, 116.335], ['C', ' H ', 198.589, 90.284, 112.917], ['C', ' HA ', 198.098, 89.802, 115.657], ['C', ' HB ', 196.464, 89.978, 113.785], ['C', ' HG1', 194.782, 88.463, 114.799], ['C', ' HG1', 196.024, 87.748, 115.799], ['C', ' HG2', 195.758, 87.933, 112.653], ['C', ' HG2', 197.443, 88.315, 112.273], ['C', ' HG2', 197.054, 87.032, 113.43], ['C', ' HD1', 194.697, 89.4, 117.037], ['C', ' HD1', 196.36, 89.958, 116.896], ['C', ' HD1', 195.12, 90.653, 115.849]]
[['C', ' N ', 199.701, 87.369, 114.328], ['C', ' CA ', 200.373, 86.116, 114.616], ['C', ' C ', 201.298, 86.219, 115.835], ['C', ' O ', 201.688, 85.2, 116.418], ['C', ' CB ', 201.153, 85.667, 113.392], ['C', ' CG ', 200.259, 85.387, 112.198], ['C', ' CD ', 199.877, 86.635, 111.474], ['C', ' OE1', 200.441, 87.665, 111.785], ['C', ' OE2', 199.019, 86.582, 110.634], ['C', ' H ', 199.984, 87.909, 113.502], ['C', ' HA ', 199.609, 85.369, 114.832], ['C', ' HB ', 201.879, 86.434, 113.119], ['C', ' HB ', 201.705, 84.757, 113.624], ['C', ' HG ', 200.779, 84.721, 111.513], ['C', ' HG ', 199.356, 84.882, 112.543]]
[['C', ' N ', 201.687, 87.442, 116.19], ['C', ' CA ', 202.581, 87.701, 117.302], ['C', ' C ', 201.756, 88.168, 118.488], ['C', ' O ', 200.757, 88.848, 118.292], ['C', ' CB ', 203.591, 88.791, 116.934], ['C', ' CG ', 204.503, 88.456, 115.765], ['C', ' CD ', 205.502, 89.553, 115.486], ['C', ' OE1', 205.569, 90.475, 116.265], ['C', ' OE2', 206.182, 89.477, 114.49], ['C', ' H ', 201.308, 88.253, 115.694], ['C', ' HA ', 203.104, 86.783, 117.568], ['C', ' HB ', 203.05, 89.706, 116.679], ['C', ' HB ', 204.216, 89.011, 117.797], ['C', ' HG ', 205.034, 87.532, 115.98], ['C', ' HG ', 203.89, 88.297, 114.878]]
[['C', ' N ', 202.226, 87.877, 119.706], ['C', ' CA ', 201.605, 88.313, 120.968], ['C', ' C ', 200.319, 87.539, 121.246], ['C', ' O ', 199.256, 87.881, 120.747], ['C', ' CB ', 201.294, 89.833, 120.964], ['C', ' CG1', 200.665, 90.22, 122.267], ['C', ' CG2', 202.566, 90.637, 120.704], ['C', ' H ', 203.058, 87.307, 119.755], ['C', ' HA ', 202.306, 88.113, 121.779], ['C', ' HB ', 200.557, 90.059, 120.21], ['C', ' HG1', 200.433, 91.278, 122.233], ['C', ' HG1', 199.759, 89.655, 122.423], ['C', ' HG1', 201.355, 90.02, 123.085], ['C', ' HG2', 202.323, 91.694, 120.707], ['C', ' HG2', 203.294, 90.428, 121.484], ['C', ' HG2', 202.989, 90.373, 119.738]]
[['C', ' N ', 200.409, 86.508, 122.074], ['C', ' CA ', 199.287, 85.598, 122.226], ['C', ' C ', 198.21, 86.182, 123.162], ['C', ' O ', 198.548, 86.981, 124.037], ['C', ' CB ', 199.782, 84.251, 122.751], ['C', ' CG ', 200.85, 83.584, 121.875], ['C', ' CD ', 200.368, 83.267, 120.45], ['C', ' CE ', 201.437, 82.483, 119.687], ['C', ' NZ ', 201.081, 82.265, 118.253], ['C', ' H ', 201.287, 86.318, 122.531], ['C', ' HA ', 198.88, 85.465, 121.244], ['C', ' HB ', 200.206, 84.388, 123.745], ['C', ' HB ', 198.962, 83.557, 122.847], ['C', ' HG ', 201.72, 84.234, 121.812], ['C', ' HG ', 201.158, 82.653, 122.352], ['C', ' HD ', 199.445, 82.69, 120.488], ['C', ' HD ', 200.181, 84.192, 119.9], ['C', ' HE ', 202.377, 83.032, 119.736], ['C', ' HE ', 201.57, 81.513, 120.167], ['C', ' HZ ', 201.82, 81.745, 117.8], ['C', ' HZ ', 200.22, 81.745, 118.188], ['C', ' HZ ', 200.973, 83.17, 117.783]]
[['C', ' N ', 196.927, 85.746, 123.06], ['C', ' CA ', 196.305, 84.682, 122.255], ['C', ' C ', 196.48, 84.975, 120.796], ['C', ' O ', 196.539, 86.127, 120.425], ['C', ' CB ', 194.821, 84.802, 122.621], ['C', ' CG ', 194.809, 85.486, 123.957], ['C', ' CD ', 195.968, 86.459, 123.892], ['C', ' HA ', 196.707, 83.701, 122.521], ['C', ' HB ', 194.281, 85.37, 121.847], ['C', ' HB ', 194.369, 83.802, 122.648], ['C', ' HG ', 193.842, 86.008, 124.088], ['C', ' HG ', 194.897, 84.758, 124.773], ['C', ' HD ', 195.663, 87.395, 123.383], ['C', ' HD ', 196.383, 86.653, 124.89]]
[['C', ' N ', 196.609, 83.962, 119.965], ['C', ' CA ', 196.805, 84.283, 118.566], ['C', ' C ', 195.472, 84.424, 117.87], ['C', ' O ', 194.412, 84.298, 118.49], ['C', ' H ', 196.553, 83.003, 120.277], ['C', ' HA ', 197.373, 85.213, 118.471], ['C', ' HA ', 197.391, 83.501, 118.087]]
[['C', ' N ', 195.51, 84.563, 116.549], ['C', ' CA ', 194.294, 84.73, 115.769], ['C', ' C ', 193.355, 83.559, 115.964], ['C', ' O ', 192.136, 83.745, 116.008], ['C', ' CB ', 194.602, 84.873, 114.277], ['C', ' CG ', 193.376, 85.13, 113.333], ['C', ' CD1', 192.669, 86.426, 113.704], ['C', ' CD2', 193.855, 85.188, 111.895], ['C', ' H ', 196.407, 84.618, 116.083], ['C', ' HA ', 193.807, 85.634, 116.125], ['C', ' HB ', 195.291, 85.691, 114.153], ['C', ' HB ', 195.089, 83.96, 113.936], ['C', ' HG ', 192.667, 84.318, 113.431], ['C', ' HD1', 191.842, 86.572, 113.034], ['C', ' HD1', 192.295, 86.391, 114.718], ['C', ' HD1', 193.355, 87.237, 113.601], ['C', ' HD2', 193.0, 85.347, 111.235], ['C', ' HD2', 194.566, 86.001, 111.769], ['C', ' HD2', 194.335, 84.24, 111.639]]
[['C', ' N ', 193.92, 82.37, 116.166], ['C', ' CA ', 193.146, 81.157, 116.321], ['C', ' C ', 192.068, 81.28, 117.392], ['C', ' O ', 191.033, 80.626, 117.284], ['C', ' H ', 194.925, 82.289, 116.131], ['C', ' HA ', 192.693, 80.899, 115.365], ['C', ' HA ', 193.814, 80.336, 116.574]]
[['C', ' N ', 192.271, 82.091, 118.432], ['C', ' CA ', 191.218, 82.187, 119.422], ['C', ' C ', 189.996, 82.854, 118.817], ['C', ' O ', 188.864, 82.503, 119.146], ['C', ' CB ', 191.673, 82.945, 120.666], ['C', ' CG ', 190.618, 83.067, 121.81], ['C', ' CD1', 190.147, 81.688, 122.282], ['C', ' CD2', 191.241, 83.819, 122.96], ['C', ' H ', 193.121, 82.657, 118.529], ['C', ' HA ', 190.953, 81.174, 119.707], ['C', ' HB ', 192.551, 82.449, 121.069], ['C', ' HB ', 191.964, 83.958, 120.367], ['C', ' HG ', 189.757, 83.611, 121.452], ['C', ' HD1', 189.419, 81.818, 123.083], ['C', ' HD1', 189.67, 81.144, 121.473], ['C', ' HD1', 190.996, 81.117, 122.654], ['C', ' HD2', 190.512, 83.931, 123.759], ['C', ' HD2', 192.102, 83.273, 123.333], ['C', ' HD2', 191.554, 84.797, 122.619]]
[['C', ' N ', 190.21, 83.838, 117.955], ['C', ' CA ', 189.113, 84.546, 117.342], ['C', ' C ', 188.424, 83.622, 116.385], ['C', ' O ', 187.2, 83.66, 116.26], ['C', ' CB ', 189.596, 85.823, 116.66], ['C', ' CG ', 188.525, 86.707, 115.999], ['C', ' CD1', 187.469, 87.119, 116.997], ['C', ' CD2', 189.196, 87.946, 115.461], ['C', ' H ', 191.16, 84.06, 117.663], ['C', ' HA ', 188.402, 84.792, 118.11], ['C', ' HB ', 190.127, 86.425, 117.396], ['C', ' HB ', 190.304, 85.536, 115.883], ['C', ' HG ', 188.044, 86.159, 115.185], ['C', ' HD1', 186.751, 87.753, 116.502], ['C', ' HD1', 186.948, 86.254, 117.396], ['C', ' HD1', 187.922, 87.667, 117.802], ['C', ' HD2', 188.45, 88.579, 114.983], ['C', ' HD2', 189.66, 88.486, 116.281], ['C', ' HD2', 189.956, 87.672, 114.738]]
[['C', ' N ', 189.216, 82.796, 115.712], ['C', ' CA ', 188.682, 81.831, 114.77], ['C', ' C ', 187.781, 80.833, 115.504], ['C', ' O ', 186.802, 80.367, 114.932], ['C', ' CB ', 189.803, 81.093, 114.053], ['C', ' CG ', 190.617, 81.951, 113.092], ['C', ' CD ', 191.798, 81.205, 112.532], ['C', ' OE1', 192.049, 80.13, 113.022], ['C', ' OE2', 192.453, 81.692, 111.639], ['C', ' H ', 190.228, 82.882, 115.864], ['C', ' HA ', 188.083, 82.36, 114.03], ['C', ' HB ', 190.467, 80.659, 114.782], ['C', ' HB ', 189.378, 80.27, 113.479], ['C', ' HG ', 189.975, 82.266, 112.275], ['C', ' HG ', 190.951, 82.835, 113.62]]
[['C', ' N ', 188.138, 80.48, 116.755], ['C', ' CA ', 187.316, 79.602, 117.592], ['C', ' C ', 186.038, 80.275, 118.086], ['C', ' O ', 184.986, 79.643, 118.088], ['C', ' CB ', 188.076, 79.109, 118.82], ['C', ' CG ', 189.16, 78.11, 118.555], ['C', ' CD ', 189.86, 77.72, 119.852], ['C', ' CE ', 190.981, 76.725, 119.606], ['C', ' NZ ', 191.695, 76.368, 120.866], ['C', ' H ', 189.032, 80.827, 117.106], ['C', ' HA ', 187.021, 78.742, 116.991], ['C', ' HB ', 188.535, 79.962, 119.316], ['C', ' HB ', 187.371, 78.669, 119.525], ['C', ' HG ', 188.725, 77.223, 118.097], ['C', ' HG ', 189.881, 78.529, 117.863], ['C', ' HD ', 190.278, 78.616, 120.316], ['C', ' HD ', 189.138, 77.28, 120.538], ['C', ' HE ', 190.565, 75.82, 119.167], ['C', ' HE ', 191.695, 77.162, 118.906], ['C', ' HZ ', 192.433, 75.707, 120.66], ['C', ' HZ ', 192.096, 77.201, 121.276], ['C', ' HZ ', 191.046, 75.952, 121.519]]
[['C', ' N ', 186.101, 81.56, 118.493], ['C', ' CA ', 184.866, 82.21, 118.955], ['C', ' C ', 183.933, 82.365, 117.769], ['C', ' O ', 182.719, 82.13, 117.866], ['C', ' CB ', 185.141, 83.588, 119.553], ['C', ' CG ', 185.423, 83.646, 121.052], ['C', ' CD1', 186.676, 82.885, 121.4], ['C', ' CD2', 185.567, 85.08, 121.432], ['C', ' H ', 187.008, 82.035, 118.538], ['C', ' HA ', 184.385, 81.573, 119.695], ['C', ' HB ', 186.008, 84.01, 119.038], ['C', ' HB ', 184.283, 84.23, 119.346], ['C', ' HG ', 184.599, 83.191, 121.594], ['C', ' HD1', 186.855, 82.949, 122.472], ['C', ' HD1', 186.584, 81.84, 121.121], ['C', ' HD1', 187.501, 83.328, 120.88], ['C', ' HD2', 185.762, 85.165, 122.499], ['C', ' HD2', 186.389, 85.489, 120.882], ['C', ' HD2', 184.67, 85.622, 121.188]]
[['C', ' N ', 184.517, 82.739, 116.639], ['C', ' CA ', 183.821, 82.807, 115.388], ['C', ' C ', 183.648, 81.35, 115.111], ['C', ' O ', 184.212, 80.562, 115.834], ['C', ' CB ', 184.602, 83.546, 114.317], ['C', ' H ', 185.512, 82.973, 116.639], ['C', ' HA ', 182.842, 83.269, 115.526], ['C', ' HB ', 184.058, 83.514, 113.376], ['C', ' HB ', 184.746, 84.581, 114.623], ['C', ' HB ', 185.574, 83.068, 114.194]]
[['C', ' N ', 182.793, 80.933, 114.22], ['C', ' CA ', 182.616, 79.489, 113.985], ['C', ' C ', 181.814, 78.854, 115.119], ['C', ' O ', 180.732, 78.349, 114.852], ['C', ' CB ', 183.936, 78.739, 113.791], ['C', ' H ', 182.302, 81.605, 113.653], ['C', ' HA ', 182.051, 79.375, 113.064], ['C', ' HB ', 183.708, 77.701, 113.566], ['C', ' HB ', 184.472, 79.178, 112.954], ['C', ' HB ', 184.589, 78.741, 114.647]]
[['C', ' N ', 182.253, 78.911, 116.384], ['C', ' CA ', 181.377, 78.369, 117.413], ['C', ' C ', 180.097, 79.172, 117.459], ['C', ' O ', 179.009, 78.602, 117.558], ['C', ' CB ', 182.016, 78.417, 118.791], ['C', ' CG ', 183.138, 77.455, 119.026], ['C', ' CD ', 183.791, 77.72, 120.373], ['C', ' OE1', 183.446, 78.702, 121.045], ['C', ' NE2', 184.722, 76.863, 120.774], ['C', ' H ', 183.173, 79.314, 116.623], ['C', ' HA ', 181.133, 77.336, 117.162], ['C', ' HB ', 182.42, 79.422, 118.948], ['C', ' HB ', 181.258, 78.247, 119.55], ['C', ' HG ', 182.728, 76.448, 119.04], ['C', ' HG ', 183.876, 77.538, 118.238], ['C', ' HE2', 185.178, 76.995, 121.656], ['C', ' HE2', 184.969, 76.082, 120.2]]
[['C', ' N ', 180.202, 80.496, 117.332], ['C', ' CA ', 179.009, 81.312, 117.342], ['C', ' C ', 178.143, 80.974, 116.146], ['C', ' O ', 176.913, 80.952, 116.245], ['C', ' CB ', 179.355, 82.794, 117.352], ['C', ' CG ', 178.147, 83.707, 117.463], ['C', ' CD ', 178.577, 85.148, 117.603], ['C', ' CE ', 177.437, 86.099, 117.556], ['C', ' NZ ', 176.501, 85.93, 118.691], ['C', ' H ', 181.127, 80.944, 117.303], ['C', ' HA ', 178.441, 81.084, 118.243], ['C', ' HB ', 180.031, 83.008, 118.183], ['C', ' HB ', 179.884, 83.049, 116.429], ['C', ' HG ', 177.534, 83.611, 116.565], ['C', ' HG ', 177.552, 83.412, 118.323], ['C', ' HD ', 179.152, 85.298, 118.517], ['C', ' HD ', 179.175, 85.37, 116.758], ['C', ' HE ', 177.814, 87.111, 117.558], ['C', ' HE ', 176.916, 85.941, 116.635], ['C', ' HZ ', 175.756, 86.59, 118.586], ['C', ' HZ ', 176.119, 84.997, 118.685], ['C', ' HZ ', 176.942, 86.113, 119.605]]
[['C', ' N ', 178.782, 80.724, 115.007], ['C', ' CA ', 178.038, 80.432, 113.801], ['C', ' C ', 177.281, 79.133, 113.957], ['C', ' O ', 176.113, 79.063, 113.585], ['C', ' CB ', 178.967, 80.325, 112.601], ['C', ' CG ', 179.595, 81.627, 112.194], ['C', ' CD ', 180.536, 81.471, 111.017], ['C', ' CE ', 181.2, 82.802, 110.693], ['C', ' NZ ', 182.19, 82.697, 109.584], ['C', ' H ', 179.79, 80.752, 115.007], ['C', ' HA ', 177.316, 81.228, 113.632], ['C', ' HB ', 179.742, 79.606, 112.808], ['C', ' HB ', 178.402, 79.948, 111.746], ['C', ' HG ', 178.822, 82.324, 111.915], ['C', ' HG ', 180.132, 82.048, 113.04], ['C', ' HD ', 181.303, 80.735, 111.239], ['C', ' HD ', 179.976, 81.136, 110.146], ['C', ' HE ', 180.434, 83.528, 110.417], ['C', ' HE ', 181.717, 83.16, 111.584], ['C', ' HZ ', 182.615, 83.614, 109.444], ['C', ' HZ ', 182.936, 82.063, 109.827], ['C', ' HZ ', 181.753, 82.393, 108.732]]
[['C', ' N ', 177.914, 78.123, 114.556], ['C', ' CA ', 177.251, 76.845, 114.739], ['C', ' C ', 176.067, 76.976, 115.665], ['C', ' O ', 175.025, 76.364, 115.424], ['C', ' CB ', 178.206, 75.809, 115.322], ['C', ' CG ', 179.293, 75.331, 114.386], ['C', ' CD ', 180.24, 74.383, 115.063], ['C', ' OE1', 180.098, 74.186, 116.249], ['C', ' OE2', 181.105, 73.858, 114.403], ['C', ' H ', 178.898, 78.226, 114.814], ['C', ' HA ', 176.899, 76.496, 113.766], ['C', ' HB ', 178.697, 76.238, 116.198], ['C', ' HB ', 177.64, 74.941, 115.656], ['C', ' HG ', 178.826, 74.824, 113.542], ['C', ' HG ', 179.839, 76.183, 113.999]]
[['C', ' N ', 176.211, 77.775, 116.723], ['C', ' CA ', 175.114, 77.942, 117.651], ['C', ' C ', 173.954, 78.597, 116.938], ['C', ' O ', 172.804, 78.162, 117.082], ['C', ' CB ', 175.561, 78.795, 118.829], ['C', ' CG ', 176.542, 78.097, 119.751], ['C', ' CD ', 177.047, 79.029, 120.843], ['C', ' CE ', 178.121, 78.357, 121.686], ['C', ' NZ ', 178.69, 79.283, 122.705], ['C', ' H ', 177.122, 78.216, 116.898], ['C', ' HA ', 174.794, 76.963, 118.005], ['C', ' HB ', 176.046, 79.697, 118.453], ['C', ' HB ', 174.694, 79.104, 119.411], ['C', ' HG ', 176.042, 77.249, 120.217], ['C', ' HG ', 177.38, 77.719, 119.178], ['C', ' HD ', 177.466, 79.926, 120.384], ['C', ' HD ', 176.219, 79.322, 121.487], ['C', ' HE ', 177.691, 77.495, 122.192], ['C', ' HE ', 178.926, 78.018, 121.029], ['C', ' HZ ', 179.4, 78.801, 123.237], ['C', ' HZ ', 179.105, 80.081, 122.24], ['C', ' HZ ', 177.959, 79.598, 123.326]]
[['C', ' N ', 174.252, 79.608, 116.114], ['C', ' CA ', 173.196, 80.255, 115.382], ['C', ' C ', 172.565, 79.274, 114.422], ['C', ' O ', 171.354, 79.149, 114.385], ['C', ' CB ', 173.732, 81.455, 114.627], ['C', ' H ', 175.213, 79.959, 116.048], ['C', ' HA ', 172.438, 80.582, 116.09], ['C', ' HB ', 172.933, 81.946, 114.085], ['C', ' HB ', 174.172, 82.149, 115.339], ['C', ' HB ', 174.493, 81.124, 113.926]]
[['C', ' N ', 173.352, 78.45, 113.742], ['C', ' CA ', 172.757, 77.534, 112.782], ['C', ' C ', 171.81, 76.558, 113.44], ['C', ' O ', 170.76, 76.231, 112.876], ['C', ' CB ', 173.834, 76.777, 112.023], ['C', ' CG ', 174.608, 77.621, 111.028], ['C', ' CD ', 175.757, 76.879, 110.431], ['C', ' OE1', 176.012, 75.784, 110.875], ['C', ' OE2', 176.383, 77.396, 109.536], ['C', ' H ', 174.368, 78.53, 113.809], ['C', ' HA ', 172.192, 78.119, 112.061], ['C', ' HB ', 174.548, 76.365, 112.736], ['C', ' HB ', 173.387, 75.94, 111.488], ['C', ' HG ', 173.93, 77.914, 110.229], ['C', ' HG ', 174.958, 78.524, 111.505]]
[['C', ' N ', 172.159, 76.083, 114.627], ['C', ' CA ', 171.283, 75.158, 115.315], ['C', ' C ', 169.974, 75.839, 115.678], ['C', ' O ', 168.9, 75.236, 115.552], ['C', ' CB ', 171.977, 74.611, 116.552], ['C', ' CG ', 173.111, 73.662, 116.219], ['C', ' CD ', 173.843, 73.185, 117.454], ['C', ' CE ', 175.006, 72.279, 117.073], ['C', ' NZ ', 175.787, 71.834, 118.261], ['C', ' H ', 173.076, 76.335, 115.015], ['C', ' HA ', 171.057, 74.331, 114.643], ['C', ' HB ', 172.392, 75.444, 117.128], ['C', ' HB ', 171.258, 74.094, 117.183], ['C', ' HG ', 172.703, 72.799, 115.695], ['C', ' HG ', 173.814, 74.158, 115.556], ['C', ' HD ', 174.228, 74.049, 118.0], ['C', ' HD ', 173.159, 72.638, 118.101], ['C', ' HE ', 174.619, 71.402, 116.556], ['C', ' HE ', 175.671, 72.823, 116.398], ['C', ' HZ ', 176.548, 71.239, 117.959], ['C', ' HZ ', 176.163, 72.641, 118.738], ['C', ' HZ ', 175.187, 71.319, 118.89]]
[['C', ' N ', 170.053, 77.096, 116.11], ['C', ' CA ', 168.859, 77.821, 116.488], ['C', ' C ', 168.036, 78.231, 115.281], ['C', ' O ', 166.807, 78.212, 115.336], ['C', ' CB ', 169.248, 79.021, 117.299], ['C', ' CG ', 169.738, 78.629, 118.647], ['C', ' OD1', 169.372, 77.577, 119.188], ['C', ' ND2', 170.579, 79.441, 119.207], ['C', ' H ', 170.98, 77.524, 116.248], ['C', ' HA ', 168.239, 77.166, 117.099], ['C', ' HB ', 170.046, 79.56, 116.782], ['C', ' HB ', 168.404, 79.699, 117.402], ['C', ' HD2', 170.956, 79.23, 120.105], ['C', ' HD2', 170.861, 80.291, 118.72]]
[['C', ' N ', 168.697, 78.545, 114.178], ['C', ' CA ', 168.022, 78.955, 112.965], ['C', ' C ', 167.252, 77.765, 112.44], ['C', ' O ', 166.097, 77.89, 112.022], ['C', ' CB ', 169.022, 79.473, 111.913], ['C', ' CG1', 169.664, 80.779, 112.392], ['C', ' CG2', 168.291, 79.754, 110.651], ['C', ' CD1', 170.905, 81.233, 111.649], ['C', ' H ', 169.712, 78.548, 114.22], ['C', ' HA ', 167.319, 79.753, 113.201], ['C', ' HB ', 169.803, 78.736, 111.748], ['C', ' HG1', 168.916, 81.567, 112.293], ['C', ' HG1', 169.915, 80.682, 113.412], ['C', ' HG2', 168.971, 80.127, 109.924], ['C', ' HG2', 167.82, 78.858, 110.267], ['C', ' HG2', 167.537, 80.507, 110.842], ['C', ' HD1', 171.251, 82.175, 112.084], ['C', ' HD1', 171.686, 80.484, 111.753], ['C', ' HD1', 170.702, 81.389, 110.604]]
[['C', ' N ', 167.899, 76.608, 112.417], ['C', ' CA ', 167.225, 75.422, 111.959], ['C', ' C ', 166.042, 75.097, 112.854], ['C', ' O ', 164.977, 74.742, 112.346], ['C', ' CB ', 168.185, 74.263, 111.938], ['C', ' H ', 168.876, 76.56, 112.714], ['C', ' HA ', 166.853, 75.608, 110.951], ['C', ' HB ', 167.673, 73.373, 111.577], ['C', ' HB ', 169.024, 74.499, 111.284], ['C', ' HB ', 168.555, 74.089, 112.951]]
[['C', ' N ', 166.19, 75.274, 114.176], ['C', ' CA ', 165.086, 74.99, 115.071], ['C', ' C ', 163.911, 75.899, 114.78], ['C', ' O ', 162.759, 75.464, 114.838], ['C', ' CB ', 165.516, 75.162, 116.506], ['C', ' H ', 167.099, 75.531, 114.573], ['C', ' HA ', 164.777, 73.957, 114.91], ['C', ' HB ', 164.688, 74.921, 117.166], ['C', ' HB ', 166.354, 74.497, 116.71], ['C', ' HB ', 165.824, 76.192, 116.669]]
[['C', ' N ', 164.183, 77.161, 114.456], ['C', ' CA ', 163.087, 78.057, 114.166], ['C', ' C ', 162.306, 77.562, 112.978], ['C', ' O ', 161.069, 77.563, 113.0], ['C', ' CB ', 163.563, 79.443, 113.843], ['C', ' CG ', 164.131, 80.233, 114.965], ['C', ' CD ', 164.516, 81.555, 114.474], ['C', ' NE ', 163.343, 82.292, 114.119], ['C', ' CZ ', 162.631, 82.998, 114.978], ['C', ' NH1', 162.969, 83.115, 116.236], ['C', ' NH2', 161.57, 83.592, 114.562], ['C', ' H ', 165.151, 77.499, 114.489], ['C', ' HA ', 162.432, 78.095, 115.023], ['C', ' HB ', 164.341, 79.366, 113.104], ['C', ' HB ', 162.755, 80.006, 113.391], ['C', ' HG ', 163.381, 80.342, 115.74], ['C', ' HG ', 164.996, 79.749, 115.37], ['C', ' HD ', 165.073, 82.102, 115.229], ['C', ' HD ', 165.134, 81.447, 113.579], ['C', ' HE ', 162.98, 82.273, 113.15], ['C', ' HH1', 163.791, 82.674, 116.602], ['C', ' HH1', 162.371, 83.697, 116.831], ['C', ' HH2', 161.31, 83.497, 113.566], ['C', ' HH2', 161.038, 84.14, 115.246]]
[['C', ' N ', 163.018, 77.089, 111.952], ['C', ' CA ', 162.33, 76.583, 110.778], ['C', ' C ', 161.483, 75.367, 111.129], ['C', ' O ', 160.322, 75.269, 110.725], ['C', ' CB ', 163.313, 76.24, 109.661], ['C', ' CG ', 162.642, 75.762, 108.378], ['C', ' CD ', 163.647, 75.562, 107.256], ['C', ' CE ', 162.968, 75.035, 105.997], ['C', ' NZ ', 163.938, 74.831, 104.882], ['C', ' H ', 164.044, 77.163, 111.979], ['C', ' HA ', 161.664, 77.365, 110.413], ['C', ' HB ', 163.906, 77.109, 109.423], ['C', ' HB ', 163.997, 75.463, 110.006], ['C', ' HG ', 162.131, 74.816, 108.564], ['C', ' HG ', 161.899, 76.499, 108.07], ['C', ' HD ', 164.109, 76.517, 107.021], ['C', ' HD ', 164.422, 74.864, 107.573], ['C', ' HE ', 162.486, 74.085, 106.224], ['C', ' HE ', 162.209, 75.749, 105.677], ['C', ' HZ ', 163.447, 74.482, 104.069], ['C', ' HZ ', 164.383, 75.709, 104.653], ['C', ' HZ ', 164.641, 74.161, 105.161]]
[['C', ' N ', 162.027, 74.474, 111.952], ['C', ' CA ', 161.334, 73.25, 112.348], ['C', ' C ', 160.037, 73.557, 113.081], ['C', ' O ', 159.037, 72.854, 112.926], ['C', ' CB ', 162.229, 72.402, 113.244], ['C', ' CG ', 163.412, 71.765, 112.544], ['C', ' CD ', 164.345, 71.107, 113.506], ['C', ' OE1', 164.178, 71.323, 114.683], ['C', ' OE2', 165.215, 70.385, 113.079], ['C', ' H ', 162.999, 74.617, 112.253], ['C', ' HA ', 161.096, 72.685, 111.449], ['C', ' HB ', 162.611, 73.018, 114.051], ['C', ' HB ', 161.639, 71.606, 113.696], ['C', ' HG ', 163.044, 71.018, 111.843], ['C', ' HG ', 163.945, 72.517, 111.976]]
[['C', ' N ', 160.042, 74.638, 113.848], ['C', ' CA ', 158.892, 75.067, 114.621], ['C', ' C ', 157.888, 75.9, 113.821], ['C', ' O ', 156.871, 76.323, 114.373], ['C', ' CB ', 159.373, 75.863, 115.82], ['C', ' CG ', 160.105, 75.032, 116.848], ['C', ' SD ', 160.52, 75.947, 118.339], ['C', ' CE ', 161.894, 76.959, 117.792], ['C', ' H ', 160.931, 75.141, 113.957], ['C', ' HA ', 158.373, 74.178, 114.972], ['C', ' HB ', 160.052, 76.635, 115.464], ['C', ' HB ', 158.531, 76.358, 116.302], ['C', ' HG ', 159.479, 74.188, 117.127], ['C', ' HG ', 161.022, 74.636, 116.416], ['C', ' HE ', 162.251, 77.567, 118.622], ['C', ' HE ', 162.696, 76.323, 117.436], ['C', ' HE ', 161.566, 77.601, 117.003]]
[['C', ' N ', 158.163, 76.156, 112.539], ['C', ' CA ', 157.262, 76.935, 111.704], ['C', ' C ', 157.343, 78.443, 111.912], ['C', ' O ', 156.372, 79.158, 111.661], ['C', ' H ', 159.01, 75.777, 112.106], ['C', ' HA ', 157.485, 76.709, 110.661], ['C', ' HA ', 156.242, 76.601, 111.881]]
[['C', ' N ', 158.472, 78.938, 112.389], ['C', ' CA ', 158.615, 80.356, 112.642], ['C', ' C ', 159.264, 81.049, 111.465], ['C', ' O ', 159.89, 80.39, 110.625], ['C', ' CB ', 159.485, 80.554, 113.87], ['C', ' CG ', 158.995, 79.929, 115.154], ['C', ' CD1', 160.057, 80.126, 116.199], ['C', ' CD2', 157.686, 80.576, 115.591], ['C', ' H ', 159.279, 78.33, 112.567], ['C', ' HA ', 157.63, 80.762, 112.808], ['C', ' HB ', 160.455, 80.129, 113.655], ['C', ' HB ', 159.617, 81.611, 114.046], ['C', ' HG ', 158.845, 78.857, 115.011], ['C', ' HD1', 159.736, 79.67, 117.136], ['C', ' HD1', 160.97, 79.663, 115.871], ['C', ' HD1', 160.226, 81.192, 116.35], ['C', ' HD2', 157.357, 80.124, 116.525], ['C', ' HD2', 157.835, 81.65, 115.739], ['C', ' HD2', 156.915, 80.42, 114.843]]
[['C', ' N ', 159.073, 82.362, 111.288], ['C', ' CA ', 159.806, 83.103, 110.307], ['C', ' C ', 161.23, 82.796, 110.658], ['C', ' O ', 161.615, 82.915, 111.83], ['C', ' CB ', 159.391, 84.541, 110.592], ['C', ' CG ', 158.0, 84.399, 111.187], ['C', ' CD ', 158.071, 83.136, 112.029], ['C', ' HA ', 159.542, 82.764, 109.294], ['C', ' HB ', 160.103, 85.016, 111.281], ['C', ' HB ', 159.403, 85.13, 109.664], ['C', ' HG ', 157.75, 85.288, 111.775], ['C', ' HG ', 157.249, 84.331, 110.388], ['C', ' HD ', 158.422, 83.365, 113.044], ['C', ' HD ', 157.081, 82.663, 112.019]]
[['C', ' N ', 162.013, 82.445, 109.663], ['C', ' CA ', 163.375, 82.041, 109.912], ['C', ' C ', 164.407, 82.704, 109.031], ['C', ' O ', 164.645, 82.235, 107.92], ['C', ' CB ', 163.481, 80.522, 109.778], ['C', ' OG1', 162.545, 79.91, 110.676], ['C', ' CG2', 164.868, 80.073, 110.14], ['C', ' H ', 161.64, 82.398, 108.723], ['C', ' HA ', 163.614, 82.265, 110.948], ['C', ' HB ', 163.25, 80.22, 108.757], ['C', ' HG1', 161.611, 80.127, 110.419], ['C', ' HG2', 164.935, 79.005, 110.059], ['C', ' HG2', 165.6, 80.518, 109.478], ['C', ' HG2', 165.09, 80.369, 111.157]]
[['C', ' N ', 164.918, 83.869, 109.412], ['C', ' CA ', 165.975, 84.564, 108.735], ['C', ' C ', 167.193, 83.674, 108.915], ['C', ' O ', 167.263, 82.992, 109.943], ['C', ' CB ', 166.088, 85.865, 109.516], ['C', ' CG ', 164.783, 85.963, 110.255], ['C', ' CD ', 164.406, 84.574, 110.573], ['C', ' HA ', 165.706, 84.724, 107.677], ['C', ' HB ', 166.964, 85.83, 110.18], ['C', ' HB ', 166.247, 86.707, 108.822], ['C', ' HG ', 164.896, 86.613, 111.122], ['C', ' HG ', 164.021, 86.423, 109.62], ['C', ' HD ', 164.907, 84.23, 111.491], ['C', ' HD ', 163.327, 84.546, 110.65]]
[['C', ' N ', 168.138, 83.708, 107.967], ['C', ' CA ', 169.415, 82.963, 108.005], ['C', ' C ', 170.624, 83.917, 108.036], ['C', ' O ', 170.507, 85.065, 108.469], ['C', ' OXT', 171.756, 83.423, 107.972], ['C', ' CB ', 169.493, 81.94, 106.813], ['C', ' CG ', 168.547, 80.685, 106.952], ['C', ' CD1', 167.09, 80.762, 106.676], ['C', ' CD2', 169.112, 79.364, 107.354], ['C', ' CE1', 166.232, 79.576, 106.823], ['C', ' CE2', 168.252, 78.182, 107.496], ['C', ' CZ ', 166.814, 78.292, 107.236], ['C', ' H ', 167.984, 84.304, 107.167], ['C', ' HA ', 169.462, 82.389, 108.929], ['C', ' HB ', 169.253, 82.442, 105.874], ['C', ' HB ', 170.524, 81.58, 106.704], ['C', ' HD1', 166.646, 81.712, 106.379], ['C', ' HD2', 170.181, 79.285, 107.556], ['C', ' HE1', 165.161, 79.662, 106.633], ['C', ' HE2', 168.68, 77.225, 107.802], ['C', ' HZ ', 166.184, 77.422, 107.351]]
[['C', ' N ', 188.805, 82.886, 106.132], ['C', ' CA ', 187.697, 83.853, 106.255], ['C', ' C ', 187.024, 83.727, 107.649], ['C', ' O ', 186.525, 82.648, 107.989], ['C', ' CB ', 186.627, 83.616, 105.076], ['C', ' CG1', 185.336, 84.586, 105.185], ['C', ' CG2', 187.304, 83.874, 103.626], ['C', ' H ', 189.212, 82.966, 105.211], ['C', ' H ', 189.52, 83.045, 106.827], ['C', ' H ', 188.432, 81.952, 106.25], ['C', ' HA ', 188.121, 84.857, 106.126], ['C', ' HB ', 186.256, 82.574, 105.14], ['C', ' HG1', 184.635, 84.37, 104.374], ['C', ' HG1', 184.81, 84.446, 106.132], ['C', ' HG1', 185.631, 85.601, 105.1], ['C', ' HG2', 186.568, 83.689, 102.835], ['C', ' HG2', 187.65, 84.912, 103.545], ['C', ' HG2', 188.151, 83.209, 103.46]] AA_SCO= 1.4180000000000001 CA_SCO= 1.0162
[['C', ' N ', 187.033, 84.828, 108.434], ['C', ' CA ', 186.382, 84.957, 109.731], ['C', ' C ', 184.891, 85.245, 109.466], ['C', ' O ', 184.063, 84.432, 109.882], ['C', ' CB ', 187.089, 86.018, 110.583], ['C', ' CG ', 188.247, 85.51, 111.477], ['C', ' CD1', 189.333, 84.853, 110.651], ['C', ' CD2', 188.841, 86.657, 112.193], ['C', ' H ', 187.479, 85.651, 108.065], ['C', ' HA ', 186.446, 84.012, 110.276], ['C', ' HB ', 187.531, 86.751, 109.919], ['C', ' HB ', 186.354, 86.507, 111.215], ['C', ' HG ', 187.86, 84.784, 112.196], ['C', ' HD1', 190.138, 84.518, 111.312], ['C', ' HD1', 188.937, 83.993, 110.121], ['C', ' HD1', 189.732, 85.568, 109.938], ['C', ' HD2', 189.637, 86.288, 112.822], ['C', ' HD2', 189.241, 87.368, 111.474], ['C', ' HD2', 188.107, 87.142, 112.8]] AA_SCO= 1.5272727272727273 CA_SCO= 1.0323636363636366
[['C', ' N ', 184.497, 86.314, 108.718], ['C', ' CA ', 185.232, 87.51, 108.259], ['C', ' C ', 186.08, 87.469, 106.989], ['C', ' O ', 187.196, 86.961, 106.992], ['C', ' H ', 183.509, 86.321, 108.477], ['C', ' HA ', 184.488, 88.282, 108.1], ['C', ' HA ', 185.828, 87.895, 109.073]] AA_SCO= 1.625 CA_SCO= 1.1103333333333334
[['C', ' N ', 185.643, 88.147, 105.95], ['C', ' CA ', 186.5, 88.338, 104.791], ['C', ' C ', 187.461, 89.41, 105.212], ['C', ' O ', 187.041, 90.354, 105.877], ['C', ' CB ', 185.717, 88.793, 103.545], ['C', ' OG1', 184.731, 87.811, 103.202], ['C', ' CG2', 186.671, 88.946, 102.371], ['C', ' H ', 184.709, 88.53, 105.936], ['C', ' HA ', 187.059, 87.428, 104.572], ['C', ' HB ', 185.223, 89.743, 103.748], ['C', ' HG1', 184.139, 88.174, 102.536], ['C', ' HG2', 186.106, 89.257, 101.494], ['C', ' HG2', 187.428, 89.696, 102.586], ['C', ' HG2', 187.154, 87.991, 102.171]] AA_SCO= 1.576153846153846 CA_SCO= 1.1763846153846154
[['C', ' N ', 188.74, 89.28, 104.912], ['C', ' CA ', 189.633, 90.341, 105.335], ['C', ' C ', 190.808, 90.552, 104.439], ['C', ' O ', 191.173, 89.682, 103.648], ['C', ' CB ', 190.137, 90.099, 106.745], ['C', ' CG ', 190.996, 88.904, 106.909], ['C', ' CD1', 192.354, 89.011, 106.742], ['C', ' CD2', 190.438, 87.701, 107.253], ['C', ' CE1', 193.153, 87.923, 106.909], ['C', ' CE2', 191.235, 86.601, 107.425], ['C', ' CZ ', 192.591, 86.71, 107.253], ['C', ' OH ', 193.405, 85.619, 107.434], ['C', ' H ', 189.08, 88.486, 104.386], ['C', ' HA ', 189.079, 91.27, 105.326], ['C', ' HB ', 190.712, 90.969, 107.061], ['C', ' HB ', 189.288, 89.998, 107.412], ['C', ' HD1', 192.795, 89.954, 106.484], ['C', ' HD2', 189.376, 87.626, 107.394], ['C', ' HE1', 194.23, 88.015, 106.776], ['C', ' HE2', 190.79, 85.646, 107.703], ['C', ' HH ', 192.892, 84.886, 107.786]] AA_SCO= 1.5707142857142855 CA_SCO= 1.2307857142857144
[['C', ' N ', 191.412, 91.727, 104.584], ['C', ' CA ', 192.612, 92.066, 103.866], ['C', ' C ', 193.823, 91.944, 104.791], ['C', ' O ', 194.859, 91.415, 104.386], ['C', ' CB ', 192.474, 93.475, 103.3], ['C', ' CG ', 193.592, 93.93, 102.41], ['C', ' CD ', 193.237, 95.277, 101.77], ['C', ' CE ', 194.296, 95.741, 100.785], ['C', ' NZ ', 193.934, 97.052, 100.171], ['C', ' H ', 191.04, 92.416, 105.235], ['C', ' HA ', 192.743, 91.363, 103.044], ['C', ' HB ', 191.547, 93.546, 102.738], ['C', ' HB ', 192.408, 94.185, 104.129], ['C', ' HG ', 194.505, 94.042, 103.003], ['C', ' HG ', 193.77, 93.185, 101.633], ['C', ' HD ', 192.284, 95.204, 101.239], ['C', ' HD ', 193.133, 96.036, 102.546], ['C', ' HE ', 195.25, 95.842, 101.299], ['C', ' HE ', 194.394, 94.998, 99.996], ['C', ' HZ ', 194.633, 97.349, 99.522], ['C', ' HZ ', 193.025, 97.002, 99.683], ['C', ' HZ ', 193.838, 97.758, 100.903]] AA_SCO= 1.5793333333333333 CA_SCO= 1.2348000000000001
[['C', ' N ', 193.693, 92.424, 106.034], ['C', ' CA ', 194.82, 92.351, 106.972], ['C', ' C ', 194.417, 92.315, 108.448], ['C', ' O ', 193.541, 93.067, 108.884], ['C', ' CB ', 195.771, 93.517, 106.737], ['C', ' CG ', 197.03, 93.462, 107.571], ['C', ' CD ', 197.999, 94.533, 107.233], ['C', ' OE1', 197.659, 95.42, 106.483], ['C', ' OE2', 199.094, 94.482, 107.722], ['C', ' H ', 192.804, 92.851, 106.305], ['C', ' HA ', 195.366, 91.43, 106.763], ['C', ' HB ', 196.06, 93.551, 105.686], ['C', ' HB ', 195.26, 94.449, 106.966], ['C', ' HG ', 196.763, 93.575, 108.615], ['C', ' HG ', 197.502, 92.49, 107.445]] AA_SCO= 1.5731249999999999 CA_SCO= 1.2259375000000001
[['C', ' N ', 195.078, 91.465, 109.253], ['C', ' CA ', 194.74, 91.46, 110.673], ['C', ' C ', 195.948, 91.729, 111.554], ['C', ' O ', 196.975, 91.037, 111.461], ['C', ' CB ', 194.142, 90.131, 111.126], ['C', ' CG1', 192.973, 89.816, 110.261], ['C', ' CG2', 193.676, 90.301, 112.606], ['C', ' CD1', 192.293, 88.499, 110.517], ['C', ' H ', 195.799, 90.859, 108.881], ['C', ' HA ', 194.016, 92.249, 110.868], ['C', ' HB ', 194.868, 89.333, 111.031], ['C', ' HG1', 192.316, 90.6, 110.332], ['C', ' HG1', 193.32, 89.784, 109.249], ['C', ' HG2', 193.227, 89.406, 112.974], ['C', ' HG2', 194.482, 90.546, 113.24], ['C', ' HG2', 192.962, 91.107, 112.668], ['C', ' HD1', 191.482, 88.381, 109.817], ['C', ' HD1', 193.007, 87.692, 110.386], ['C', ' HD1', 191.886, 88.464, 111.512]] AA_SCO= 1.566470588235294 CA_SCO= 1.2574117647058825
[['C', ' N ', 195.806, 92.738, 112.4], ['C', ' CA ', 196.841, 93.133, 113.346], ['C', ' C ', 196.256, 93.35, 114.717], ['C', ' O ', 195.047, 93.503, 114.844], ['C', ' CB ', 197.518, 94.426, 112.902], ['C', ' CG1', 198.153, 94.242, 111.545], ['C', ' CG2', 196.504, 95.574, 112.9], ['C', ' H ', 194.9, 93.229, 112.386], ['C', ' HA ', 197.589, 92.348, 113.41], ['C', ' HB ', 198.316, 94.646, 113.595], ['C', ' HG1', 198.662, 95.159, 111.253], ['C', ' HG1', 198.87, 93.43, 111.591], ['C', ' HG1', 197.395, 94.011, 110.813], ['C', ' HG2', 197.008, 96.479, 112.601], ['C', ' HG2', 195.696, 95.355, 112.199], ['C', ' HG2', 196.091, 95.714, 113.896]] AA_SCO= 1.5955555555555554 CA_SCO= 1.295388888888889
[['C', ' N ', 197.089, 93.4, 115.738], ['C', ' CA ', 196.605, 93.861, 117.023], ['C', ' C ', 197.104, 95.284, 117.113], ['C', ' O ', 198.147, 95.627, 116.548], ['C', ' CB ', 197.103, 93.008, 118.171], ['C', ' OG ', 198.487, 93.043, 118.271], ['C', ' H ', 198.079, 93.194, 115.595], ['C', ' HA ', 195.522, 93.875, 117.034], ['C', ' HB ', 196.664, 93.369, 119.098], ['C', ' HB ', 196.771, 91.985, 118.033], ['C', ' HG ', 198.718, 92.362, 118.916]] AA_SCO= 1.53 CA_SCO= 1.3303157894736841
[['C', ' N ', 196.401, 96.137, 117.814], ['C', ' CA ', 196.851, 97.505, 117.903], ['C', ' C ', 196.262, 98.221, 119.08], ['C', ' O ', 195.266, 97.802, 119.671], ['C', ' CB ', 196.499, 98.247, 116.631], ['C', ' H ', 195.536, 95.835, 118.256], ['C', ' HA ', 197.923, 97.504, 118.023], ['C', ' HB ', 196.866, 99.271, 116.696], ['C', ' HB ', 196.947, 97.76, 115.781], ['C', ' HB ', 195.435, 98.255, 116.51]] AA_SCO= 1.7063157894736842 CA_SCO= 1.6213684210526313
[['C', ' N ', 196.893, 99.307, 119.448], ['C', ' CA ', 196.292, 100.159, 120.442], ['C', ' C ', 196.59, 101.604, 120.178], ['C', ' O ', 197.603, 101.948, 119.565], ['C', ' CB ', 196.73, 99.823, 121.845], ['C', ' CG ', 198.148, 100.03, 122.166], ['C', ' CD ', 198.379, 99.719, 123.566], ['C', ' NE ', 199.744, 99.896, 123.901], ['C', ' CZ ', 200.294, 99.692, 125.096], ['C', ' NH1', 199.571, 99.299, 126.127], ['C', ' NH2', 201.589, 99.895, 125.205], ['C', ' H ', 197.755, 99.558, 118.953], ['C', ' HA ', 195.211, 100.031, 120.389], ['C', ' HB ', 196.148, 100.397, 122.563], ['C', ' HB ', 196.541, 98.796, 122.029], ['C', ' HG ', 198.767, 99.371, 121.561], ['C', ' HG ', 198.441, 101.067, 121.993], ['C', ' HD ', 197.784, 100.396, 124.178], ['C', ' HD ', 198.092, 98.696, 123.769], ['C', ' HE ', 200.38, 100.193, 123.152], ['C', ' HH1', 198.579, 99.143, 126.019], ['C', ' HH1', 200.006, 99.149, 127.026], ['C', ' HH2', 202.099, 100.198, 124.355], ['C', ' HH2', 202.066, 99.756, 126.081]] AA_SCO= 1.5315789473684212 CA_SCO= 1.5272105263157894
[['C', ' N ', 195.715, 102.46, 120.676], ['C', ' CA ', 195.936, 103.889, 120.617], ['C', ' C ', 197.124, 104.216, 121.475], ['C', ' O ', 197.274, 103.637, 122.553], ['C', ' CB ', 194.727, 104.657, 121.089], ['C', ' OG ', 195.005, 106.033, 121.138], ['C', ' H ', 194.887, 102.11, 121.131], ['C', ' HA ', 196.149, 104.173, 119.598], ['C', ' HB ', 193.892, 104.477, 120.409], ['C', ' HB ', 194.427, 104.309, 122.078], ['C', ' HG ', 194.141, 106.451, 121.274]] AA_SCO= 1.4578947368421054 CA_SCO= 1.5732105263157894
[['C', ' N ', 197.931, 105.165, 121.028], ['C', ' CA ', 199.112, 105.628, 121.737], ['C', ' C ', 198.808, 106.843, 122.592], ['C', ' O ', 199.673, 107.333, 123.323], ['C', ' CB ', 200.218, 105.982, 120.74], ['C', ' OG1', 199.752, 107.051, 119.9], ['C', ' CG2', 200.521, 104.76, 119.903], ['C', ' H ', 197.716, 105.572, 120.117], ['C', ' HA ', 199.466, 104.828, 122.382], ['C', ' HB ', 201.115, 106.304, 121.265], ['C', ' HG1', 200.437, 107.305, 119.226], ['C', ' HG2', 201.292, 104.992, 119.168], ['C', ' HG2', 200.865, 103.954, 120.547], ['C', ' HG2', 199.636, 104.456, 119.408]] AA_SCO= 1.704736842105263 CA_SCO= 1.6571052631578944
[['C', ' N ', 197.582, 107.342, 122.496], ['C', ' CA ', 197.169, 108.503, 123.256], ['C', ' C ', 196.66, 108.077, 124.615], ['C', ' O ', 195.625, 107.411, 124.717], ['C', ' CB ', 196.092, 109.313, 122.554], ['C', ' CG ', 195.759, 110.595, 123.346], ['C', ' OD1', 196.282, 110.718, 124.462], ['C', ' OD2', 195.043, 111.44, 122.842], ['C', ' H ', 196.909, 106.895, 121.875], ['C', ' HA ', 198.036, 109.148, 123.402], ['C', ' HB ', 196.417, 109.575, 121.545], ['C', ' HB ', 195.205, 108.709, 122.469]] AA_SCO= 1.5394736842105263 CA_SCO= 1.6610526315789471
[['C', ' N ', 197.371, 108.441, 125.661], ['C', ' CA ', 197.034, 107.997, 127.001], ['C', ' C ', 195.628, 108.413, 127.416], ['C', ' O ', 194.995, 107.716, 128.221], ['C', ' CB ', 198.037, 108.507, 128.007], ['C', ' CG ', 199.382, 107.831, 127.908], ['C', ' CD ', 200.247, 108.121, 129.073], ['C', ' NE ', 200.58, 109.54, 129.171], ['C', ' CZ ', 201.606, 110.151, 128.532], ['C', ' NH1', 202.398, 109.473, 127.722], ['C', ' NH2', 201.811, 111.444, 128.718], ['C', ' H ', 198.182, 109.025, 125.5], ['C', ' HA ', 197.089, 106.913, 127.015], ['C', ' HB ', 198.183, 109.576, 127.864], ['C', ' HB ', 197.656, 108.356, 129.016], ['C', ' HG ', 199.233, 106.752, 127.858], ['C', ' HG ', 199.883, 108.163, 127.0], ['C', ' HD ', 199.716, 107.837, 129.982], ['C', ' HD ', 201.166, 107.544, 129.007], ['C', ' HE ', 200.009, 110.109, 129.784], ['C', ' HH1', 202.249, 108.487, 127.567], ['C', ' HH1', 203.16, 109.942, 127.25], ['C', ' HH2', 201.207, 111.969, 129.336], ['C', ' HH2', 202.572, 111.911, 128.246]] AA_SCO= 1.5794736842105264 CA_SCO= 1.6650526315789471
[['C', ' N ', 195.133, 109.544, 126.894], ['C', ' CA ', 193.803, 110.0, 127.262], ['C', ' C ', 192.723, 109.088, 126.708], ['C', ' O ', 191.583, 109.141, 127.15], ['C', ' CB ', 193.527, 111.423, 126.797], ['C', ' CG ', 194.339, 112.477, 127.507], ['C', ' CD ', 193.961, 113.887, 127.116], ['C', ' OE1', 193.054, 114.067, 126.312], ['C', ' OE2', 194.578, 114.793, 127.62], ['C', ' H ', 195.681, 110.105, 126.216], ['C', ' HA ', 193.736, 109.981, 128.345], ['C', ' HB ', 193.748, 111.497, 125.728], ['C', ' HB ', 192.471, 111.653, 126.931], ['C', ' HG ', 194.204, 112.358, 128.58], ['C', ' HG ', 195.393, 112.312, 127.28]] AA_SCO= 1.6310526315789473 CA_SCO= 1.6653157894736839
[['C', ' N ', 193.058, 108.311, 125.694], ['C', ' CA ', 192.126, 107.398, 125.088], ['C', ' C ', 192.331, 106.036, 125.715], ['C', ' O ', 191.377, 105.339, 126.068], ['C', ' CB ', 192.286, 107.345, 123.567], ['C', ' CG1', 191.947, 108.732, 122.998], ['C', ' CG2', 191.387, 106.268, 122.992], ['C', ' CD1', 192.243, 108.935, 121.528], ['C', ' H ', 194.026, 108.301, 125.372], ['C', ' HA ', 191.112, 107.728, 125.312], ['C', ' HB ', 193.325, 107.129, 123.319], ['C', ' HG1', 190.891, 108.924, 123.167], ['C', ' HG1', 192.53, 109.468, 123.548], ['C', ' HG2', 191.493, 106.22, 121.915], ['C', ' HG2', 191.658, 105.312, 123.408], ['C', ' HG2', 190.35, 106.492, 123.246], ['C', ' HD1', 191.975, 109.953, 121.248], ['C', ' HD1', 193.291, 108.781, 121.329], ['C', ' HD1', 191.665, 108.249, 120.93]] AA_SCO= 1.6384210526315788 CA_SCO= 1.657736842105263
[['C', ' N ', 193.59, 105.659, 125.916], ['C', ' CA ', 193.912, 104.344, 126.451], ['C', ' C ', 193.25, 104.127, 127.798], ['C', ' O ', 192.786, 103.03, 128.098], ['C', ' CB ', 195.412, 104.217, 126.688], ['C', ' CG ', 196.285, 104.17, 125.473], ['C', ' CD ', 197.746, 104.228, 125.863], ['C', ' OE1', 198.059, 104.481, 127.036], ['C', ' NE2', 198.624, 104.015, 124.913], ['C', ' H ', 194.346, 106.28, 125.623], ['C', ' HA ', 193.562, 103.581, 125.758], ['C', ' HB ', 195.733, 105.048, 127.306], ['C', ' HB ', 195.602, 103.31, 127.257], ['C', ' HG ', 196.114, 103.232, 124.945], ['C', ' HG ', 196.068, 105.001, 124.816], ['C', ' HE2', 199.603, 104.046, 125.107], ['C', ' HE2', 198.288, 103.829, 123.972]] AA_SCO= 1.6521052631578945 CA_SCO= 1.6583157894736842
[['C', ' N ', 193.173, 105.18, 128.605], ['C', ' CA ', 192.568, 105.071, 129.918], ['C', ' C ', 191.034, 104.959, 129.882], ['C', ' O ', 190.423, 104.642, 130.911], ['C', ' CB ', 192.945, 106.267, 130.793], ['C', ' CG ', 192.26, 107.565, 130.421], ['C', ' CD ', 192.731, 108.709, 131.289], ['C', ' CE ', 191.943, 109.986, 131.004], ['C', ' NZ ', 192.426, 111.131, 131.833], ['C', ' H ', 193.61, 106.061, 128.317], ['C', ' HA ', 192.956, 104.168, 130.388], ['C', ' HB ', 192.711, 106.046, 131.832], ['C', ' HB ', 194.021, 106.435, 130.723], ['C', ' HG ', 192.445, 107.795, 129.374], ['C', ' HG ', 191.194, 107.462, 130.571], ['C', ' HD ', 192.618, 108.44, 132.338], ['C', ' HD ', 193.788, 108.895, 131.087], ['C', ' HE ', 192.039, 110.242, 129.952], ['C', ' HE ', 190.891, 109.81, 131.225], ['C', ' HZ ', 191.881, 111.955, 131.62], ['C', ' HZ ', 192.327, 110.908, 132.816], ['C', ' HZ ', 193.399, 111.307, 131.625]] AA_SCO= 1.761578947368421 CA_SCO= 1.6596315789473683
[['C', ' N ', 190.395, 105.304, 128.757], ['C', ' CA ', 188.936, 105.317, 128.685], ['C', ' C ', 188.328, 104.139, 127.934], ['C', ' O ', 187.305, 103.586, 128.346], ['C', ' CB ', 188.487, 106.574, 127.956], ['C', ' CG ', 188.878, 107.911, 128.553], ['C', ' CD1', 188.408, 109.014, 127.609], ['C', ' CD2', 188.274, 108.078, 129.935], ['C', ' H ', 190.934, 105.503, 127.919], ['C', ' HA ', 188.539, 105.295, 129.694], ['C', ' HB ', 188.878, 106.539, 126.937], ['C', ' HB ', 187.413, 106.551, 127.916], ['C', ' HG ', 189.955, 107.973, 128.62], ['C', ' HD1', 188.703, 109.982, 128.01], ['C', ' HD1', 188.871, 108.877, 126.63], ['C', ' HD1', 187.321, 108.978, 127.505], ['C', ' HD2', 188.564, 109.047, 130.333], ['C', ' HD2', 187.186, 108.024, 129.865], ['C', ' HD2', 188.633, 107.303, 130.603]] AA_SCO= 1.7842105263157895 CA_SCO= 1.691315789473684
[['C', ' N ', 188.938, 103.761, 126.824], ['C', ' CA ', 188.406, 102.677, 126.014], ['C', ' C ', 188.61, 101.394, 126.77], ['C', ' O ', 189.548, 101.297, 127.553], ['C', ' CB ', 189.074, 102.62, 124.674], ['C', ' H ', 189.79, 104.251, 126.538], ['C', ' HA ', 187.337, 102.834, 125.879], ['C', ' HB ', 188.657, 101.795, 124.1], ['C', ' HB ', 188.906, 103.563, 124.148], ['C', ' HB ', 190.142, 102.463, 124.823]] AA_SCO= 1.7515789473684207 CA_SCO= 1.686157894736842
[['C', ' N ', 187.781, 100.381, 126.548], ['C', ' CA ', 188.026, 99.179, 127.325], ['C', ' C ', 189.342, 98.496, 126.965], ['C', ' O ', 190.062, 98.051, 127.855], ['C', ' CB ', 186.849, 98.211, 127.172], ['C', ' CG ', 186.947, 96.942, 128.011], ['C', ' CD ', 187.026, 97.223, 129.493], ['C', ' OE1', 186.362, 98.126, 130.012], ['C', ' NE2', 187.847, 96.444, 130.185], ['C', ' H ', 187.013, 100.449, 125.897], ['C', ' HA ', 188.084, 99.469, 128.375], ['C', ' HB ', 185.918, 98.716, 127.432], ['C', ' HB ', 186.773, 97.903, 126.133], ['C', ' HG ', 186.057, 96.335, 127.843], ['C', ' HG ', 187.84, 96.375, 127.721], ['C', ' HE2', 187.954, 96.569, 131.169], ['C', ' HE2', 188.363, 95.71, 129.711]] AA_SCO= 1.8321052631578945 CA_SCO= 1.1714736842105264
[['C', ' N ', 189.662, 98.436, 125.679], ['C', ' CA ', 190.907, 97.866, 125.175], ['C', ' C ', 191.171, 98.502, 123.847], ['C', ' O ', 190.22, 98.643, 123.083], ['C', ' CB ', 190.827, 96.348, 124.977], ['C', ' CG ', 190.786, 95.529, 126.259], ['C', ' OD1', 191.824, 95.389, 126.928], ['C', ' OD2', 189.735, 94.995, 126.547], ['C', ' H ', 189.017, 98.828, 125.013], ['C', ' HA ', 191.724, 98.111, 125.854], ['C', ' HB ', 189.945, 96.123, 124.396], ['C', ' HB ', 191.685, 96.02, 124.393]] AA_SCO= 1.8863157894736844 CA_SCO= 1.1378947368421053
[['C', ' N ', 192.418, 98.861, 123.543], ['C', ' CA ', 192.765, 99.371, 122.235], ['C', ' C ', 191.722, 100.337, 121.746], ['C', ' O ', 190.901, 99.988, 120.896], ['C', ' H ', 193.182, 98.752, 124.198], ['C', ' HA ', 193.731, 99.862, 122.295], ['C', ' HA ', 192.872, 98.546, 121.536]] AA_SCO= 1.9752631578947366 CA_SCO= 1.173315789473684
[['C', ' N ', 191.754, 101.575, 122.238], ['C', ' CA ', 190.746, 102.575, 121.881], ['C', ' C ', 190.86, 103.109, 120.47], ['C', ' O ', 191.044, 104.305, 120.249], ['C', ' H ', 192.46, 101.805, 122.921], ['C', ' HA ', 189.759, 102.131, 121.999], ['C', ' HA ', 190.802, 103.398, 122.582]] AA_SCO= 2.041052631578947 CA_SCO= 1.2193684210526314
[['C', ' N ', 190.673, 102.206, 119.531], ['C', ' CA ', 190.746, 102.386, 118.107], ['C', ' C ', 189.402, 102.899, 117.66], ['C', ' O ', 189.302, 103.865, 116.909], ['C', ' CB ', 191.159, 101.076, 117.442], ['C', ' CG1', 192.57, 100.781, 117.946], ['C', ' CG2', 191.103, 101.184, 115.899], ['C', ' CD1', 193.07, 99.511, 117.645], ['C', ' H ', 190.491, 101.272, 119.871], ['C', ' HA ', 191.496, 103.137, 117.881], ['C', ' HB ', 190.503, 100.272, 117.783], ['C', ' HG1', 193.242, 101.471, 117.529], ['C', ' HG1', 192.588, 100.881, 119.021], ['C', ' HG2', 191.409, 100.251, 115.436], ['C', ' HG2', 190.088, 101.412, 115.573], ['C', ' HG2', 191.772, 101.973, 115.576], ['C', ' HD1', 194.049, 99.434, 118.055], ['C', ' HD1', 192.442, 98.743, 118.066], ['C', ' HD1', 193.118, 99.408, 116.6]] AA_SCO= 2.096842105263158 CA_SCO= 1.2303684210526316
[['C', ' N ', 188.347, 102.362, 118.225], ['C', ' CA ', 187.022, 102.826, 117.863], ['C', ' C ', 186.888, 104.316, 118.251], ['C', ' O ', 186.218, 105.08, 117.574], ['C', ' CB ', 185.965, 101.934, 118.552], ['C', ' CG1', 186.111, 100.505, 118.061], ['C', ' CG2', 186.121, 101.965, 120.07], ['C', ' H ', 188.477, 101.594, 118.861], ['C', ' HA ', 186.901, 102.738, 116.783], ['C', ' HB ', 184.984, 102.277, 118.291], ['C', ' HG1', 185.361, 99.887, 118.536], ['C', ' HG1', 185.976, 100.467, 117.001], ['C', ' HG1', 187.094, 100.114, 118.306], ['C', ' HG2', 185.359, 101.325, 120.515], ['C', ' HG2', 187.105, 101.61, 120.369], ['C', ' HG2', 185.977, 102.952, 120.413]] AA_SCO= 2.065263157894737 CA_SCO= 1.231736842105263
[['C', ' N ', 187.634, 104.724, 119.28], ['C', ' CA ', 187.781, 106.08, 119.802], ['C', ' C ', 189.077, 106.763, 119.378], ['C', ' O ', 189.414, 107.838, 119.87], ['C', ' CB ', 187.848, 106.017, 121.317], ['C', ' OG1', 188.884, 105.065, 121.671], ['C', ' CG2', 186.57, 105.632, 121.939], ['C', ' H ', 188.118, 104.01, 119.814], ['C', ' HA ', 186.935, 106.681, 119.468], ['C', ' HB ', 188.133, 106.998, 121.698], ['C', ' HG1', 189.744, 105.225, 121.165], ['C', ' HG2', 186.708, 105.604, 122.998], ['C', ' HG2', 185.8, 106.363, 121.685], ['C', ' HG2', 186.269, 104.678, 121.605]] AA_SCO= 2.1521052631578947 CA_SCO= 1.2165263157894735
[['C', ' N ', 189.839, 106.097, 118.542], ['C', ' CA ', 191.154, 106.514, 118.089], ['C', ' C ', 191.111, 106.833, 116.623], ['C', ' O ', 191.465, 107.927, 116.195], ['C', ' H ', 189.467, 105.241, 118.156], ['C', ' HA ', 191.483, 107.385, 118.651], ['C', ' HA ', 191.872, 105.716, 118.276]] AA_SCO= 2.2005263157894737 CA_SCO= 1.2128947368421055
[['C', ' N ', 190.783, 105.813, 115.852], ['C', ' CA ', 190.729, 105.82, 114.421], ['C', ' C ', 189.594, 106.668, 114.008], ['C', ' O ', 189.695, 107.434, 113.06], ['C', ' CB ', 190.487, 104.405, 113.911], ['C', ' CG ', 190.497, 104.173, 112.425], ['C', ' CD1', 191.869, 104.562, 111.861], ['C', ' CD2', 190.168, 102.702, 112.18], ['C', ' H ', 190.511, 104.959, 116.306], ['C', ' HA ', 191.658, 106.231, 114.045], ['C', ' HB ', 191.242, 103.772, 114.33], ['C', ' HB ', 189.52, 104.068, 114.288], ['C', ' HG ', 189.744, 104.793, 111.93], ['C', ' HD1', 191.88, 104.375, 110.818], ['C', ' HD1', 192.079, 105.612, 112.018], ['C', ' HD1', 192.638, 103.972, 112.335], ['C', ' HD2', 190.166, 102.495, 111.113], ['C', ' HD2', 190.902, 102.07, 112.665], ['C', ' HD2', 189.181, 102.482, 112.592]] AA_SCO= 2.4147368421052633 CA_SCO= 1.2667368421052634
[['C', ' N ', 188.505, 106.551, 114.739], ['C', ' CA ', 187.356, 107.34, 114.376], ['C', ' C ', 187.667, 108.8, 114.663], ['C', ' O ', 187.318, 109.676, 113.874], ['C', ' CB ', 186.134, 106.855, 115.13], ['C', ' CG ', 184.779, 107.461, 114.8], ['C', ' CD1', 184.446, 107.272, 113.311], ['C', ' CD2', 183.757, 106.728, 115.651], ['C', ' H ', 188.507, 105.868, 115.503], ['C', ' HA ', 187.194, 107.219, 113.309], ['C', ' HB ', 186.061, 105.772, 115.018], ['C', ' HB ', 186.307, 107.07, 116.183], ['C', ' HG ', 184.768, 108.527, 115.033], ['C', ' HD1', 183.48, 107.673, 113.125], ['C', ' HD1', 185.165, 107.789, 112.682], ['C', ' HD1', 184.446, 106.208, 113.065], ['C', ' HD2', 182.762, 107.101, 115.476], ['C', ' HD2', 183.794, 105.673, 115.398], ['C', ' HD2', 184.006, 106.852, 116.704]] AA_SCO= 2.3036842105263164 CA_SCO= 1.2675789473684211
[['C', ' N ', 188.332, 109.066, 115.788], ['C', ' CA ', 188.703, 110.429, 116.132], ['C', ' C ', 189.726, 110.953, 115.134], ['C', ' O ', 189.683, 112.12, 114.752], ['C', ' CB ', 189.237, 110.489, 117.538], ['C', ' H ', 188.586, 108.298, 116.393], ['C', ' HA ', 187.821, 111.056, 116.053], ['C', ' HB ', 189.495, 111.516, 117.783], ['C', ' HB ', 188.486, 110.125, 118.237], ['C', ' HB ', 190.128, 109.863, 117.615]] AA_SCO= 2.1300000000000003 CA_SCO= 1.2684210526315791
[['C', ' N ', 190.628, 110.081, 114.689], ['C', ' CA ', 191.615, 110.432, 113.693], ['C', ' C ', 190.963, 110.819, 112.409], ['C', ' O ', 191.348, 111.798, 111.796], ['C', ' CB ', 192.586, 109.301, 113.436], ['C', ' CG ', 193.503, 109.567, 112.286], ['C', ' CD1', 194.419, 110.575, 112.373], ['C', ' CD2', 193.459, 108.768, 111.158], ['C', ' CE1', 195.284, 110.809, 111.361], ['C', ' CE2', 194.351, 108.997, 110.127], ['C', ' CZ ', 195.259, 110.029, 110.239], ['C', ' OH ', 196.185, 110.286, 109.263], ['C', ' H ', 190.663, 109.145, 115.085], ['C', ' HA ', 192.171, 111.296, 114.057], ['C', ' HB ', 193.176, 109.11, 114.325], ['C', ' HB ', 192.036, 108.403, 113.219], ['C', ' HD1', 194.454, 111.2, 113.258], ['C', ' HD2', 192.736, 107.953, 111.087], ['C', ' HE1', 196.011, 111.615, 111.444], ['C', ' HE2', 194.337, 108.364, 109.238], ['C', ' HH ', 196.496, 109.449, 108.862]] AA_SCO= 2.2815789473684216 CA_SCO= 1.2657368421052635
[['C', ' N ', 190.019, 110.01, 111.96], ['C', ' CA ', 189.301, 110.271, 110.741], ['C', ' C ', 188.511, 111.573, 110.844], ['C', ' O ', 188.4, 112.337, 109.877], ['C', ' CB ', 188.39, 109.104, 110.459], ['C', ' H ', 189.799, 109.167, 112.488], ['C', ' HA ', 190.028, 110.375, 109.939], ['C', ' HB ', 187.894, 109.25, 109.55], ['C', ' HB ', 188.982, 108.203, 110.4], ['C', ' HB ', 187.669, 109.004, 111.267]] AA_SCO= 2.251052631578948 CA_SCO= 1.3092105263157898
[['C', ' N ', 187.988, 111.86, 112.038], ['C', ' CA ', 187.25, 113.09, 112.247], ['C', ' C ', 188.223, 114.258, 112.047], ['C', ' O ', 187.936, 115.252, 111.358], ['C', ' CB ', 186.643, 113.071, 113.66], ['C', ' CG ', 185.772, 114.238, 114.119], ['C', ' CD1', 184.57, 114.371, 113.232], ['C', ' CD2', 185.329, 113.969, 115.544], ['C', ' H ', 188.044, 111.169, 112.79], ['C', ' HA ', 186.47, 113.139, 111.522], ['C', ' HB ', 186.065, 112.154, 113.766], ['C', ' HB ', 187.46, 113.022, 114.36], ['C', ' HG ', 186.341, 115.17, 114.077], ['C', ' HD1', 183.942, 115.197, 113.576], ['C', ' HD1', 184.879, 114.575, 112.22], ['C', ' HD1', 184.005, 113.447, 113.261], ['C', ' HD2', 184.716, 114.786, 115.873], ['C', ' HD2', 184.754, 113.048, 115.586], ['C', ' HD2', 186.206, 113.879, 116.184]] AA_SCO= 2.2221052631578946 CA_SCO= 1.3130000000000002
[['C', ' N ', 189.411, 114.127, 112.615], ['C', ' CA ', 190.423, 115.12, 112.381], ['C', ' C ', 190.8, 115.031, 110.915], ['C', ' O ', 190.71, 113.984, 110.291], ['C', ' CB ', 191.642, 114.918, 113.268], ['C', ' CG ', 191.412, 115.309, 114.723], ['C', ' OD1', 190.44, 115.972, 115.026], ['C', ' OD2', 192.236, 114.952, 115.528], ['C', ' H ', 189.601, 113.333, 113.234], ['C', ' HA ', 190.008, 116.107, 112.577], ['C', ' HB ', 191.931, 113.867, 113.232], ['C', ' HB ', 192.477, 115.496, 112.873]] AA_SCO= 2.228947368421052 CA_SCO= 1.3190526315789475
[['C', ' N ', 191.166, 116.14, 110.33], ['C', ' CA ', 191.566, 116.189, 108.927], ['C', ' C ', 190.422, 115.917, 107.927], ['C', ' O ', 190.668, 115.912, 106.72], ['C', ' CB ', 192.725, 115.219, 108.638], ['C', ' CG ', 193.918, 115.349, 109.586], ['C', ' CD ', 194.551, 116.704, 109.554], ['C', ' OE1', 194.453, 117.366, 108.551], ['C', ' OE2', 195.123, 117.088, 110.545], ['C', ' H ', 191.202, 116.989, 110.876], ['C', ' HA ', 191.933, 117.198, 108.728], ['C', ' HB ', 192.387, 114.187, 108.636], ['C', ' HB ', 193.101, 115.419, 107.636], ['C', ' HG ', 193.612, 115.123, 110.601], ['C', ' HG ', 194.66, 114.606, 109.298]] AA_SCO= 2.2410526315789467 CA_SCO= 1.3190526315789475
[['C', ' N ', 189.172, 115.784, 108.395], ['C', ' CA ', 188.029, 115.729, 107.491], ['C', ' C ', 187.682, 114.438, 106.747], ['C', ' O ', 187.07, 114.515, 105.676], ['C', ' H ', 188.981, 115.737, 109.404], ['C', ' HA ', 187.151, 116.006, 108.078], ['C', ' HA ', 188.145, 116.524, 106.758]] AA_SCO= 2.282631578947368 CA_SCO= 1.2978947368421054
[['C', ' N ', 188.071, 113.267, 107.234], ['C', ' CA ', 187.67, 112.059, 106.518], ['C', ' C ', 186.216, 111.855, 106.899], ['C', ' O ', 185.366, 111.497, 106.085], ['C', ' CB ', 188.5, 110.838, 106.916], ['C', ' CG1', 190.012, 111.083, 106.612], ['C', ' CG2', 187.947, 109.569, 106.24], ['C', ' CD1', 190.373, 111.389, 105.177], ['C', ' H ', 188.584, 113.205, 108.12], ['C', ' HA ', 187.721, 112.218, 105.446], ['C', ' HB ', 188.431, 110.721, 107.964], ['C', ' HG1', 190.348, 111.919, 107.229], ['C', ' HG1', 190.566, 110.208, 106.905], ['C', ' HG2', 188.513, 108.707, 106.551], ['C', ' HG2', 186.907, 109.417, 106.514], ['C', ' HG2', 188.007, 109.667, 105.16], ['C', ' HD1', 191.451, 111.537, 105.108], ['C', ' HD1', 190.087, 110.563, 104.532], ['C', ' HD1', 189.873, 112.298, 104.848]] AA_SCO= 2.1536842105263156 CA_SCO= 1.264526315789474
[['C', ' N ', 185.991, 112.043, 108.182], ['C', ' CA ', 184.724, 111.955, 108.859], ['C', ' C ', 184.383, 113.342, 109.37], ['C', ' O ', 185.232, 114.057, 109.869], ['C', ' CB ', 184.825, 110.86, 109.942], ['C', ' CG1', 185.13, 109.509, 109.254], ['C', ' CG2', 183.665, 110.795, 110.835], ['C', ' CD1', 184.098, 108.985, 108.306], ['C', ' H ', 186.807, 112.301, 108.742], ['C', ' HA ', 183.95, 111.695, 108.147], ['C', ' HB ', 185.683, 111.074, 110.552], ['C', ' HG1', 186.007, 109.625, 108.679], ['C', ' HG1', 185.299, 108.754, 110.019], ['C', ' HG2', 183.819, 110.02, 111.579], ['C', ' HG2', 183.552, 111.741, 111.337], ['C', ' HG2', 182.776, 110.577, 110.261], ['C', ' HD1', 184.449, 108.066, 107.881], ['C', ' HD1', 183.185, 108.807, 108.817], ['C', ' HD1', 183.924, 109.675, 107.499]] AA_SCO= 2.1978947368421053 CA_SCO= 1.2572631578947369
[['C', ' N ', 183.168, 113.775, 109.149], ['C', ' CA ', 182.722, 115.088, 109.604], ['C', ' C ', 181.976, 115.018, 110.934], ['C', ' O ', 181.636, 116.04, 111.525], ['C', ' CB ', 181.898, 115.736, 108.51], ['C', ' CG ', 182.679, 116.112, 107.299], ['C', ' CD ', 181.8, 116.567, 106.183], ['C', ' OE1', 180.589, 116.585, 106.363], ['C', ' OE2', 182.332, 116.936, 105.159], ['C', ' H ', 182.519, 113.138, 108.687], ['C', ' HA ', 183.603, 115.71, 109.758], ['C', ' HB ', 181.174, 115.017, 108.148], ['C', ' HB ', 181.366, 116.61, 108.89], ['C', ' HG ', 183.351, 116.924, 107.566], ['C', ' HG ', 183.291, 115.28, 106.986]] AA_SCO= 2.115263157894737 CA_SCO= 1.7584736842105264
[['C', ' N ', 181.751, 113.802, 111.393], ['C', ' CA ', 181.066, 113.491, 112.638], ['C', ' C ', 180.801, 111.998, 112.659], ['C', ' O ', 180.844, 111.343, 111.616], ['C', ' H ', 182.084, 113.034, 110.831], ['C', ' HA ', 181.689, 113.771, 113.484], ['C', ' HA ', 180.14, 114.048, 112.719]] AA_SCO= 2.107894736842106 CA_SCO= 1.781947368421053
[['C', ' N ', 180.427, 111.465, 113.8], ['C', ' CA ', 180.177, 110.034, 113.86], ['C', ' C ', 179.119, 109.674, 114.86], ['C', ' O ', 178.953, 110.341, 115.874], ['C', ' CB ', 181.45, 109.322, 114.201], ['C', ' H ', 180.372, 112.077, 114.619], ['C', ' HA ', 179.825, 109.716, 112.885], ['C', ' HB ', 181.26, 108.256, 114.211], ['C', ' HB ', 182.203, 109.558, 113.458], ['C', ' HB ', 181.793, 109.637, 115.174]] AA_SCO= 1.9831578947368425 CA_SCO= 1.7812631578947369
[['C', ' N ', 178.421, 108.587, 114.599], ['C', ' CA ', 177.4, 108.131, 115.514], ['C', ' C ', 177.88, 107.022, 116.398], ['C', ' O ', 178.205, 105.909, 115.961], ['C', ' CB ', 176.147, 107.729, 114.752], ['C', ' CG1', 175.136, 107.18, 115.681], ['C', ' CG2', 175.558, 108.985, 114.087], ['C', ' H ', 178.637, 108.062, 113.748], ['C', ' HA ', 177.127, 108.961, 116.157], ['C', ' HB ', 176.389, 106.968, 114.01], ['C', ' HG1', 174.284, 106.923, 115.085], ['C', ' HG1', 175.501, 106.284, 116.183], ['C', ' HG1', 174.873, 107.929, 116.431], ['C', ' HG2', 174.65, 108.726, 113.557], ['C', ' HG2', 175.326, 109.711, 114.857], ['C', ' HG2', 176.279, 109.41, 113.394]] AA_SCO= 1.912105263157895 CA_SCO= 1.759368421052632
[['C', ' N ', 177.873, 107.356, 117.673], ['C', ' CA ', 178.376, 106.523, 118.732], ['C', ' C ', 177.369, 106.387, 119.848], ['C', ' O ', 176.417, 107.162, 119.932], ['C', ' CB ', 179.688, 107.117, 119.272], ['C', ' CG1', 180.718, 107.189, 118.162], ['C', ' CG2', 179.44, 108.519, 119.831], ['C', ' H ', 177.48, 108.277, 117.897], ['C', ' HA ', 178.559, 105.541, 118.329], ['C', ' HB ', 180.079, 106.465, 120.053], ['C', ' HG1', 181.63, 107.574, 118.567], ['C', ' HG1', 180.901, 106.205, 117.762], ['C', ' HG1', 180.373, 107.842, 117.363], ['C', ' HG2', 180.368, 108.937, 120.214], ['C', ' HG2', 179.057, 109.17, 119.041], ['C', ' HG2', 178.711, 108.473, 120.642]] AA_SCO= 1.9073684210526316 CA_SCO= 1.736842105263158
[['C', ' N ', 177.574, 105.404, 120.709], ['C', ' CA ', 176.706, 105.242, 121.862], ['C', ' C ', 177.26, 106.033, 123.024], ['C', ' O ', 178.273, 105.641, 123.611], ['C', ' CB ', 176.605, 103.781, 122.244], ['C', ' H ', 178.359, 104.783, 120.578], ['C', ' HA ', 175.717, 105.628, 121.618], ['C', ' HB ', 175.965, 103.688, 123.092], ['C', ' HB ', 176.207, 103.211, 121.422], ['C', ' HB ', 177.592, 103.406, 122.494]] AA_SCO= 2.005789473684211 CA_SCO= 1.734421052631579
[['C', ' N ', 176.671, 107.176, 123.311], ['C', ' CA ', 177.206, 108.052, 124.325], ['C', ' C ', 176.522, 107.798, 125.645], ['C', ' O ', 175.783, 106.822, 125.785], ['C', ' H ', 175.812, 107.461, 122.827], ['C', ' HA ', 178.273, 107.879, 124.41], ['C', ' HA ', 177.058, 109.084, 124.015]] AA_SCO= 2.0352631578947373 CA_SCO= 1.749
[['C', ' N ', 176.784, 108.627, 126.656], ['C', ' CA ', 176.197, 108.556, 127.976], ['C', ' C ', 174.694, 108.724, 127.87], ['C', ' O ', 174.235, 109.527, 127.061], ['C', ' CB ', 176.835, 109.749, 128.69], ['C', ' CG ', 178.114, 110.024, 127.916], ['C', ' CD ', 177.767, 109.709, 126.488], ['C', ' HA ', 176.457, 107.599, 128.453], ['C', ' HB ', 176.137, 110.602, 128.69], ['C', ' HB ', 177.023, 109.495, 129.742], ['C', ' HG ', 178.423, 111.073, 128.054], ['C', ' HG ', 178.944, 109.402, 128.294], ['C', ' HD ', 177.301, 110.579, 126.0], ['C', ' HD ', 178.68, 109.384, 125.98]] AA_SCO= 2.0447368421052636 CA_SCO= 1.7526315789473683
[['C', ' N ', 173.94, 108.006, 128.694], ['C', ' CA ', 172.485, 108.122, 128.692], ['C', ' C ', 171.957, 108.879, 129.909], ['C', ' O ', 172.701, 109.564, 130.614], ['C', ' H ', 174.366, 107.349, 129.338], ['C', ' HA ', 172.162, 108.635, 127.791], ['C', ' HA ', 172.047, 107.122, 128.661]] AA_SCO= 2.083157894736842 CA_SCO= 1.7972105263157894
[['C', ' N ', 170.651, 108.73, 130.163], ['C', ' CA ', 169.944, 109.382, 131.274], ['C', ' C ', 170.092, 108.602, 132.577], ['C', ' O ', 169.679, 109.052, 133.647], ['C', ' CB ', 168.455, 109.527, 130.942], ['C', ' CG ', 167.624, 108.221, 131.032], ['C', ' CD ', 167.72, 107.353, 129.819], ['C', ' OE1', 168.604, 107.567, 129.026], ['C', ' OE2', 166.923, 106.451, 129.684], ['C', ' H ', 170.095, 108.152, 129.525], ['C', ' HA ', 170.374, 110.373, 131.42], ['C', ' HB ', 168.006, 110.247, 131.626], ['C', ' HB ', 168.346, 109.926, 129.934], ['C', ' HG ', 167.9, 107.64, 131.904], ['C', ' HG ', 166.582, 108.508, 131.162]] AA_SCO= 2.2321052631578944 CA_SCO= 1.798315789473684
[['C', ' N ', 170.639, 107.415, 132.445], ['C', ' CA ', 170.825, 106.43, 133.49], ['C', ' C ', 172.232, 105.892, 133.362], ['C', ' O ', 172.826, 105.981, 132.291], ['C', ' CB ', 169.765, 105.328, 133.364], ['C', ' CG ', 169.844, 104.196, 134.385], ['C', ' CD ', 169.739, 104.649, 135.814], ['C', ' OE1', 168.684, 104.54, 136.384], ['C', ' OE2', 170.735, 105.122, 136.334], ['C', ' H ', 170.944, 107.182, 131.512], ['C', ' HA ', 170.728, 106.912, 134.464], ['C', ' HB ', 168.775, 105.774, 133.443], ['C', ' HB ', 169.834, 104.879, 132.378], ['C', ' HG ', 169.019, 103.512, 134.186], ['C', ' HG ', 170.757, 103.633, 134.237]] AA_SCO= 2.3894736842105258 CA_SCO= 1.798
[['C', ' N ', 172.771, 105.362, 134.439], ['C', ' CA ', 174.112, 104.823, 134.403], ['C', ' C ', 174.173, 103.613, 133.513], ['C', ' O ', 173.265, 102.781, 133.523], ['C', ' CB ', 174.545, 104.433, 135.805], ['C', ' CG ', 174.822, 105.582, 136.633], ['C', ' CD1', 173.855, 106.09, 137.465], ['C', ' CD2', 176.06, 106.178, 136.597], ['C', ' CE1', 174.119, 107.184, 138.246], ['C', ' CE2', 176.329, 107.269, 137.377], ['C', ' CZ ', 175.355, 107.775, 138.202], ['C', ' H ', 172.205, 105.325, 135.293], ['C', ' HA ', 174.784, 105.585, 134.011], ['C', ' HB ', 173.762, 103.842, 136.284], ['C', ' HB ', 175.435, 103.828, 135.76], ['C', ' HD1', 172.866, 105.619, 137.503], ['C', ' HD2', 176.834, 105.773, 135.942], ['C', ' HE1', 173.344, 107.581, 138.901], ['C', ' HE2', 177.315, 107.737, 137.344], ['C', ' HZ ', 175.567, 108.643, 138.825]] AA_SCO= 2.2942105263157893 CA_SCO= 1.7997894736842104
[['C', ' N ', 175.25, 103.518, 132.731], ['C', ' CA ', 175.542, 102.406, 131.818], ['C', ' C ', 174.626, 102.265, 130.611], ['C', ' O ', 175.101, 101.962, 129.521], ['C', ' CB ', 175.695, 101.142, 132.633], ['C', ' CG ', 176.967, 101.261, 133.303], ['C', ' CD1', 177.227, 101.652, 134.565], ['C', ' CD2', 178.22, 100.996, 132.705], ['C', ' NE1', 178.565, 101.683, 134.764], ['C', ' CE2', 179.183, 101.28, 133.642], ['C', ' CE3', 178.599, 100.548, 131.459], ['C', ' CZ2', 180.504, 101.14, 133.378], ['C', ' CZ3', 179.931, 100.398, 131.189], ['C', ' CH2', 180.862, 100.691, 132.128], ['C', ' H ', 175.923, 104.271, 132.774], ['C', ' HA ', 176.531, 102.605, 131.411], ['C', ' HB ', 174.91, 101.036, 133.362], ['C', ' HB ', 175.694, 100.264, 131.993], ['C', ' HD1', 176.486, 101.927, 135.301], ['C', ' HE1', 179.081, 101.967, 135.628], ['C', ' HE3', 177.85, 100.313, 130.713], ['C', ' HZ2', 181.252, 101.371, 134.119], ['C', ' HZ3', 180.221, 100.04, 130.204], ['C', ' HH2', 181.905, 100.57, 131.885]] AA_SCO= 2.2784210526315785 CA_SCO= 1.8114736842105263
[['C', ' N ', 173.347, 102.48, 130.783], ['C', ' CA ', 172.434, 102.467, 129.669], ['C', ' C ', 172.94, 103.532, 128.669], ['C', ' O ', 173.082, 104.687, 129.048], ['C', ' CB ', 171.042, 102.804, 130.18], ['C', ' CG ', 169.942, 102.746, 129.182], ['C', ' CD ', 168.603, 102.982, 129.891], ['C', ' CE ', 167.415, 102.921, 128.938], ['C', ' NZ ', 167.337, 104.128, 128.046], ['C', ' H ', 173.048, 102.669, 131.733], ['C', ' HA ', 172.424, 101.467, 129.259], ['C', ' HB ', 170.785, 102.148, 131.001], ['C', ' HB ', 171.061, 103.816, 130.585], ['C', ' HG ', 170.105, 103.51, 128.417], ['C', ' HG ', 169.934, 101.764, 128.704], ['C', ' HD ', 168.469, 102.23, 130.672], ['C', ' HD ', 168.612, 103.97, 130.362], ['C', ' HE ', 167.504, 102.03, 128.318], ['C', ' HE ', 166.495, 102.856, 129.519], ['C', ' HZ ', 166.545, 104.056, 127.44], ['C', ' HZ ', 167.231, 104.982, 128.626], ['C', ' HZ ', 168.171, 104.213, 127.489]] AA_SCO= 2.2873684210526313 CA_SCO= 1.812421052631579
[['C', ' N ', 173.268, 103.172, 127.427], ['C', ' CA ', 173.781, 104.016, 126.367], ['C', ' C ', 172.728, 104.865, 125.71], ['C', ' O ', 171.555, 104.487, 125.689], ['C', ' CB ', 174.305, 102.998, 125.389], ['C', ' CG ', 173.417, 101.825, 125.595], ['C', ' CD ', 173.104, 101.811, 127.028], ['C', ' HA ', 174.595, 104.646, 126.762], ['C', ' HB ', 174.207, 103.41, 124.385], ['C', ' HB ', 175.366, 102.797, 125.572], ['C', ' HG ', 172.497, 101.924, 124.993], ['C', ' HG ', 173.91, 100.895, 125.271], ['C', ' HD ', 172.056, 101.49, 127.132], ['C', ' HD ', 173.826, 101.172, 127.547]] AA_SCO= 2.201052631578947 CA_SCO= 1.8073157894736842
[['C', ' N ', 173.164, 105.934, 125.078], ['C', ' CA ', 172.308, 106.742, 124.235], ['C', ' C ', 172.989, 107.174, 122.942], ['C', ' O ', 173.927, 107.973, 122.98], ['C', ' CB ', 171.863, 107.978, 124.986], ['C', ' CG ', 171.121, 109.011, 124.16], ['C', ' CD ', 169.823, 108.543, 123.576], ['C', ' OE1', 168.946, 108.036, 124.275], ['C', ' NE2', 169.687, 108.704, 122.262], ['C', ' H ', 174.145, 106.203, 125.206], ['C', ' HA ', 171.418, 106.165, 124.027], ['C', ' HB ', 171.22, 107.68, 125.812], ['C', ' HB ', 172.737, 108.464, 125.403], ['C', ' HG ', 170.898, 109.851, 124.812], ['C', ' HG ', 171.754, 109.36, 123.341], ['C', ' HE2', 168.847, 108.421, 121.803], ['C', ' HE2', 170.467, 109.09, 121.707]] AA_SCO= 2.1710526315789465 CA_SCO= 1.804157894736842
[['C', ' N ', 172.508, 106.753, 121.772], ['C', ' CA ', 173.051, 107.152, 120.498], ['C', ' C ', 173.1, 108.662, 120.379], ['C', ' O ', 172.117, 109.356, 120.657], ['C', ' CB ', 172.019, 106.595, 119.533], ['C', ' CG ', 171.467, 105.383, 120.238], ['C', ' CD ', 171.423, 105.755, 121.689], ['C', ' HA ', 174.033, 106.697, 120.337], ['C', ' HB ', 171.246, 107.352, 119.343], ['C', ' HB ', 172.492, 106.409, 118.577], ['C', ' HG ', 170.475, 105.139, 119.829], ['C', ' HG ', 172.1, 104.51, 120.049], ['C', ' HD ', 170.449, 106.172, 121.943], ['C', ' HD ', 171.667, 104.851, 122.284]] AA_SCO= 2.1294736842105255 CA_SCO= 1.825263157894737
[['C', ' N ', 174.224, 109.156, 119.909], ['C', ' CA ', 174.426, 110.576, 119.712], ['C', ' C ', 175.401, 110.777, 118.585], ['C', ' O ', 176.124, 109.841, 118.23], ['C', ' CB ', 174.896, 111.232, 121.004], ['C', ' CG ', 176.232, 110.725, 121.571], ['C', ' SD ', 177.714, 111.415, 120.77], ['C', ' CE ', 177.69, 113.163, 121.14], ['C', ' H ', 174.994, 108.507, 119.721], ['C', ' HA ', 173.48, 111.029, 119.416], ['C', ' HB ', 174.95, 112.3, 120.863], ['C', ' HB ', 174.143, 111.048, 121.776], ['C', ' HG ', 176.272, 110.961, 122.629], ['C', ' HG ', 176.266, 109.635, 121.467], ['C', ' HE ', 178.547, 113.642, 120.691], ['C', ' HE ', 176.795, 113.619, 120.731], ['C', ' HE ', 177.721, 113.314, 122.217]] AA_SCO= 2.2205263157894732 CA_SCO= 1.861210526315789
[['C', ' N ', 175.442, 111.968, 118.004], ['C', ' CA ', 176.445, 112.146, 116.981], ['C', ' C ', 177.495, 113.078, 117.507], ['C', ' O ', 177.193, 114.162, 118.001], ['C', ' CB ', 175.857, 112.687, 115.658], ['C', ' CG1', 175.258, 114.091, 115.798], ['C', ' CG2', 176.929, 112.671, 114.601], ['C', ' H ', 174.832, 112.72, 118.296], ['C', ' HA ', 176.913, 111.194, 116.769], ['C', ' HB ', 175.046, 112.033, 115.359], ['C', ' HG1', 174.843, 114.383, 114.841], ['C', ' HG1', 174.479, 114.101, 116.544], ['C', ' HG1', 176.016, 114.817, 116.072], ['C', ' HG2', 176.51, 112.996, 113.689], ['C', ' HG2', 177.755, 113.327, 114.87], ['C', ' HG2', 177.294, 111.672, 114.478]] AA_SCO= 2.194736842105263 CA_SCO= 1.8716315789473683
[['C', ' N ', 178.722, 112.638, 117.403], ['C', ' CA ', 179.848, 113.402, 117.83], ['C', ' C ', 180.326, 114.23, 116.676], ['C', ' O ', 180.443, 113.73, 115.558], ['C', ' CB ', 180.946, 112.479, 118.308], ['C', ' H ', 178.857, 111.722, 116.991], ['C', ' HA ', 179.539, 114.068, 118.628], ['C', ' HB ', 181.808, 113.056, 118.615], ['C', ' HB ', 180.588, 111.883, 119.148], ['C', ' HB ', 181.223, 111.828, 117.492]] AA_SCO= 2.248421052631579 CA_SCO= 1.853894736842105
[['C', ' N ', 180.653, 115.481, 116.934], ['C', ' CA ', 181.225, 116.348, 115.909], ['C', ' C ', 182.542, 116.903, 116.408], ['C', ' O ', 183.062, 117.898, 115.904], ['C', ' CB ', 180.252, 117.447, 115.531], ['C', ' CG ', 178.997, 116.927, 114.849], ['C', ' SD ', 177.914, 118.233, 114.233], ['C', ' CE ', 177.231, 118.874, 115.74], ['C', ' H ', 180.486, 115.839, 117.891], ['C', ' HA ', 181.438, 115.758, 115.02], ['C', ' HB ', 179.972, 117.989, 116.428], ['C', ' HB ', 180.741, 118.15, 114.853], ['C', ' HG ', 179.295, 116.297, 114.009], ['C', ' HG ', 178.43, 116.309, 115.549], ['C', ' HE ', 176.541, 119.683, 115.51], ['C', ' HE ', 176.702, 118.077, 116.268], ['C', ' HE ', 178.025, 119.258, 116.374]] AA_SCO= 2.2305263157894735 CA_SCO= 1.8476315789473683
[['C', ' N ', 183.043, 116.259, 117.437], ['C', ' CA ', 184.278, 116.597, 118.115], ['C', ' C ', 184.906, 115.372, 118.702], ['C', ' O ', 184.222, 114.476, 119.194], ['C', ' CB ', 184.072, 117.593, 119.222], ['C', ' OG ', 185.292, 117.785, 119.919], ['C', ' H ', 182.527, 115.448, 117.748], ['C', ' HA ', 184.97, 117.022, 117.386], ['C', ' HB ', 183.73, 118.539, 118.803], ['C', ' HB ', 183.302, 117.235, 119.907], ['C', ' HG ', 185.136, 118.518, 120.535]] AA_SCO= 2.3389473684210524 CA_SCO= 1.8306842105263155
[['C', ' N ', 186.225, 115.326, 118.708], ['C', ' CA ', 186.889, 114.179, 119.289], ['C', ' C ', 186.597, 114.076, 120.783], ['C', ' O ', 186.509, 112.972, 121.324], ['C', ' CB ', 188.372, 114.278, 119.041], ['C', ' OG ', 188.91, 115.37, 119.722], ['C', ' H ', 186.772, 116.083, 118.315], ['C', ' HA ', 186.513, 113.281, 118.801], ['C', ' HB ', 188.859, 113.363, 119.37], ['C', ' HB ', 188.557, 114.384, 117.969], ['C', ' HG ', 189.846, 115.39, 119.493]] AA_SCO= 2.27578947368421 CA_SCO= 1.8447894736842103
[['C', ' N ', 186.269, 115.196, 121.43], ['C', ' CA ', 185.98, 115.196, 122.86], ['C', ' C ', 184.755, 114.356, 123.179], ['C', ' O ', 184.598, 113.839, 124.289], ['C', ' CB ', 185.69, 116.613, 123.342], ['C', ' CG ', 186.898, 117.536, 123.373], ['C', ' OD1', 188.009, 117.078, 123.291], ['C', ' OD2', 186.681, 118.717, 123.463], ['C', ' H ', 186.308, 116.092, 120.941], ['C', ' HA ', 186.839, 114.788, 123.392], ['C', ' HB ', 184.935, 117.057, 122.694], ['C', ' HB ', 185.265, 116.57, 124.344]] AA_SCO= 2.2621052631578946 CA_SCO= 1.8272105263157894
[['C', ' N ', 183.854, 114.258, 122.216], ['C', ' CA ', 182.61, 113.553, 122.375], ['C', ' C ', 182.809, 112.07, 122.128], ['C', ' O ', 182.013, 111.246, 122.583], ['C', ' CB ', 181.582, 114.186, 121.464], ['C', ' CG ', 181.201, 115.611, 121.893], ['C', ' CD ', 180.37, 116.358, 120.884], ['C', ' OE1', 180.337, 115.928, 119.752], ['C', ' OE2', 179.778, 117.345, 121.237], ['C', ' H ', 184.051, 114.647, 121.291], ['C', ' HA ', 182.269, 113.689, 123.398], ['C', ' HB ', 181.988, 114.259, 120.472], ['C', ' HB ', 180.698, 113.566, 121.425], ['C', ' HG ', 180.647, 115.553, 122.83], ['C', ' HG ', 182.114, 116.174, 122.083]] AA_SCO= 2.2215789473684207 CA_SCO= 1.829736842105263
[['C', ' N ', 183.863, 111.714, 121.39], ['C', ' CA ', 184.115, 110.324, 121.116], ['C', ' C ', 184.794, 109.795, 122.358], ['C', ' O ', 184.65, 108.625, 122.71], ['C', ' CB ', 185.001, 110.161, 119.878], ['C', ' CG ', 184.395, 110.64, 118.523], ['C', ' CD1', 185.443, 110.534, 117.459], ['C', ' CD2', 183.22, 109.797, 118.139], ['C', ' H ', 184.53, 112.399, 121.044], ['C', ' HA ', 183.176, 109.796, 120.986], ['C', ' HB ', 185.921, 110.723, 120.043], ['C', ' HB ', 185.262, 109.106, 119.773], ['C', ' HG ', 184.088, 111.688, 118.607], ['C', ' HD1', 185.041, 110.873, 116.507], ['C', ' HD1', 186.278, 111.156, 117.741], ['C', ' HD1', 185.77, 109.499, 117.363], ['C', ' HD2', 182.831, 110.136, 117.189], ['C', ' HD2', 183.543, 108.766, 118.047], ['C', ' HD2', 182.439, 109.87, 118.886]] AA_SCO= 2.215789473684211 CA_SCO= 1.7772105263157894
[['C', ' N ', 185.549, 110.677, 123.023], ['C', ' CA ', 186.172, 110.305, 124.273], ['C', ' C ', 185.082, 110.171, 125.327], ['C', ' O ', 185.007, 109.171, 126.027], ['C', ' CB ', 187.221, 111.326, 124.707], ['C', ' CG ', 188.495, 111.322, 123.872], ['C', ' CD ', 189.488, 112.401, 124.346], ['C', ' CE ', 190.79, 112.362, 123.532], ['C', ' NZ ', 191.748, 113.482, 123.88], ['C', ' H ', 185.697, 111.604, 122.617], ['C', ' HA ', 186.657, 109.337, 124.154], ['C', ' HB ', 186.792, 112.327, 124.645], ['C', ' HB ', 187.491, 111.153, 125.744], ['C', ' HG ', 188.968, 110.341, 123.945], ['C', ' HG ', 188.236, 111.503, 122.826], ['C', ' HD ', 189.033, 113.389, 124.241], ['C', ' HD ', 189.733, 112.237, 125.398], ['C', ' HE ', 191.286, 111.425, 123.726], ['C', ' HE ', 190.546, 112.423, 122.471], ['C', ' HZ ', 192.588, 113.393, 123.316], ['C', ' HZ ', 191.319, 114.374, 123.694], ['C', ' HZ ', 192.043, 113.467, 124.872]] AA_SCO= 2.1594736842105267 CA_SCO= 1.7737894736842108
[['C', ' N ', 184.124, 111.097, 125.353], ['C', ' CA ', 183.033, 111.001, 126.316], ['C', ' C ', 182.234, 109.711, 126.135], ['C', ' O ', 181.776, 109.107, 127.104], ['C', ' CB ', 182.109, 112.185, 126.167], ['C', ' H ', 184.208, 111.941, 124.781], ['C', ' HA ', 183.467, 111.002, 127.315], ['C', ' HB ', 181.314, 112.119, 126.907], ['C', ' HB ', 182.673, 113.107, 126.311], ['C', ' HB ', 181.677, 112.176, 125.171]] AA_SCO= 2.127368421052632 CA_SCO= 1.7709473684210528
[['C', ' N ', 182.094, 109.276, 124.889], ['C', ' CA ', 181.369, 108.069, 124.528], ['C', ' C ', 182.226, 106.795, 124.65], ['C', ' O ', 181.745, 105.704, 124.33], ['C', ' CB ', 180.85, 108.205, 123.106], ['C', ' H ', 182.449, 109.865, 124.132], ['C', ' HA ', 180.532, 107.969, 125.212], ['C', ' HB ', 180.272, 107.32, 122.836], ['C', ' HB ', 180.22, 109.091, 123.029], ['C', ' HB ', 181.699, 108.306, 122.432]] AA_SCO= 2.143157894736842 CA_SCO= 1.7560526315789478
[['C', ' N ', 183.493, 106.933, 125.043], ['C', ' CA ', 184.439, 105.828, 125.153], ['C', ' C ', 184.029, 104.834, 126.213], ['C', ' O ', 183.5, 105.197, 127.262], ['C', ' CB ', 185.816, 106.347, 125.498], ['C', ' H ', 183.836, 107.857, 125.308], ['C', ' HA ', 184.468, 105.314, 124.193], ['C', ' HB ', 186.522, 105.523, 125.56], ['C', ' HB ', 186.137, 107.051, 124.739], ['C', ' HB ', 185.754, 106.851, 126.451]] AA_SCO= 2.15578947368421 CA_SCO= 1.7545789473684212
[['C', ' N ', 184.322, 103.572, 125.955], ['C', ' CA ', 184.037, 102.504, 126.895], ['C', ' C ', 183.052, 101.568, 126.236], ['C', ' O ', 182.382, 101.946, 125.275], ['C', ' H ', 184.734, 103.334, 125.067], ['C', ' HA ', 184.956, 101.977, 127.157], ['C', ' HA ', 183.615, 102.913, 127.812]] AA_SCO= 2.2042105263157894 CA_SCO= 1.7581578947368421
[['C', ' N ', 182.948, 100.351, 126.729], ['C', ' CA ', 182.033, 99.414, 126.109], ['C', ' C ', 180.852, 99.182, 127.002], ['C', ' O ', 180.997, 98.901, 128.187], ['C', ' CB ', 182.721, 98.076, 125.785], ['C', ' OG1', 183.804, 98.296, 124.868], ['C', ' CG2', 181.724, 97.132, 125.124], ['C', ' H ', 183.492, 100.072, 127.532], ['C', ' HA ', 181.667, 99.835, 125.174], ['C', ' HB ', 183.107, 97.628, 126.701], ['C', ' HG1', 184.371, 97.523, 124.862], ['C', ' HG2', 182.222, 96.195, 124.888], ['C', ' HG2', 180.888, 96.93, 125.786], ['C', ' HG2', 181.35, 97.581, 124.207]] AA_SCO= 2.1647368421052633 CA_SCO= 1.7577894736842108
[['C', ' N ', 179.683, 99.341, 126.428], ['C', ' CA ', 178.44, 99.121, 127.118], ['C', ' C ', 177.978, 97.79, 126.578], ['C', ' O ', 178.199, 97.508, 125.403], ['C', ' CB ', 177.468, 100.281, 126.862], ['C', ' CG ', 177.752, 101.553, 127.736], ['C', ' CD ', 178.898, 102.478, 127.228], ['C', ' CE ', 178.447, 103.405, 126.113], ['C', ' NZ ', 179.559, 104.306, 125.645], ['C', ' H ', 179.669, 99.594, 125.449], ['C', ' HA ', 178.615, 99.021, 128.19], ['C', ' HB ', 177.497, 100.56, 125.812], ['C', ' HB ', 176.45, 99.96, 127.084], ['C', ' HG ', 176.841, 102.151, 127.776], ['C', ' HG ', 177.989, 101.249, 128.732], ['C', ' HD ', 179.238, 103.091, 128.061], ['C', ' HD ', 179.746, 101.915, 126.875], ['C', ' HE ', 178.091, 102.827, 125.265], ['C', ' HE ', 177.629, 104.029, 126.483], ['C', ' HZ ', 179.19, 104.915, 124.908], ['C', ' HZ ', 179.912, 104.881, 126.391], ['C', ' HZ ', 180.326, 103.754, 125.26]] AA_SCO= 2.048947368421053 CA_SCO= 1.7578421052631579
[['C', ' N ', 177.353, 96.977, 127.412], ['C', ' CA ', 176.947, 95.632, 126.999], ['C', ' C ', 175.466, 95.439, 126.821], ['C', ' O ', 174.98, 94.303, 126.851], ['C', ' CB ', 177.548, 94.619, 127.96], ['C', ' CG ', 179.024, 94.653, 127.84], ['C', ' CD1', 179.735, 95.454, 128.665], ['C', ' CD2', 179.673, 93.914, 126.871], ['C', ' CE1', 181.07, 95.539, 128.531], ['C', ' CE2', 181.042, 94.004, 126.755], ['C', ' CZ ', 181.73, 94.828, 127.602], ['C', ' OH ', 183.097, 94.981, 127.512], ['C', ' H ', 177.206, 97.286, 128.364], ['C', ' HA ', 177.393, 95.441, 126.021], ['C', ' HB ', 177.273, 94.86, 128.988], ['C', ' HB ', 177.195, 93.613, 127.732], ['C', ' HD1', 179.231, 96.055, 129.421], ['C', ' HD2', 179.106, 93.271, 126.195], ['C', ' HE1', 181.623, 96.195, 129.157], ['C', ' HE2', 181.569, 93.434, 125.991], ['C', ' HH ', 183.434, 95.432, 128.344]] AA_SCO= 2.139473684210527 CA_SCO= 1.7628947368421055
[['C', ' N ', 174.764, 96.544, 126.664], ['C', ' CA ', 173.342, 96.521, 126.413], ['C', ' C ', 173.042, 97.134, 125.068], ['C', ' O ', 173.938, 97.393, 124.265], ['C', ' CB ', 172.498, 97.163, 127.521], ['C', ' OG1', 171.125, 96.868, 127.262], ['C', ' CG2', 172.706, 98.613, 127.602], ['C', ' H ', 175.255, 97.425, 126.672], ['C', ' HA ', 173.039, 95.487, 126.336], ['C', ' HB ', 172.757, 96.714, 128.455], ['C', ' HG1', 171.023, 95.901, 127.431], ['C', ' HG2', 172.092, 99.018, 128.395], ['C', ' HG2', 173.754, 98.807, 127.816], ['C', ' HG2', 172.432, 99.083, 126.668]] AA_SCO= 2.1394736842105266 CA_SCO= 1.765736842105263
[['C', ' N ', 171.776, 97.306, 124.797], ['C', ' CA ', 171.334, 97.784, 123.516], ['C', ' C ', 171.34, 99.27, 123.353], ['C', ' O ', 170.789, 100.014, 124.161], ['C', ' CB ', 169.943, 97.255, 123.264], ['C', ' CG ', 170.031, 95.848, 123.039], ['C', ' CD1', 169.979, 94.968, 124.083], ['C', ' CD2', 170.222, 95.379, 121.782], ['C', ' CE1', 170.128, 93.651, 123.858], ['C', ' CE2', 170.369, 94.076, 121.56], ['C', ' CZ ', 170.329, 93.213, 122.585], ['C', ' H ', 171.12, 97.104, 125.535], ['C', ' HA ', 172.002, 97.366, 122.761], ['C', ' HB ', 169.298, 97.441, 124.124], ['C', ' HB ', 169.509, 97.733, 122.387], ['C', ' HD1', 169.841, 95.336, 125.081], ['C', ' HD2', 170.276, 96.073, 120.938], ['C', ' HE1', 170.104, 92.945, 124.677], ['C', ' HE2', 170.535, 93.722, 120.552], ['C', ' HZ ', 170.478, 92.176, 122.39]] AA_SCO= 1.928421052631579 CA_SCO= 1.7630526315789476
[['C', ' N ', 171.908, 99.675, 122.236], ['C', ' CA ', 172.001, 101.053, 121.826], ['C', ' C ', 171.702, 101.083, 120.346], ['C', ' O ', 172.545, 100.668, 119.549], ['C', ' CB ', 173.385, 101.598, 121.982], ['C', ' OG ', 173.393, 102.926, 121.591], ['C', ' H ', 172.332, 98.97, 121.65], ['C', ' HA ', 171.312, 101.649, 122.411], ['C', ' HB ', 173.725, 101.498, 122.974], ['C', ' HB ', 174.07, 101.032, 121.352], ['C', ' HG ', 174.311, 103.202, 121.575]] AA_SCO= 1.9494736842105262 CA_SCO= 1.7696315789473682
[['C', ' N ', 170.535, 101.535, 119.904], ['C', ' CA ', 170.121, 101.535, 118.521], ['C', ' C ', 170.825, 102.679, 117.823], ['C', ' O ', 170.221, 103.669, 117.443], ['C', ' CB ', 168.615, 101.725, 118.64], ['C', ' CG ', 168.452, 102.559, 119.881], ['C', ' CD ', 169.545, 102.087, 120.827], ['C', ' HA ', 170.367, 100.568, 118.055], ['C', ' HB ', 168.223, 102.224, 117.742], ['C', ' HB ', 168.123, 100.742, 118.705], ['C', ' HG ', 168.561, 103.61, 119.624], ['C', ' HG ', 167.441, 102.443, 120.299], ['C', ' HD ', 169.944, 102.965, 121.359], ['C', ' HD ', 169.166, 101.306, 121.51]] AA_SCO= 1.951052631578947 CA_SCO= 1.7514736842105263
[['C', ' N ', 172.133, 102.548, 117.667], ['C', ' CA ', 172.966, 103.614, 117.136], ['C', ' C ', 172.624, 103.984, 115.719], ['C', ' O ', 172.673, 105.147, 115.339], ['C', ' CB ', 174.42, 103.211, 117.174], ['C', ' CG ', 175.024, 103.217, 118.53], ['C', ' OD1', 174.619, 103.925, 119.461], ['C', ' ND2', 176.018, 102.387, 118.665], ['C', ' H ', 172.556, 101.689, 118.016], ['C', ' HA ', 172.826, 104.489, 117.742], ['C', ' HB ', 174.523, 102.205, 116.757], ['C', ' HB ', 174.997, 103.88, 116.539], ['C', ' HD2', 176.49, 102.294, 119.535], ['C', ' HD2', 176.308, 101.828, 117.886]] AA_SCO= 1.993684210526316 CA_SCO= 1.7772631578947369
[['C', ' N ', 172.178, 103.027, 114.948], ['C', ' CA ', 171.894, 103.27, 113.553], ['C', ' C ', 170.84, 104.327, 113.338], ['C', ' O ', 170.97, 105.153, 112.447], ['C', ' CB ', 171.491, 101.97, 112.871], ['C', ' CG1', 170.992, 102.205, 111.502], ['C', ' CG2', 172.672, 101.066, 112.841], ['C', ' H ', 172.121, 102.09, 115.325], ['C', ' HA ', 172.814, 103.617, 113.082], ['C', ' HB ', 170.713, 101.522, 113.412], ['C', ' HG1', 170.735, 101.269, 111.079], ['C', ' HG1', 170.113, 102.835, 111.525], ['C', ' HG1', 171.759, 102.664, 110.905], ['C', ' HG2', 172.4, 100.113, 112.372], ['C', ' HG2', 173.463, 101.532, 112.277], ['C', ' HG2', 173.005, 100.887, 113.852]] AA_SCO= 2.034736842105263 CA_SCO= 1.7935789473684212
[['C', ' N ', 169.808, 104.366, 114.152], ['C', ' CA ', 168.729, 105.302, 113.895], ['C', ' C ', 169.161, 106.742, 113.979], ['C', ' O ', 168.543, 107.613, 113.373], ['C', ' CB ', 167.563, 105.047, 114.831], ['C', ' CG ', 167.711, 105.546, 116.227], ['C', ' SD ', 166.334, 105.027, 117.214], ['C', ' CE ', 166.633, 105.877, 118.739], ['C', ' H ', 169.755, 103.719, 114.926], ['C', ' HA ', 168.39, 105.154, 112.897], ['C', ' HB ', 166.662, 105.48, 114.406], ['C', ' HB ', 167.395, 103.98, 114.903], ['C', ' HG ', 168.617, 105.186, 116.668], ['C', ' HG ', 167.741, 106.634, 116.234], ['C', ' HE ', 165.837, 105.633, 119.457], ['C', ' HE ', 167.589, 105.585, 119.146], ['C', ' HE ', 166.631, 106.951, 118.564]] AA_SCO= 2.048421052631579 CA_SCO= 1.809578947368421
[['C', ' N ', 170.246, 107.017, 114.675], ['C', ' CA ', 170.75, 108.359, 114.832], ['C', ' C ', 171.361, 108.891, 113.538], ['C', ' O ', 171.478, 110.108, 113.354], ['C', ' CB ', 171.704, 108.392, 116.007], ['C', ' CG ', 172.321, 109.706, 116.29], ['C', ' SD ', 171.145, 110.905, 116.773], ['C', ' CE ', 172.011, 112.33, 116.196], ['C', ' H ', 170.787, 106.261, 115.1], ['C', ' HA ', 169.908, 109.003, 115.075], ['C', ' HB ', 171.155, 108.11, 116.899], ['C', ' HB ', 172.445, 107.657, 115.875], ['C', ' HG ', 173.03, 109.579, 117.102], ['C', ' HG ', 172.871, 110.075, 115.429], ['C', ' HE ', 171.427, 113.202, 116.417], ['C', ' HE ', 172.955, 112.39, 116.702], ['C', ' HE ', 172.173, 112.258, 115.116]] AA_SCO= 2.1794736842105262 CA_SCO= 1.7824736842105267
[['C', ' N ', 171.714, 107.999, 112.614], ['C', ' CA ', 172.343, 108.395, 111.369], ['C', ' C ', 171.39, 109.275, 110.561], ['C', ' O ', 171.829, 110.117, 109.776], ['C', ' CB ', 172.707, 107.16, 110.537], ['C', ' CG ', 173.835, 106.204, 111.057], ['C', ' CD1', 173.849, 104.956, 110.201], ['C', ' CD2', 175.196, 106.849, 110.974], ['C', ' H ', 171.525, 107.004, 112.764], ['C', ' HA ', 173.239, 108.957, 111.594], ['C', ' HB ', 171.821, 106.562, 110.488], ['C', ' HB ', 172.967, 107.478, 109.527], ['C', ' HG ', 173.618, 105.924, 112.091], ['C', ' HD1', 174.613, 104.273, 110.564], ['C', ' HD1', 172.882, 104.481, 110.264], ['C', ' HD1', 174.058, 105.216, 109.165], ['C', ' HD2', 175.953, 106.151, 111.338], ['C', ' HD2', 175.417, 107.111, 109.938], ['C', ' HD2', 175.22, 107.73, 111.576]] AA_SCO= 2.1289473684210534 CA_SCO= 1.8129473684210529
[['C', ' N ', 170.066, 109.095, 110.706], ['C', ' CA ', 169.169, 109.896, 109.885], ['C', ' C ', 169.288, 111.382, 110.186], ['C', ' O ', 169.111, 112.218, 109.289], ['C', ' CB ', 167.702, 109.495, 110.113], ['C', ' CG ', 167.101, 109.934, 111.491], ['C', ' CD ', 165.69, 109.396, 111.704], ['C', ' CE ', 165.045, 109.887, 113.031], ['C', ' NZ ', 165.705, 109.342, 114.249], ['C', ' H ', 169.672, 108.421, 111.372], ['C', ' HA ', 169.423, 109.731, 108.851], ['C', ' HB ', 167.085, 109.936, 109.333], ['C', ' HB ', 167.596, 108.42, 110.027], ['C', ' HG ', 167.745, 109.626, 112.299], ['C', ' HG ', 167.01, 111.017, 111.516], ['C', ' HD ', 165.059, 109.705, 110.873], ['C', ' HD ', 165.718, 108.315, 111.721], ['C', ' HE ', 165.086, 110.973, 113.072], ['C', ' HE ', 164.006, 109.568, 113.04], ['C', ' HZ ', 165.223, 109.679, 115.073], ['C', ' HZ ', 165.648, 108.332, 114.213], ['C', ' HZ ', 166.671, 109.64, 114.29]] AA_SCO= 2.0394736842105265 CA_SCO= 1.806526315789474
[['C', ' N ', 169.571, 111.713, 111.457], ['C', ' CA ', 169.619, 113.084, 111.921], ['C', ' C ', 171.03, 113.586, 111.756], ['C', ' O ', 171.306, 114.761, 111.49], ['C', ' CB ', 169.182, 113.14, 113.379], ['C', ' CG ', 169.005, 114.518, 113.926], ['C', ' CD ', 168.43, 114.49, 115.34], ['C', ' CE ', 168.169, 115.899, 115.828], ['C', ' NZ ', 167.514, 115.94, 117.174], ['C', ' H ', 169.758, 110.991, 112.151], ['C', ' HA ', 168.946, 113.684, 111.319], ['C', ' HB ', 168.238, 112.612, 113.488], ['C', ' HB ', 169.916, 112.618, 113.993], ['C', ' HG ', 169.942, 115.03, 113.929], ['C', ' HG ', 168.326, 115.07, 113.273], ['C', ' HD ', 167.493, 113.934, 115.35], ['C', ' HD ', 169.13, 114.003, 116.016], ['C', ' HE ', 169.104, 116.454, 115.873], ['C', ' HE ', 167.514, 116.376, 115.109], ['C', ' HZ ', 167.319, 116.927, 117.415], ['C', ' HZ ', 166.631, 115.454, 117.125], ['C', ' HZ ', 168.096, 115.521, 117.874]] AA_SCO= 2.0500000000000003 CA_SCO= 1.8437894736842104
[['C', ' N ', 171.96, 112.673, 111.928], ['C', ' CA ', 173.331, 113.045, 111.816], ['C', ' C ', 173.589, 113.581, 110.41], ['C', ' O ', 174.341, 114.545, 110.249], ['C', ' CB ', 174.191, 111.866, 112.156], ['C', ' H ', 171.709, 111.716, 112.181], ['C', ' HA ', 173.537, 113.833, 112.532], ['C', ' HB ', 175.205, 112.145, 112.098], ['C', ' HB ', 173.96, 111.532, 113.164], ['C', ' HB ', 173.99, 111.075, 111.464]] AA_SCO= 2.0473684210526315 CA_SCO= 1.8451052631578948
[['C', ' N ', 172.943, 112.998, 109.393], ['C', ' CA ', 173.171, 113.559, 108.079], ['C', ' C ', 172.255, 114.764, 107.885], ['C', ' O ', 172.718, 115.828, 107.489], ['C', ' CB ', 172.895, 112.568, 106.941], ['C', ' CG1', 173.089, 113.269, 105.584], ['C', ' CG2', 173.788, 111.409, 107.05], ['C', ' H ', 172.369, 112.161, 109.549], ['C', ' HA ', 174.209, 113.882, 108.01], ['C', ' HB ', 171.87, 112.236, 107.004], ['C', ' HG1', 172.882, 112.56, 104.782], ['C', ' HG1', 172.441, 114.127, 105.471], ['C', ' HG1', 174.129, 113.608, 105.51], ['C', ' HG2', 173.589, 110.706, 106.24], ['C', ' HG2', 174.829, 111.744, 106.995], ['C', ' HG2', 173.602, 110.925, 107.994]] AA_SCO= 2.0789473684210527 CA_SCO= 1.827
[['C', ' N ', 170.955, 114.616, 108.137], ['C', ' CA ', 170.049, 115.734, 107.948], ['C', ' C ', 169.746, 116.361, 109.27], ['C', ' O ', 169.246, 115.682, 110.151], ['C', ' CB ', 168.766, 115.318, 107.288], ['C', ' CG ', 168.879, 115.034, 105.798], ['C', ' CD ', 169.373, 113.677, 105.558], ['C', ' NE ', 168.569, 112.723, 106.232], ['C', ' CZ ', 167.469, 112.188, 105.747], ['C', ' NH1', 167.09, 112.493, 104.538], ['C', ' NH2', 166.777, 111.352, 106.499], ['C', ' H ', 170.573, 113.729, 108.471], ['C', ' HA ', 170.524, 116.463, 107.319], ['C', ' HB ', 168.36, 114.457, 107.806], ['C', ' HB ', 168.041, 116.123, 107.402], ['C', ' HG ', 167.9, 115.148, 105.338], ['C', ' HG ', 169.578, 115.74, 105.351], ['C', ' HD ', 169.372, 113.461, 104.496], ['C', ' HD ', 170.343, 113.57, 105.9], ['C', ' HE ', 168.842, 112.464, 107.192], ['C', ' HH1', 167.624, 113.134, 103.978], ['C', ' HH1', 166.264, 112.065, 104.157], ['C', ' HH2', 167.103, 111.136, 107.432], ['C', ' HH2', 165.897, 110.926, 106.16]] AA_SCO= 1.946315789473684 CA_SCO= 1.7549473684210526
[['C', ' N ', 169.916, 117.676, 109.349], ['C', ' CA ', 169.754, 118.51, 110.539], ['C', ' C ', 171.139, 118.849, 111.087], ['C', ' O ', 171.48, 120.032, 111.248], ['C', ' CB ', 168.975, 117.796, 111.645], ['C', ' CG ', 168.496, 118.679, 112.67], ['C', ' CD ', 167.388, 119.466, 112.067], ['C', ' OE1', 166.451, 118.844, 111.565], ['C', ' NE2', 167.467, 120.763, 112.093], ['C', ' H ', 170.255, 118.143, 108.521], ['C', ' HA ', 169.26, 119.437, 110.263], ['C', ' HB ', 168.086, 117.319, 111.248], ['C', ' HB ', 169.6, 117.044, 112.129], ['C', ' HG ', 168.116, 118.101, 113.502], ['C', ' HG ', 169.284, 119.361, 112.995], ['C', ' HE2', 166.725, 121.326, 111.707], ['C', ' HE2', 168.261, 121.198, 112.541]] AA_SCO= 1.9015789473684208 CA_SCO= 1.752157894736842
[['C', ' N ', 171.961, 117.838, 111.345], ['C', ' CA ', 173.326, 118.141, 111.739], ['C', ' C ', 174.196, 118.548, 110.547], ['C', ' O ', 175.144, 119.307, 110.707], ['C', ' CB ', 173.958, 117.009, 112.508], ['C', ' CG ', 173.503, 116.94, 113.893], ['C', ' CD1', 172.574, 116.042, 114.283], ['C', ' CD2', 174.034, 117.798, 114.788], ['C', ' CE1', 172.169, 116.003, 115.575], ['C', ' CE2', 173.641, 117.766, 116.088], ['C', ' CZ ', 172.708, 116.865, 116.481], ['C', ' OH ', 172.3, 116.819, 117.786], ['C', ' H ', 171.64, 116.862, 111.272], ['C', ' HA ', 173.282, 118.983, 112.419], ['C', ' HB ', 173.717, 116.087, 112.03], ['C', ' HB ', 175.032, 117.123, 112.507], ['C', ' HD1', 172.155, 115.365, 113.578], ['C', ' HD2', 174.774, 118.512, 114.462], ['C', ' HE1', 171.425, 115.294, 115.886], ['C', ' HE2', 174.074, 118.461, 116.81], ['C', ' HH ', 172.759, 117.499, 118.289]] AA_SCO= 1.9136842105263154 CA_SCO= 1.731684210526316
[['C', ' N ', 173.867, 118.079, 109.345], ['C', ' CA ', 174.633, 118.437, 108.154], ['C', ' C ', 175.951, 117.728, 108.003], ['C', ' O ', 176.902, 118.301, 107.468], ['C', ' H ', 173.084, 117.445, 109.242], ['C', ' HA ', 174.034, 118.205, 107.282], ['C', ' HA ', 174.815, 119.502, 108.131]] AA_SCO= 1.8447368421052626 CA_SCO= 1.7296315789473689
[['C', ' N ', 176.044, 116.502, 108.471], ['C', ' CA ', 177.298, 115.818, 108.359], ['C', ' C ', 177.247, 114.956, 107.106], ['C', ' O ', 176.467, 114.018, 107.021], ['C', ' CB ', 177.465, 114.956, 109.6], ['C', ' CG1', 177.382, 115.849, 110.85], ['C', ' CG2', 178.792, 114.33, 109.55], ['C', ' CD1', 177.168, 115.099, 112.105], ['C', ' H ', 175.257, 116.022, 108.923], ['C', ' HA ', 178.113, 116.538, 108.275], ['C', ' HB ', 176.692, 114.203, 109.649], ['C', ' HG1', 178.306, 116.412, 110.946], ['C', ' HG1', 176.564, 116.548, 110.744], ['C', ' HG2', 178.977, 113.755, 110.411], ['C', ' HG2', 178.891, 113.698, 108.676], ['C', ' HG2', 179.488, 115.121, 109.516], ['C', ' HD1', 177.106, 115.779, 112.932], ['C', ' HD1', 176.229, 114.56, 112.021], ['C', ' HD1', 177.962, 114.408, 112.282]] AA_SCO= 1.9273684210526314 CA_SCO= 1.7248421052631582
[['C', ' N ', 178.089, 115.254, 106.124], ['C', ' CA ', 178.036, 114.559, 104.842], ['C', ' C ', 179.001, 113.379, 104.77], ['C', ' O ', 179.159, 112.744, 103.726], ['C', ' CB ', 178.313, 115.541, 103.703], ['C', ' CG ', 177.263, 116.666, 103.572], ['C', ' CD ', 177.501, 117.589, 102.373], ['C', ' OE1', 178.271, 117.227, 101.515], ['C', ' OE2', 176.899, 118.645, 102.315], ['C', ' H ', 178.777, 116.012, 106.233], ['C', ' HA ', 177.026, 114.172, 104.71], ['C', ' HB ', 179.284, 116.014, 103.87], ['C', ' HB ', 178.367, 115.009, 102.758], ['C', ' HG ', 176.276, 116.213, 103.482], ['C', ' HG ', 177.274, 117.262, 104.489]] AA_SCO= 1.995263157894737 CA_SCO= 1.6461578947368423
[['C', ' N ', 179.715, 113.144, 105.849], ['C', ' CA ', 180.686, 112.066, 105.918], ['C', ' C ', 180.678, 111.393, 107.283], ['C', ' O ', 181.469, 111.743, 108.158], ['C', ' CB ', 182.081, 112.598, 105.652], ['C', ' CG ', 182.296, 113.214, 104.289], ['C', ' CD ', 183.717, 113.686, 104.149], ['C', ' CE ', 183.967, 114.335, 102.828], ['C', ' NZ ', 185.339, 114.902, 102.762], ['C', ' H ', 179.533, 113.725, 106.654], ['C', ' HA ', 180.426, 111.315, 105.173], ['C', ' HB ', 182.319, 113.34, 106.386], ['C', ' HB ', 182.803, 111.79, 105.768], ['C', ' HG ', 182.057, 112.493, 103.511], ['C', ' HG ', 181.646, 114.081, 104.176], ['C', ' HD ', 183.963, 114.39, 104.941], ['C', ' HD ', 184.383, 112.835, 104.237], ['C', ' HE ', 183.851, 113.593, 102.041], ['C', ' HE ', 183.242, 115.136, 102.672], ['C', ' HZ ', 185.487, 115.331, 101.865], ['C', ' HZ ', 185.437, 115.604, 103.49], ['C', ' HZ ', 186.023, 114.169, 102.905]] AA_SCO= 1.9489473684210528 CA_SCO= 1.6460526315789472
[['C', ' N ', 179.761, 110.485, 107.515], ['C', ' CA ', 179.657, 109.878, 108.823], ['C', ' C ', 180.461, 108.649, 109.062], ['C', ' O ', 180.671, 107.795, 108.179], ['C', ' CB ', 178.21, 109.516, 109.157], ['C', ' CG ', 177.274, 110.648, 109.324], ['C', ' CD1', 175.905, 110.149, 109.393], ['C', ' CD2', 177.567, 111.328, 110.641], ['C', ' H ', 179.107, 110.224, 106.79], ['C', ' HA ', 180.01, 110.607, 109.532], ['C', ' HB ', 177.824, 108.887, 108.358], ['C', ' HB ', 178.207, 108.932, 110.082], ['C', ' HG ', 177.379, 111.347, 108.487], ['C', ' HD1', 175.247, 110.99, 109.529], ['C', ' HD1', 175.66, 109.628, 108.465], ['C', ' HD1', 175.809, 109.48, 110.223], ['C', ' HD2', 176.894, 112.153, 110.767], ['C', ' HD2', 177.443, 110.623, 111.461], ['C', ' HD2', 178.556, 111.686, 110.659]] AA_SCO= 2.1763157894736844 CA_SCO= 1.6479473684210526
[['C', ' N ', 180.861, 108.541, 110.311], ['C', ' CA ', 181.463, 107.333, 110.777], ['C', ' C ', 180.573, 106.74, 111.857], ['C', ' O ', 179.611, 107.373, 112.307], ['C', ' H ', 180.735, 109.34, 110.943], ['C', ' HA ', 181.561, 106.633, 109.955], ['C', ' HA ', 182.459, 107.531, 111.156]] AA_SCO= 2.0736842105263156 CA_SCO= 1.469
[['C', ' N ', 180.882, 105.52, 112.234], ['C', ' CA ', 180.188, 104.799, 113.305], ['C', ' C ', 181.016, 103.586, 113.679], ['C', ' O ', 181.808, 103.182, 112.851], ['C', ' CB ', 178.762, 104.412, 112.919], ['C', ' OG1', 178.131, 103.864, 114.07], ['C', ' CG2', 178.756, 103.397, 111.782], ['C', ' H ', 181.649, 105.077, 111.72], ['C', ' HA ', 180.126, 105.442, 114.186], ['C', ' HB ', 178.214, 105.3, 112.612], ['C', ' HG1', 178.1, 104.578, 114.783], ['C', ' HG2', 177.733, 103.147, 111.543], ['C', ' HG2', 179.242, 103.829, 110.905], ['C', ' HG2', 179.286, 102.498, 112.08]] AA_SCO= 2.0868421052631576 CA_SCO= 1.4777368421052632
[['C', ' N ', 180.807, 102.981, 114.856], ['C', ' CA ', 181.037, 101.979, 115.896], ['C', ' C ', 179.926, 100.94, 116.042], ['C', ' O ', 179.689, 100.434, 117.132], ['C', ' CB ', 181.239, 102.652, 117.249], ['C', ' CG1', 182.478, 103.493, 117.203], ['C', ' CG2', 180.047, 103.468, 117.585], ['C', ' H ', 181.459, 102.321, 114.421], ['C', ' HA ', 181.961, 101.458, 115.664], ['C', ' HB ', 181.385, 101.899, 118.002], ['C', ' HG1', 182.649, 103.964, 118.172], ['C', ' HG1', 183.325, 102.873, 116.947], ['C', ' HG1', 182.35, 104.255, 116.45], ['C', ' HG2', 180.211, 103.932, 118.55], ['C', ' HG2', 179.909, 104.23, 116.82], ['C', ' HG2', 179.154, 102.849, 117.635]] AA_SCO= 2.0663157894736845 CA_SCO= 1.4822105263157896
[['C', ' N ', 179.231, 100.654, 114.964], ['C', ' CA ', 178.15, 99.676, 114.979], ['C', ' C ', 178.605, 98.257, 115.363], ['C', ' O ', 179.678, 97.791, 114.995], ['C', ' CB ', 177.493, 99.631, 113.615], ['C', ' H ', 179.462, 101.14, 114.11], ['C', ' HA ', 177.417, 99.998, 115.719], ['C', ' HB ', 176.678, 98.943, 113.621], ['C', ' HB ', 177.13, 100.621, 113.351], ['C', ' HB ', 178.212, 99.311, 112.901]] AA_SCO= 2.055263157894737 CA_SCO= 1.4838421052631579
[['C', ' N ', 177.751, 97.568, 116.084], ['C', ' CA ', 177.973, 96.174, 116.469], ['C', ' C ', 177.569, 95.387, 115.195], ['C', ' O ', 176.814, 95.955, 114.416], ['C', ' CB ', 177.092, 95.928, 117.718], ['C', ' CG1', 177.466, 94.721, 118.469], ['C', ' CG2', 175.714, 95.804, 117.266], ['C', ' CD1', 176.907, 94.611, 119.843], ['C', ' H ', 176.884, 98.054, 116.376], ['C', ' HA ', 179.027, 96.008, 116.7], ['C', ' HB ', 177.177, 96.788, 118.386], ['C', ' HG1', 177.092, 93.872, 117.929], ['C', ' HG1', 178.56, 94.678, 118.548], ['C', ' HG2', 175.028, 95.684, 118.09], ['C', ' HG2', 175.466, 96.656, 116.744], ['C', ' HG2', 175.634, 94.97, 116.63], ['C', ' HD1', 177.246, 93.687, 120.301], ['C', ' HD1', 177.253, 95.451, 120.445], ['C', ' HD1', 175.837, 94.607, 119.81]] AA_SCO= 2.008947368421053 CA_SCO= 1.243157894736842
[['C', ' N ', 177.984, 94.141, 114.869], ['C', ' CA ', 177.569, 93.452, 113.655], ['C', ' C ', 176.061, 93.381, 113.467], ['C', ' O ', 175.551, 93.601, 112.366], ['C', ' CB ', 178.145, 92.059, 113.871], ['C', ' CG ', 178.447, 91.999, 115.295], ['C', ' CD ', 178.881, 93.385, 115.634], ['C', ' HA ', 178.07, 93.901, 112.804], ['C', ' HB ', 177.404, 91.299, 113.586], ['C', ' HB ', 179.005, 91.885, 113.25], ['C', ' HG ', 177.556, 91.668, 115.835], ['C', ' HG ', 179.234, 91.231, 115.461], ['C', ' HD ', 178.838, 93.558, 116.643], ['C', ' HD ', 179.886, 93.535, 115.262]] AA_SCO= 1.8147368421052634 CA_SCO= 1.2768421052631578
[['C', ' N ', 175.337, 93.313, 114.57], ['C', ' CA ', 173.884, 93.259, 114.587], ['C', ' C ', 173.273, 94.511, 113.93], ['C', ' O ', 172.103, 94.53, 113.552], ['C', ' CB ', 173.417, 93.247, 116.038], ['C', ' SG ', 174.192, 91.988, 117.078], ['C', ' H ', 175.826, 93.134, 115.436], ['C', ' HA ', 173.551, 92.363, 114.054], ['C', ' HB ', 173.561, 94.212, 116.484], ['C', ' HB ', 172.367, 93.067, 116.06], ['C', ' HG ', 173.387, 90.963, 116.724]] AA_SCO= 1.7763157894736843 CA_SCO= 1.283421052631579
[['C', ' N ', 174.072, 95.578, 113.88], ['C', ' CA ', 173.763, 96.89, 113.342], ['C', ' C ', 174.515, 97.166, 112.055], ['C', ' O ', 173.968, 97.751, 111.117], ['C', ' CB ', 174.123, 97.936, 114.374], ['C', ' CG ', 173.296, 97.88, 115.573], ['C', ' CD ', 173.793, 98.731, 116.666], ['C', ' OE1', 175.013, 99.046, 116.76], ['C', ' NE2', 172.876, 99.082, 117.554], ['C', ' H ', 175.025, 95.453, 114.214], ['C', ' HA ', 172.693, 96.943, 113.14], ['C', ' HB ', 175.131, 97.768, 114.692], ['C', ' HB ', 174.081, 98.911, 113.944], ['C', ' HG ', 172.334, 98.269, 115.298], ['C', ' HG ', 173.193, 96.858, 115.928], ['C', ' HE2', 173.131, 99.639, 118.365], ['C', ' HE2', 171.886, 98.773, 117.472]] AA_SCO= 1.844736842105263 CA_SCO= 1.2894736842105263
[['C', ' N ', 175.74, 96.654, 111.968], ['C', ' CA ', 176.615, 96.856, 110.818], ['C', ' C ', 175.902, 96.345, 109.613], ['C', ' O ', 175.883, 96.988, 108.558], ['C', ' CB ', 177.901, 96.048, 110.967], ['C', ' OG1', 178.632, 96.497, 112.115], ['C', ' CG2', 178.765, 96.137, 109.75], ['C', ' H ', 176.11, 96.17, 112.774], ['C', ' HA ', 176.827, 97.918, 110.7], ['C', ' HB ', 177.634, 95.022, 111.083], ['C', ' HG1', 178.102, 96.369, 112.922], ['C', ' HG2', 179.64, 95.524, 109.908], ['C', ' HG2', 178.236, 95.783, 108.885], ['C', ' HG2', 179.058, 97.134, 109.581]] AA_SCO= 1.8852631578947372 CA_SCO= 1.305842105263158
[['C', ' N ', 175.304, 95.174, 109.77], ['C', ' CA ', 174.575, 94.608, 108.678], ['C', ' C ', 173.379, 95.456, 108.367], ['C', ' O ', 173.014, 95.552, 107.213], ['C', ' CB ', 174.161, 93.183, 109.007], ['C', ' CG ', 173.108, 93.027, 110.106], ['C', ' SD ', 172.65, 91.304, 110.404], ['C', ' CE ', 174.13, 90.622, 111.158], ['C', ' H ', 175.402, 94.676, 110.661], ['C', ' HA ', 175.214, 94.608, 107.801], ['C', ' HB ', 173.812, 92.693, 108.12], ['C', ' HB ', 175.045, 92.655, 109.342], ['C', ' HG ', 173.473, 93.448, 111.036], ['C', ' HG ', 172.203, 93.557, 109.838], ['C', ' HE ', 173.974, 89.572, 111.407], ['C', ' HE ', 174.968, 90.694, 110.472], ['C', ' HE ', 174.372, 91.169, 112.065]] AA_SCO= 1.9405263157894743 CA_SCO= 1.3053157894736842
[['C', ' N ', 172.801, 96.123, 109.352], ['C', ' CA ', 171.638, 96.944, 109.125], ['C', ' C ', 171.986, 98.089, 108.204], ['C', ' O ', 171.188, 98.483, 107.353], ['C', ' H ', 173.156, 96.053, 110.296], ['C', ' HA ', 170.832, 96.349, 108.705], ['C', ' HA ', 171.309, 97.333, 110.087]] AA_SCO= 1.9326315789473687 CA_SCO= 1.3136842105263158
[['C', ' N ', 173.181, 98.618, 108.373], ['C', ' CA ', 173.615, 99.722, 107.557], ['C', ' C ', 173.826, 99.263, 106.142], ['C', ' O ', 173.363, 99.92, 105.215], ['C', ' CB ', 174.897, 100.348, 108.098], ['C', ' CG1', 174.583, 101.008, 109.447], ['C', ' CG2', 175.46, 101.358, 107.069], ['C', ' CD1', 175.797, 101.403, 110.245], ['C', ' H ', 173.761, 98.242, 109.13], ['C', ' HA ', 172.837, 100.484, 107.559], ['C', ' HB ', 175.632, 99.564, 108.281], ['C', ' HG1', 173.98, 101.895, 109.267], ['C', ' HG1', 173.997, 100.311, 110.047], ['C', ' HG2', 176.367, 101.809, 107.443], ['C', ' HG2', 175.691, 100.868, 106.126], ['C', ' HG2', 174.716, 102.134, 106.891], ['C', ' HD1', 175.485, 101.857, 111.182], ['C', ' HD1', 176.394, 100.519, 110.461], ['C', ' HD1', 176.397, 102.117, 109.695]] AA_SCO= 2.095263157894737 CA_SCO= 1.3768947368421054
[['C', ' N ', 174.506, 98.132, 105.969], ['C', ' CA ', 174.767, 97.644, 104.625], ['C', ' C ', 173.487, 97.214, 103.948], ['C', ' O ', 173.391, 97.199, 102.724], ['C', ' CB ', 175.718, 96.492, 104.614], ['C', ' CG ', 177.065, 96.772, 105.134], ['C', ' CD ', 177.669, 97.963, 104.597], ['C', ' NE ', 178.993, 98.066, 105.041], ['C', ' CZ ', 179.766, 99.144, 104.974], ['C', ' NH1', 179.353, 100.277, 104.444], ['C', ' NH2', 180.954, 99.018, 105.48], ['C', ' H ', 174.87, 97.639, 106.792], ['C', ' HA ', 175.185, 98.456, 104.038], ['C', ' HB ', 175.295, 95.668, 105.185], ['C', ' HB ', 175.842, 96.171, 103.602], ['C', ' HG ', 177.066, 96.825, 106.223], ['C', ' HG ', 177.696, 95.978, 104.802], ['C', ' HD ', 177.653, 97.962, 103.507], ['C', ' HD ', 177.144, 98.82, 104.993], ['C', ' HE ', 179.413, 97.236, 105.477], ['C', ' HH1', 178.403, 100.359, 104.053], ['C', ' HH1', 179.978, 101.074, 104.424], ['C', ' HH2', 181.179, 98.093, 105.879], ['C', ' HH2', 181.631, 99.808, 105.499]] AA_SCO= 2.114736842105263 CA_SCO= 1.3804210526315792
[['C', ' N ', 172.541, 96.764, 104.747], ['C', ' CA ', 171.222, 96.378, 104.312], ['C', ' C ', 170.379, 97.59, 103.857], ['C', ' O ', 169.538, 97.445, 102.965], ['C', ' CB ', 170.613, 95.497, 105.403], ['C', ' CG ', 171.264, 94.052, 105.409], ['C', ' CD ', 170.752, 93.101, 106.46], ['C', ' CE ', 171.434, 91.728, 106.301], ['C', ' NZ ', 170.919, 90.694, 107.259], ['C', ' H ', 172.743, 96.654, 105.743], ['C', ' HA ', 171.337, 95.749, 103.436], ['C', ' HB ', 170.82, 95.949, 106.352], ['C', ' HB ', 169.585, 95.46, 105.352], ['C', ' HG ', 171.046, 93.6, 104.482], ['C', ' HG ', 172.34, 94.118, 105.474], ['C', ' HD ', 171.026, 93.497, 107.433], ['C', ' HD ', 169.676, 93.001, 106.41], ['C', ' HE ', 171.297, 91.371, 105.286], ['C', ' HE ', 172.493, 91.86, 106.476], ['C', ' HZ ', 171.451, 89.81, 107.114], ['C', ' HZ ', 171.053, 91.007, 108.208], ['C', ' HZ ', 169.944, 90.517, 107.112]] AA_SCO= 2.1073684210526316 CA_SCO= 1.3994210526315793
[['C', ' N ', 170.578, 98.778, 104.479], ['C', ' CA ', 169.9, 100.008, 104.03], ['C', ' C ', 170.597, 100.54, 102.789], ['C', ' O ', 169.997, 101.178, 101.929], ['C', ' CB ', 169.878, 101.065, 105.111], ['C', ' CG ', 168.995, 100.705, 106.264], ['C', ' SD ', 168.993, 101.887, 107.573], ['C', ' CE ', 168.047, 103.157, 106.814], ['C', ' H ', 171.209, 98.815, 105.281], ['C', ' HA ', 168.876, 99.763, 103.756], ['C', ' HB ', 170.892, 101.199, 105.5], ['C', ' HB ', 169.564, 102.0, 104.675], ['C', ' HG ', 167.979, 100.618, 105.902], ['C', ' HG ', 169.272, 99.742, 106.663], ['C', ' HE ', 167.878, 103.956, 107.483], ['C', ' HE ', 168.565, 103.539, 105.947], ['C', ' HE ', 167.11, 102.743, 106.53]] AA_SCO= 2.1700000000000004 CA_SCO= 1.3318947368421052
[['C', ' N ', 171.881, 100.265, 102.694], ['C', ' CA ', 172.646, 100.593, 101.524], ['C', ' C ', 172.274, 99.441, 100.632], ['C', ' O ', 171.503, 98.595, 101.061], ['C', ' CB ', 174.146, 100.627, 101.805], ['C', ' CG ', 174.577, 101.702, 102.747], ['C', ' CD ', 176.055, 101.667, 103.075], ['C', ' OE1', 176.635, 100.626, 103.418], ['C', ' NE2', 176.677, 102.819, 102.96], ['C', ' H ', 172.346, 99.819, 103.488], ['C', ' HA ', 172.303, 101.523, 101.082], ['C', ' HB ', 174.45, 99.674, 102.213], ['C', ' HB ', 174.688, 100.767, 100.876], ['C', ' HG ', 174.391, 102.638, 102.262], ['C', ' HG ', 174.009, 101.654, 103.663], ['C', ' HE2', 177.655, 102.912, 103.143], ['C', ' HE2', 176.152, 103.644, 102.666]] AA_SCO= 2.1389473684210527 CA_SCO= 1.3332105263157894
[['C', ' N ', 172.732, 99.407, 99.396], ['C', ' CA ', 172.413, 98.324, 98.446], ['C', ' C ', 170.943, 98.435, 97.994], ['C', ' O ', 170.694, 98.68, 96.816], ['C', ' CB ', 172.68, 96.911, 99.033], ['C', ' OG1', 174.031, 96.828, 99.491], ['C', ' CG2', 172.539, 95.881, 97.897], ['C', ' H ', 173.35, 100.14, 99.091], ['C', ' HA ', 173.044, 98.437, 97.563], ['C', ' HB ', 171.989, 96.656, 99.829], ['C', ' HG1', 174.088, 97.265, 100.359], ['C', ' HG2', 172.749, 94.885, 98.278], ['C', ' HG2', 171.545, 95.908, 97.492], ['C', ' HG2', 173.246, 96.119, 97.106]] AA_SCO= 2.07 CA_SCO= 1.389421052631579
[['C', ' N ', 169.998, 98.36, 98.935], ['C', ' CA ', 168.567, 98.515, 98.707], ['C', ' C ', 167.937, 99.63, 99.532], ['C', ' O ', 167.128, 99.358, 100.426], ['C', ' CB ', 167.826, 97.257, 99.076], ['C', ' CG ', 168.159, 96.143, 98.294], ['C', ' CD1', 169.091, 95.264, 98.722], ['C', ' CD2', 167.509, 95.972, 97.118], ['C', ' CE1', 169.387, 94.208, 97.95], ['C', ' CE2', 167.792, 94.919, 96.357], ['C', ' CZ ', 168.733, 94.038, 96.762], ['C', ' OH ', 169.031, 92.987, 95.986], ['C', ' H ', 170.319, 98.144, 99.873], ['C', ' HA ', 168.402, 98.708, 97.652], ['C', ' HB ', 168.023, 97.013, 100.123], ['C', ' HB ', 166.774, 97.428, 98.98], ['C', ' HD1', 169.603, 95.418, 99.674], ['C', ' HD2', 166.758, 96.693, 96.795], ['C', ' HE1', 170.143, 93.507, 98.266], ['C', ' HE2', 167.273, 94.781, 95.411], ['C', ' HH ', 168.471, 93.019, 95.185]] AA_SCO= 2.1205263157894736 CA_SCO= 1.3641578947368422
[['C', ' N ', 168.196, 100.898, 99.212], ['C', ' CA ', 167.748, 102.054, 99.947], ['C', ' C ', 166.291, 102.432, 99.726], ['C', ' O ', 165.98, 103.571, 99.346], ['C', ' CB ', 168.694, 103.121, 99.394], ['C', ' CG ', 168.969, 102.702, 98.001], ['C', ' CD ', 169.079, 101.223, 98.087], ['C', ' HA ', 167.924, 101.886, 101.018], ['C', ' HB ', 168.25, 104.12, 99.44], ['C', ' HB ', 169.594, 103.144, 100.004], ['C', ' HG ', 168.167, 103.035, 97.334], ['C', ' HG ', 169.895, 103.181, 97.642], ['C', ' HD ', 168.778, 100.772, 97.146], ['C', ' HD ', 170.111, 100.993, 98.347]] AA_SCO= 2.1331578947368426 CA_SCO= 1.3571578947368423
[['C', ' N ', 165.385, 101.526, 100.065], ['C', ' CA ', 163.984, 101.827, 99.859], ['C', ' C ', 163.547, 102.719, 100.976], ['C', ' O ', 163.641, 102.344, 102.143], ['C', ' CB ', 163.078, 100.596, 99.982], ['C', ' CG ', 163.176, 99.548, 98.989], ['C', ' CD1', 163.961, 98.453, 99.222], ['C', ' CD2', 162.459, 99.611, 97.823], ['C', ' CE1', 164.032, 97.451, 98.304], ['C', ' CE2', 162.553, 98.596, 96.899], ['C', ' CZ ', 163.339, 97.523, 97.15], ['C', ' H ', 165.706, 100.623, 100.408], ['C', ' HA ', 163.846, 102.329, 98.903], ['C', ' HB ', 163.21, 100.143, 100.962], ['C', ' HB ', 162.059, 100.951, 99.933], ['C', ' HD1', 164.532, 98.378, 100.157], ['C', ' HD2', 161.812, 100.48, 97.625], ['C', ' HE1', 164.642, 96.598, 98.489], ['C', ' HE2', 162.004, 98.643, 95.97], ['C', ' HZ ', 163.41, 96.722, 96.425]] AA_SCO= 2.2010526315789476 CA_SCO= 1.5321052631578949
[['C', ' N ', 163.118, 103.912, 100.62], ['C', ' CA ', 162.655, 104.892, 101.585], ['C', ' C ', 163.73, 105.509, 102.487], ['C', ' O ', 163.4, 105.958, 103.579], ['C', ' H ', 163.066, 104.1, 99.635], ['C', ' HA ', 162.135, 105.691, 101.051], ['C', ' HA ', 161.908, 104.421, 102.213]] AA_SCO= 2.191052631578948 CA_SCO= 1.5173157894736842
[['C', ' N ', 165.002, 105.55, 102.085], ['C', ' CA ', 165.99, 106.103, 103.027], ['C', ' C ', 166.666, 107.351, 102.478], ['C', ' O ', 167.763, 107.707, 102.91], ['C', ' CB ', 167.048, 105.055, 103.37], ['C', ' CG1', 166.343, 103.864, 103.992], ['C', ' CG2', 167.823, 104.69, 102.197], ['C', ' H ', 165.289, 105.177, 101.173], ['C', ' HA ', 165.484, 106.379, 103.952], ['C', ' HB ', 167.722, 105.456, 104.124], ['C', ' HG1', 167.065, 103.11, 104.249], ['C', ' HG1', 165.799, 104.187, 104.874], ['C', ' HG1', 165.646, 103.434, 103.279], ['C', ' HG2', 168.563, 103.936, 102.467], ['C', ' HG2', 167.147, 104.301, 101.49], ['C', ' HG2', 168.338, 105.55, 101.772]] AA_SCO= 2.1431578947368424 CA_SCO= 1.517157894736842
[['C', ' N ', 166.049, 107.963, 101.485], ['C', ' CA ', 166.586, 109.147, 100.829], ['C', ' C ', 168.033, 108.953, 100.417], ['C', ' O ', 168.335, 108.042, 99.66], ['C', ' CB ', 166.441, 110.356, 101.722], ['C', ' CG ', 165.009, 110.73, 102.069], ['C', ' CD ', 164.269, 111.233, 100.921], ['C', ' NE ', 164.884, 112.454, 100.41], ['C', ' CZ ', 164.78, 112.891, 99.158], ['C', ' NH1', 164.106, 112.224, 98.277], ['C', ' NH2', 165.352, 114.003, 98.77], ['C', ' H ', 165.139, 107.602, 101.234], ['C', ' HA ', 166.024, 109.32, 99.917], ['C', ' HB ', 166.962, 110.184, 102.664], ['C', ' HB ', 166.893, 111.223, 101.242], ['C', ' HG ', 164.481, 109.872, 102.491], ['C', ' HG ', 165.027, 111.518, 102.776], ['C', ' HD ', 164.209, 110.496, 100.135], ['C', ' HD ', 163.256, 111.478, 101.252], ['C', ' HE ', 165.423, 113.026, 101.052], ['C', ' HH1', 163.63, 111.374, 98.514], ['C', ' HH1', 164.064, 112.607, 97.323], ['C', ' HH2', 165.912, 114.598, 99.423], ['C', ' HH2', 165.212, 114.265, 97.788]] AA_SCO= 2.10421052631579 CA_SCO= 1.517157894736842
[['C', ' N ', 168.932, 109.799, 100.905], ['C', ' CA ', 170.326, 109.718, 100.504], ['C', ' C ', 171.22, 109.159, 101.59], ['C', ' O ', 172.44, 109.204, 101.461], ['C', ' CB ', 170.84, 111.097, 100.125], ['C', ' CG ', 170.102, 111.724, 98.992], ['C', ' CD1', 169.271, 112.81, 99.21], ['C', ' CD2', 170.228, 111.237, 97.706], ['C', ' CE1', 168.6, 113.396, 98.167], ['C', ' CE2', 169.552, 111.822, 96.66], ['C', ' CZ ', 168.739, 112.904, 96.889], ['C', ' H ', 168.654, 110.52, 101.548], ['C', ' HA ', 170.401, 109.06, 99.634], ['C', ' HB ', 170.777, 111.76, 100.986], ['C', ' HB ', 171.891, 111.023, 99.843], ['C', ' HD1', 169.156, 113.215, 100.218], ['C', ' HD2', 170.881, 110.375, 97.519], ['C', ' HE1', 167.964, 114.259, 98.36], ['C', ' HE2', 169.666, 111.431, 95.645], ['C', ' HZ ', 168.208, 113.37, 96.054]] AA_SCO= 2.100526315789474 CA_SCO= 1.7584736842105264
[['C', ' N ', 170.627, 108.563, 102.623], ['C', ' CA ', 171.35, 108.061, 103.798], ['C', ' C ', 172.205, 106.85, 103.528], ['C', ' O ', 172.953, 106.419, 104.398], ['C', ' CB ', 170.359, 107.678, 104.894], ['C', ' CG ', 169.55, 108.803, 105.531], ['C', ' CD1', 168.466, 108.192, 106.45], ['C', ' CD2', 170.496, 109.71, 106.328], ['C', ' H ', 169.604, 108.472, 102.618], ['C', ' HA ', 172.02, 108.845, 104.14], ['C', ' HB ', 169.659, 106.957, 104.48], ['C', ' HB ', 170.92, 107.195, 105.679], ['C', ' HG ', 169.046, 109.382, 104.757], ['C', ' HD1', 167.883, 108.972, 106.899], ['C', ' HD1', 167.807, 107.552, 105.855], ['C', ' HD1', 168.914, 107.62, 107.223], ['C', ' HD2', 169.936, 110.501, 106.787], ['C', ' HD2', 171.002, 109.133, 107.105], ['C', ' HD2', 171.234, 110.15, 105.679]] AA_SCO= 2.314736842105263 CA_SCO= 1.7427894736842104
[['C', ' N ', 172.031, 106.236, 102.365], ['C', ' CA ', 172.882, 105.135, 101.968], ['C', ' C ', 174.29, 105.691, 101.77], ['C', ' O ', 175.301, 105.025, 101.985], ['C', ' CB ', 172.365, 104.492, 100.702], ['C', ' H ', 171.346, 106.603, 101.72], ['C', ' HA ', 172.907, 104.404, 102.774], ['C', ' HB ', 173.017, 103.678, 100.409], ['C', ' HB ', 171.372, 104.118, 100.889], ['C', ' HB ', 172.332, 105.236, 99.898]] AA_SCO= 2.42 CA_SCO= 1.7455263157894736
[['C', ' N ', 174.369, 106.927, 101.305], ['C', ' CA ', 175.637, 107.578, 101.112], ['C', ' C ', 175.91, 108.34, 102.376], ['C', ' O ', 175.12, 108.328, 103.312], ['C', ' CB ', 175.63, 108.535, 99.909], ['C', ' CG ', 177.077, 109.017, 99.457], ['C', ' OD1', 178.077, 108.479, 99.966], ['C', ' OD2', 177.163, 109.948, 98.687], ['C', ' H ', 173.538, 107.494, 101.131], ['C', ' HA ', 176.417, 106.833, 100.973], ['C', ' HB ', 175.145, 108.041, 99.064], ['C', ' HB ', 175.024, 109.409, 100.155]] AA_SCO= 2.3799999999999994 CA_SCO= 1.7457894736842106
[['C', ' N ', 177.024, 109.01, 102.392], ['C', ' CA ', 177.465, 109.842, 103.477], ['C', ' C ', 177.854, 109.008, 104.676], ['C', ' O ', 177.918, 109.512, 105.784], ['C', ' CB ', 176.359, 110.842, 103.904], ['C', ' CG ', 175.607, 111.58, 102.741], ['C', ' CD ', 176.56, 112.241, 101.753], ['C', ' CE ', 175.838, 112.991, 100.656], ['C', ' NZ ', 176.777, 113.34, 99.53], ['C', ' H ', 177.624, 108.893, 101.581], ['C', ' HA ', 178.345, 110.396, 103.158], ['C', ' HB ', 175.62, 110.342, 104.524], ['C', ' HB ', 176.798, 111.606, 104.529], ['C', ' HG ', 174.942, 110.9, 102.217], ['C', ' HG ', 174.994, 112.359, 103.186], ['C', ' HD ', 177.182, 112.943, 102.277], ['C', ' HD ', 177.199, 111.501, 101.284], ['C', ' HE ', 175.023, 112.379, 100.266], ['C', ' HE ', 175.428, 113.912, 101.07], ['C', ' HZ ', 176.284, 113.843, 98.81], ['C', ' HZ ', 177.551, 113.905, 99.87], ['C', ' HZ ', 177.146, 112.461, 99.141]] AA_SCO= 2.402105263157894 CA_SCO= 1.745210526315789
[['C', ' N ', 178.112, 107.723, 104.469], ['C', ' CA ', 178.648, 106.875, 105.505], ['C', ' C ', 179.97, 106.482, 104.925], ['C', ' O ', 180.014, 105.801, 103.904], ['C', ' CB ', 177.773, 105.649, 105.787], ['C', ' CG1', 176.36, 106.134, 106.19], ['C', ' CG2', 178.441, 104.795, 106.913], ['C', ' CD1', 175.316, 105.052, 106.288], ['C', ' H ', 177.981, 107.334, 103.546], ['C', ' HA ', 178.807, 107.436, 106.424], ['C', ' HB ', 177.669, 105.055, 104.88], ['C', ' HG1', 176.425, 106.652, 107.145], ['C', ' HG1', 176.005, 106.844, 105.436], ['C', ' HG2', 177.844, 103.918, 107.128], ['C', ' HG2', 179.434, 104.47, 106.59], ['C', ' HG2', 178.54, 105.4, 107.821], ['C', ' HD1', 174.358, 105.504, 106.555], ['C', ' HD1', 175.216, 104.551, 105.319], ['C', ' HD1', 175.592, 104.337, 107.043]] AA_SCO= 2.228947368421052 CA_SCO= 1.7342105263157892
[['C', ' N ', 181.044, 106.952, 105.511], ['C', ' CA ', 182.325, 106.706, 104.886], ['C', ' C ', 183.15, 105.709, 105.669], ['C', ' O ', 184.023, 105.059, 105.105], ['C', ' CB ', 183.079, 108.012, 104.668], ['C', ' CG ', 182.323, 109.08, 103.81], ['C', ' CD ', 181.948, 108.629, 102.363], ['C', ' CE ', 181.396, 109.845, 101.547], ['C', ' NZ ', 180.859, 109.49, 100.129], ['C', ' H ', 180.944, 107.463, 106.388], ['C', ' HA ', 182.161, 106.259, 103.909], ['C', ' HB ', 183.287, 108.462, 105.622], ['C', ' HB ', 184.035, 107.807, 104.189], ['C', ' HG ', 181.401, 109.333, 104.326], ['C', ' HG ', 182.935, 109.981, 103.753], ['C', ' HD ', 182.823, 108.217, 101.86], ['C', ' HD ', 181.173, 107.862, 102.403], ['C', ' HE ', 180.6, 110.328, 102.115], ['C', ' HE ', 182.218, 110.55, 101.431], ['C', ' HZ ', 180.558, 110.34, 99.677], ['C', ' HZ ', 181.588, 109.065, 99.581], ['C', ' HZ ', 180.03, 108.855, 100.137]] AA_SCO= 2.0194736842105265 CA_SCO= 1.7394210526315785
[['C', ' N ', 182.921, 105.615, 106.977], ['C', ' CA ', 183.71, 104.653, 107.73], ['C', ' C ', 182.923, 103.928, 108.776], ['C', ' O ', 182.584, 104.484, 109.831], ['C', ' CB ', 184.883, 105.352, 108.413], ['C', ' CG ', 185.78, 104.497, 109.299], ['C', ' CD1', 186.452, 103.387, 108.47], ['C', ' CD2', 186.812, 105.421, 109.971], ['C', ' H ', 182.204, 106.189, 107.417], ['C', ' HA ', 184.087, 103.911, 107.029], ['C', ' HB ', 185.505, 105.817, 107.647], ['C', ' HB ', 184.477, 106.13, 109.053], ['C', ' HG ', 185.192, 104.018, 110.056], ['C', ' HD1', 187.09, 102.794, 109.12], ['C', ' HD1', 185.711, 102.737, 108.026], ['C', ' HD1', 187.051, 103.832, 107.679], ['C', ' HD2', 187.463, 104.837, 110.625], ['C', ' HD2', 187.406, 105.911, 109.205], ['C', ' HD2', 186.293, 106.177, 110.562]] AA_SCO= 1.8084210526315794 CA_SCO= 1.7593157894736842
[['C', ' N ', 182.72, 102.64, 108.535], ['C', ' CA ', 181.972, 101.844, 109.469], ['C', ' C ', 182.985, 100.983, 110.213], ['C', ' O ', 183.604, 100.066, 109.642], ['C', ' CB ', 180.96, 100.973, 108.718], ['C', ' CG ', 179.754, 100.398, 109.506], ['C', ' CD1', 178.82, 99.747, 108.493], ['C', ' CD2', 180.191, 99.429, 110.585], ['C', ' H ', 183.023, 102.213, 107.646], ['C', ' HA ', 181.461, 102.485, 110.183], ['C', ' HB ', 180.564, 101.565, 107.894], ['C', ' HB ', 181.498, 100.132, 108.28], ['C', ' HG ', 179.199, 101.205, 109.966], ['C', ' HD1', 177.942, 99.353, 108.996], ['C', ' HD1', 178.51, 100.481, 107.752], ['C', ' HD1', 179.339, 98.933, 107.996], ['C', ' HD2', 179.324, 99.043, 111.077], ['C', ' HD2', 180.738, 98.619, 110.157], ['C', ' HD2', 180.805, 99.915, 111.32]] AA_SCO= 1.8505263157894736 CA_SCO= 1.760315789473684
[['C', ' N ', 183.161, 101.299, 111.48], ['C', ' CA ', 184.071, 100.602, 112.342], ['C', ' C ', 183.174, 99.673, 113.117], ['C', ' O ', 182.262, 100.127, 113.8], ['C', ' CB ', 184.761, 101.558, 113.338], ['C', ' CG1', 185.72, 100.772, 114.207], ['C', ' CG2', 185.438, 102.692, 112.606], ['C', ' H ', 182.638, 102.06, 111.871], ['C', ' HA ', 184.789, 100.056, 111.762], ['C', ' HB ', 184.014, 101.983, 114.002], ['C', ' HG1', 186.182, 101.444, 114.916], ['C', ' HG1', 185.182, 99.989, 114.745], ['C', ' HG1', 186.492, 100.318, 113.598], ['C', ' HG2', 185.907, 103.367, 113.323], ['C', ' HG2', 186.192, 102.303, 111.932], ['C', ' HG2', 184.685, 103.231, 112.045]] AA_SCO= 1.8763157894736842 CA_SCO= 1.760526315789474
[['C', ' N ', 183.381, 98.379, 112.959], ['C', ' CA ', 182.526, 97.405, 113.603], ['C', ' C ', 183.09, 96.957, 114.941], ['C', ' O ', 184.307, 96.963, 115.136], ['C', ' H ', 184.163, 98.102, 112.381], ['C', ' HA ', 181.546, 97.838, 113.727], ['C', ' HA ', 182.404, 96.55, 112.949]] AA_SCO= 1.980526315789474 CA_SCO= 1.8277894736842102
[['C', ' N ', 182.228, 96.503, 115.835], ['C', ' CA ', 182.669, 95.973, 117.13], ['C', ' C ', 182.222, 94.534, 117.327], ['C', ' O ', 181.049, 94.235, 117.214], ['C', ' CB ', 182.18, 96.868, 118.279], ['C', ' CG1', 182.784, 98.273, 118.075], ['C', ' CG2', 182.571, 96.266, 119.638], ['C', ' CD1', 182.303, 99.34, 119.016], ['C', ' H ', 181.231, 96.597, 115.608], ['C', ' HA ', 183.757, 95.977, 117.155], ['C', ' HB ', 181.097, 96.965, 118.225], ['C', ' HG1', 183.862, 98.187, 118.143], ['C', ' HG1', 182.528, 98.619, 117.077], ['C', ' HG2', 182.22, 96.896, 120.446], ['C', ' HG2', 182.118, 95.277, 119.756], ['C', ' HG2', 183.658, 96.172, 119.697], ['C', ' HD1', 182.79, 100.275, 118.758], ['C', ' HD1', 181.22, 99.452, 118.918], ['C', ' HD1', 182.548, 99.091, 120.041]] AA_SCO= 2.004736842105263 CA_SCO= 1.8315263157894741
[['C', ' N ', 183.125, 93.639, 117.69], ['C', ' CA ', 182.753, 92.222, 117.819], ['C', ' C ', 181.637, 92.008, 118.843], ['C', ' O ', 181.645, 92.593, 119.931], ['C', ' CB ', 183.945, 91.379, 118.243], ['C', ' CG ', 185.129, 91.344, 117.286], ['C', ' CD1', 185.08, 91.899, 116.021], ['C', ' CD2', 186.295, 90.78, 117.723], ['C', ' CE1', 186.195, 91.891, 115.25], ['C', ' CE2', 187.398, 90.788, 116.941], ['C', ' CZ ', 187.344, 91.343, 115.718], ['C', ' OH ', 188.44, 91.385, 114.948], ['C', ' H ', 184.099, 93.935, 117.802], ['C', ' HA ', 182.377, 91.874, 116.86], ['C', ' HB ', 184.302, 91.722, 119.211], ['C', ' HB ', 183.593, 90.379, 118.37], ['C', ' HD1', 184.18, 92.359, 115.635], ['C', ' HD2', 186.344, 90.344, 118.721], ['C', ' HE1', 186.177, 92.338, 114.269], ['C', ' HE2', 188.329, 90.355, 117.308], ['C', ' HH ', 189.203, 91.133, 115.467]] AA_SCO= 2.01 CA_SCO= 1.8544210526315787
[['C', ' N ', 180.675, 91.152, 118.489], ['C', ' CA ', 179.515, 90.886, 119.346], ['C', ' C ', 179.354, 89.483, 119.798], ['C', ' O ', 179.074, 88.602, 118.997], ['C', ' CB ', 178.224, 91.158, 118.596], ['C', ' SG ', 176.647, 90.884, 119.513], ['C', ' H ', 180.782, 90.677, 117.584], ['C', ' HA ', 179.582, 91.533, 120.218], ['C', ' HB ', 178.251, 92.131, 118.259], ['C', ' HB ', 178.2, 90.514, 117.729], ['C', ' HG ', 175.831, 91.176, 118.493]] AA_SCO= 2.0247368421052636 CA_SCO= 1.8800526315789476
[['C', ' N ', 179.449, 89.265, 121.084], ['C', ' CA ', 179.184, 87.919, 121.523], ['C', ' C ', 177.692, 87.795, 121.719], ['C', ' O ', 177.055, 86.864, 121.215], ['C', ' CB ', 179.902, 87.575, 122.818], ['C', ' CG ', 179.712, 86.125, 123.21], ['C', ' SD ', 180.36, 84.982, 121.966], ['C', ' CE ', 182.096, 84.986, 122.307], ['C', ' H ', 179.691, 90.028, 121.7], ['C', ' HA ', 179.481, 87.218, 120.748], ['C', ' HB ', 180.955, 87.799, 122.753], ['C', ' HB ', 179.49, 88.178, 123.628], ['C', ' HG ', 180.216, 85.934, 124.156], ['C', ' HG ', 178.646, 85.914, 123.35], ['C', ' HE ', 182.587, 84.335, 121.599], ['C', ' HE ', 182.494, 85.985, 122.218], ['C', ' HE ', 182.272, 84.621, 123.32]] AA_SCO= 1.9900000000000002 CA_SCO= 1.88621052631579
[['C', ' N ', 177.14, 88.773, 122.44], ['C', ' CA ', 175.732, 88.84, 122.781], ['C', ' C ', 175.454, 90.09, 123.609], ['C', ' O ', 176.199, 90.372, 124.545], ['C', ' CB ', 175.342, 87.577, 123.56], ['C', ' CG ', 176.096, 87.371, 124.901], ['C', ' CD ', 175.835, 86.009, 125.515], ['C', ' OE1', 175.195, 85.236, 124.86], ['C', ' OE2', 176.342, 85.716, 126.586], ['C', ' H ', 177.737, 89.508, 122.78], ['C', ' HA ', 175.148, 88.896, 121.86], ['C', ' HB ', 174.298, 87.641, 123.799], ['C', ' HB ', 175.46, 86.689, 122.958], ['C', ' HG ', 177.164, 87.504, 124.754], ['C', ' HG ', 175.758, 88.126, 125.596]] AA_SCO= 1.8647368421052632 CA_SCO= 1.8730526315789475
[['C', ' N ', 174.389, 90.835, 123.301], ['C', ' CA ', 174.016, 91.949, 124.18], ['C', ' C ', 172.936, 91.559, 125.145], ['C', ' O ', 172.074, 90.719, 124.848], ['C', ' CB ', 173.584, 93.197, 123.463], ['C', ' CG ', 174.626, 93.985, 122.924], ['C', ' OD1', 175.762, 93.959, 123.409], ['C', ' ND2', 174.284, 94.759, 121.943], ['C', ' H ', 173.821, 90.597, 122.501], ['C', ' HA ', 174.882, 92.215, 124.791], ['C', ' HB ', 172.966, 92.908, 122.638], ['C', ' HB ', 172.993, 93.822, 124.135], ['C', ' HD2', 174.957, 95.378, 121.544], ['C', ' HD2', 173.34, 94.756, 121.604]] AA_SCO= 1.8994736842105264 CA_SCO= 1.8993684210526316
[['C', ' N ', 172.938, 92.235, 126.279], ['C', ' CA ', 171.984, 91.99, 127.325], ['C', ' C ', 171.047, 93.159, 127.46], ['C', ' O ', 171.508, 94.285, 127.514], ['C', ' CB ', 172.749, 91.83, 128.613], ['C', ' CG ', 173.583, 90.673, 128.583], ['C', ' CD1', 174.896, 90.774, 128.205], ['C', ' CD2', 173.07, 89.461, 128.892], ['C', ' CE1', 175.673, 89.666, 128.15], ['C', ' CE2', 173.835, 88.349, 128.834], ['C', ' CZ ', 175.14, 88.452, 128.463], ['C', ' H ', 173.671, 92.94, 126.436], ['C', ' HA ', 171.466, 91.069, 127.107], ['C', ' HB ', 173.385, 92.701, 128.748], ['C', ' HB ', 172.094, 91.767, 129.453], ['C', ' HD1', 175.311, 91.755, 127.94], ['C', ' HD2', 172.032, 89.391, 129.182], ['C', ' HE1', 176.717, 89.744, 127.842], ['C', ' HE2', 173.413, 87.368, 129.075], ['C', ' HZ ', 175.762, 87.553, 128.403]] AA_SCO= 1.9447368421052633 CA_SCO= 1.8716315789473683
[['C', ' N ', 169.748, 92.984, 127.517], ['C', ' CA ', 168.84, 94.061, 127.735], ['C', ' C ', 169.22, 94.718, 129.029], ['C', ' O ', 169.597, 94.02, 129.981], ['C', ' CB ', 167.494, 93.358, 127.812], ['C', ' CG ', 167.695, 92.092, 127.032], ['C', ' CD ', 169.123, 91.693, 127.295], ['C', ' HA ', 168.871, 94.775, 126.902], ['C', ' HB ', 167.22, 93.185, 128.87], ['C', ' HB ', 166.71, 94.001, 127.381], ['C', ' HG ', 166.976, 91.324, 127.357], ['C', ' HG ', 167.496, 92.283, 125.965], ['C', ' HD ', 169.203, 91.051, 128.179], ['C', ' HD ', 169.494, 91.21, 126.391]] AA_SCO= 1.7784210526315793 CA_SCO= 1.8226315789473682
[['C', ' N ', 169.101, 96.023, 129.097], ['C', ' CA ', 169.377, 96.69, 130.341], ['C', ' C ', 168.287, 96.063, 131.176], ['C', ' O ', 167.186, 95.886, 130.663], ['C', ' CB ', 169.26, 98.194, 130.209], ['C', ' CG ', 169.781, 98.945, 131.369], ['C', ' CD1', 171.141, 99.16, 131.462], ['C', ' CD2', 168.942, 99.429, 132.325], ['C', ' CE1', 171.651, 99.869, 132.501], ['C', ' CE2', 169.456, 100.136, 133.368], ['C', ' CZ ', 170.806, 100.364, 133.455], ['C', ' OH ', 171.313, 101.088, 134.502], ['C', ' H ', 168.81, 96.561, 128.288], ['C', ' HA ', 170.355, 96.406, 130.731], ['C', ' HB ', 169.8, 98.523, 129.32], ['C', ' HB ', 168.215, 98.465, 130.072], ['C', ' HD1', 171.809, 98.772, 130.698], ['C', ' HD2', 167.867, 99.258, 132.255], ['C', ' HE1', 172.722, 100.048, 132.57], ['C', ' HE2', 168.789, 100.535, 134.13], ['C', ' HH ', 172.117, 101.573, 134.208]] AA_SCO= 1.7578947368421047 CA_SCO= 1.8239473684210523
[['C', ' N ', 168.572, 95.732, 132.426], ['C', ' CA ', 167.719, 94.923, 133.323], ['C', ' C ', 168.403, 93.567, 133.474], ['C', ' O ', 168.519, 93.064, 134.598], ['C', ' CB ', 166.276, 94.625, 132.822], ['C', ' OG1', 165.568, 95.828, 132.594], ['C', ' CG2', 165.527, 93.828, 133.881], ['C', ' H ', 169.472, 96.013, 132.768], ['C', ' HA ', 167.658, 95.399, 134.298], ['C', ' HB ', 166.303, 94.03, 131.905], ['C', ' HG1', 165.946, 96.2, 131.785], ['C', ' HG2', 164.518, 93.628, 133.526], ['C', ' HG2', 166.025, 92.882, 134.076], ['C', ' HG2', 165.481, 94.408, 134.801]] AA_SCO= 1.7278947368421052 CA_SCO= 1.840736842105263
[['C', ' N ', 168.839, 92.937, 132.376], ['C', ' CA ', 169.591, 91.702, 132.534], ['C', ' C ', 170.923, 92.062, 133.126], ['C', ' O ', 171.393, 91.414, 134.063], ['C', ' CB ', 169.829, 90.976, 131.23], ['C', ' OG ', 168.675, 90.374, 130.7], ['C', ' H ', 168.736, 93.339, 131.445], ['C', ' HA ', 169.062, 91.04, 133.22], ['C', ' HB ', 170.189, 91.687, 130.517], ['C', ' HB ', 170.605, 90.276, 131.373], ['C', ' HG ', 168.994, 89.788, 129.949]] AA_SCO= 1.704736842105263 CA_SCO= 1.8409999999999995
[['C', ' N ', 171.496, 93.169, 132.653], ['C', ' CA ', 172.783, 93.549, 133.213], ['C', ' C ', 172.612, 93.901, 134.665], ['C', ' O ', 173.391, 93.487, 135.511], ['C', ' CB ', 173.38, 94.787, 132.538], ['C', ' CG ', 173.857, 94.694, 131.114], ['C', ' CD1', 174.268, 96.079, 130.688], ['C', ' CD2', 175.028, 93.726, 130.993], ['C', ' H ', 171.048, 93.648, 131.866], ['C', ' HA ', 173.464, 92.705, 133.15], ['C', ' HB ', 172.634, 95.576, 132.571], ['C', ' HB ', 174.214, 95.115, 133.117], ['C', ' HG ', 173.04, 94.364, 130.466], ['C', ' HD1', 174.612, 96.047, 129.66], ['C', ' HD1', 173.42, 96.756, 130.77], ['C', ' HD1', 175.079, 96.433, 131.327], ['C', ' HD2', 175.363, 93.689, 129.958], ['C', ' HD2', 175.846, 94.055, 131.628], ['C', ' HD2', 174.719, 92.748, 131.289]] AA_SCO= 1.703157894736842 CA_SCO= 1.8326842105263152
[['C', ' N ', 171.53, 94.583, 134.994], ['C', ' CA ', 171.346, 94.968, 136.374], ['C', ' C ', 171.162, 93.741, 137.227], ['C', ' O ', 171.749, 93.634, 138.295], ['C', ' CB ', 170.133, 95.864, 136.536], ['C', ' CG ', 170.274, 97.224, 135.959], ['C', ' CD ', 168.992, 97.97, 136.039], ['C', ' OE1', 167.95, 97.418, 135.7], ['C', ' NE2', 169.035, 99.201, 136.506], ['C', ' H ', 170.877, 94.852, 134.284], ['C', ' HA ', 172.234, 95.496, 136.718], ['C', ' HB ', 169.269, 95.382, 136.088], ['C', ' HB ', 169.921, 95.982, 137.599], ['C', ' HG ', 171.002, 97.757, 136.539], ['C', ' HG ', 170.59, 97.166, 134.92], ['C', ' HE2', 168.193, 99.74, 136.588], ['C', ' HE2', 169.908, 99.607, 136.778]] AA_SCO= 1.6194736842105262 CA_SCO= 1.8314736842105261
[['C', ' N ', 170.442, 92.748, 136.733], ['C', ' CA ', 170.244, 91.559, 137.529], ['C', ' C ', 171.566, 90.891, 137.849], ['C', ' O ', 171.865, 90.605, 139.018], ['C', ' CB ', 169.364, 90.537, 136.783], ['C', ' OG1', 168.068, 91.106, 136.53], ['C', ' CG2', 169.206, 89.272, 137.634], ['C', ' H ', 169.945, 92.849, 135.85], ['C', ' HA ', 169.757, 91.838, 138.463], ['C', ' HB ', 169.827, 90.278, 135.83], ['C', ' HG1', 168.155, 91.826, 135.864], ['C', ' HG2', 168.579, 88.566, 137.109], ['C', ' HG2', 170.173, 88.812, 137.827], ['C', ' HG2', 168.736, 89.534, 138.587]] AA_SCO= 1.7468421052631578 CA_SCO= 1.8451052631578946
[['C', ' N ', 172.428, 90.726, 136.859], ['C', ' CA ', 173.629, 90.023, 137.227], ['C', ' C ', 174.759, 90.914, 137.72], ['C', ' O ', 175.727, 90.426, 138.292], ['C', ' CB ', 174.049, 89.017, 136.172], ['C', ' CG ', 174.268, 89.464, 134.793], ['C', ' CD1', 175.413, 90.132, 134.432], ['C', ' CD2', 173.346, 89.132, 133.81], ['C', ' CE1', 175.621, 90.47, 133.135], ['C', ' CE2', 173.566, 89.475, 132.519], ['C', ' CZ ', 174.705, 90.141, 132.183], ['C', ' H ', 172.2, 91.005, 135.893], ['C', ' HA ', 173.37, 89.395, 138.066], ['C', ' HB ', 174.923, 88.543, 136.513], ['C', ' HB ', 173.287, 88.24, 136.133], ['C', ' HD1', 176.16, 90.383, 135.188], ['C', ' HD2', 172.438, 88.585, 134.079], ['C', ' HE1', 176.522, 90.995, 132.857], ['C', ' HE2', 172.845, 89.215, 131.756], ['C', ' HZ ', 174.888, 90.409, 131.15]] AA_SCO= 1.9852631578947364 CA_SCO= 1.8292105263157896
[['C', ' N ', 174.628, 92.214, 137.62], ['C', ' CA ', 175.637, 93.052, 138.214], ['C', ' C ', 175.241, 93.401, 139.649], ['C', ' O ', 176.044, 93.227, 140.572], ['C', ' CB ', 175.87, 94.289, 137.361], ['C', ' CG1', 176.45, 93.812, 136.022], ['C', ' CG2', 176.755, 95.29, 138.065], ['C', ' CD1', 176.505, 94.845, 135.006], ['C', ' H ', 173.874, 92.638, 137.071], ['C', ' HA ', 176.573, 92.501, 138.249], ['C', ' HB ', 174.908, 94.758, 137.152], ['C', ' HG1', 177.444, 93.422, 136.182], ['C', ' HG1', 175.828, 93.008, 135.635], ['C', ' HG2', 176.899, 96.167, 137.456], ['C', ' HG2', 176.286, 95.596, 138.987], ['C', ' HG2', 177.714, 94.834, 138.28], ['C', ' HD1', 176.902, 94.439, 134.084], ['C', ' HD1', 175.513, 95.216, 134.842], ['C', ' HD1', 177.117, 95.618, 135.341]] AA_SCO= 2.1252631578947367 CA_SCO= 1.8320526315789476
[['C', ' N ', 173.986, 93.797, 139.855], ['C', ' CA ', 173.523, 94.21, 141.161], ['C', ' C ', 173.058, 93.079, 142.081], ['C', ' O ', 173.09, 93.261, 143.297], ['C', ' CB ', 172.385, 95.189, 140.983], ['C', ' SG ', 172.891, 96.635, 140.065], ['C', ' H ', 173.338, 93.871, 139.08], ['C', ' HA ', 174.335, 94.725, 141.654], ['C', ' HB ', 171.546, 94.719, 140.481], ['C', ' HB ', 172.046, 95.514, 141.964], ['C', ' HG ', 174.171, 96.637, 140.533]] AA_SCO= 2.0657894736842106 CA_SCO= 1.827421052631579
[['C', ' N ', 172.624, 91.917, 141.557], ['C', ' CA ', 172.19, 90.863, 142.472], ['C', ' C ', 173.199, 89.724, 142.538], ['C', ' O ', 173.508, 89.239, 143.624], ['C', ' CB ', 170.815, 90.298, 142.084], ['C', ' CG ', 169.656, 91.299, 142.156], ['C', ' CD ', 168.307, 90.679, 141.792], ['C', ' OE1', 168.291, 89.535, 141.403], ['C', ' OE2', 167.307, 91.35, 141.913], ['C', ' H ', 172.558, 91.746, 140.553], ['C', ' HA ', 172.1, 91.282, 143.472], ['C', ' HB ', 170.848, 89.893, 141.083], ['C', ' HB ', 170.572, 89.472, 142.749], ['C', ' HG ', 169.604, 91.708, 143.164], ['C', ' HG ', 169.87, 92.12, 141.47]] AA_SCO= 2.034210526315789 CA_SCO= 1.8257894736842109
[['C', ' N ', 173.777, 89.333, 141.399], ['C', ' CA ', 174.742, 88.223, 141.446], ['C', ' C ', 176.072, 88.658, 142.06], ['C', ' O ', 176.702, 87.901, 142.796], ['C', ' CB ', 175.041, 87.654, 140.061], ['C', ' CG ', 173.917, 86.93, 139.325], ['C', ' CD ', 173.629, 85.569, 139.883], ['C', ' CE ', 172.628, 84.834, 138.996], ['C', ' NZ ', 172.356, 83.464, 139.49], ['C', ' H ', 173.456, 89.758, 140.527], ['C', ' HA ', 174.332, 87.435, 142.075], ['C', ' HB ', 175.414, 88.422, 139.431], ['C', ' HB ', 175.847, 86.935, 140.171], ['C', ' HG ', 173.004, 87.525, 139.397], ['C', ' HG ', 174.186, 86.827, 138.276], ['C', ' HD ', 174.553, 84.989, 139.938], ['C', ' HD ', 173.211, 85.658, 140.885], ['C', ' HE ', 171.693, 85.395, 138.968], ['C', ' HE ', 173.03, 84.768, 137.981], ['C', ' HZ ', 171.699, 83.008, 138.871], ['C', ' HZ ', 173.228, 82.953, 139.493], ['C', ' HZ ', 171.975, 83.5, 140.424]] AA_SCO= 1.9778947368421047 CA_SCO= 1.824526315789474
[['C', ' N ', 176.506, 89.876, 141.751], ['C', ' CA ', 177.763, 90.386, 142.281], ['C', ' C ', 177.547, 91.318, 143.465], ['C', ' O ', 178.451, 91.523, 144.274], ['C', ' CB ', 178.562, 91.065, 141.173], ['C', ' CG ', 178.923, 90.168, 139.985], ['C', ' CD1', 179.622, 90.997, 138.947], ['C', ' CD2', 179.813, 89.016, 140.435], ['C', ' H ', 175.966, 90.444, 141.11], ['C', ' HA ', 178.336, 89.552, 142.666], ['C', ' HB ', 178.001, 91.898, 140.794], ['C', ' HB ', 179.481, 91.44, 141.593], ['C', ' HG ', 178.009, 89.766, 139.539], ['C', ' HD1', 179.868, 90.379, 138.085], ['C', ' HD1', 178.956, 91.794, 138.642], ['C', ' HD1', 180.532, 91.417, 139.355], ['C', ' HD2', 180.046, 88.417, 139.595], ['C', ' HD2', 180.732, 89.398, 140.869], ['C', ' HD2', 179.31, 88.391, 141.159]] AA_SCO= 2.0094736842105263 CA_SCO= 1.8227894736842107
[['C', ' N ', 176.346, 91.873, 143.584], ['C', ' CA ', 176.028, 92.789, 144.671], ['C', ' C ', 176.464, 94.244, 144.494], ['C', ' O ', 176.625, 94.957, 145.486], ['C', ' H ', 175.627, 91.644, 142.915], ['C', ' HA ', 174.951, 92.764, 144.834], ['C', ' HA ', 176.473, 92.402, 145.585]] AA_SCO= 2.016315789473684 CA_SCO= 1.8216315789473678
[['C', ' N ', 176.69, 94.706, 143.269], ['C', ' CA ', 177.128, 96.089, 143.126], ['C', ' C ', 176.181, 96.928, 142.278], ['C', ' O ', 175.821, 96.558, 141.168], ['C', ' CB ', 178.563, 96.134, 142.572], ['C', ' CG1', 178.661, 95.45, 141.235], ['C', ' CG2', 179.001, 97.556, 142.452], ['C', ' H ', 176.52, 94.117, 142.448], ['C', ' HA ', 177.159, 96.544, 144.114], ['C', ' HB ', 179.215, 95.604, 143.264], ['C', ' HG1', 179.685, 95.492, 140.891], ['C', ' HG1', 178.352, 94.41, 141.322], ['C', ' HG1', 178.038, 95.952, 140.521], ['C', ' HG2', 179.992, 97.614, 142.1], ['C', ' HG2', 178.37, 98.074, 141.755], ['C', ' HG2', 178.949, 98.033, 143.423]] AA_SCO= 1.9431578947368422 CA_SCO= 1.8162631578947366
[['C', ' N ', 175.856, 98.108, 142.773], ['C', ' CA ', 174.974, 99.037, 142.081], ['C', ' C ', 175.598, 99.501, 140.762], ['C', ' O ', 176.813, 99.546, 140.611], ['C', ' CB ', 174.675, 100.21, 142.97], ['C', ' OG ', 174.047, 99.802, 144.148], ['C', ' H ', 176.194, 98.345, 143.695], ['C', ' HA ', 174.036, 98.532, 141.868], ['C', ' HB ', 175.574, 100.752, 143.194], ['C', ' HB ', 174.016, 100.873, 142.44], ['C', ' HG ', 173.854, 100.614, 144.635]] AA_SCO= 1.8057894736842106 CA_SCO= 1.8178947368421052
[['C', ' N ', 174.776, 99.853, 139.78], ['C', ' CA ', 175.309, 100.217, 138.461], ['C', ' C ', 176.171, 101.471, 138.498], ['C', ' O ', 177.149, 101.591, 137.763], ['C', ' CB ', 174.162, 100.452, 137.487], ['C', ' CG ', 173.328, 99.221, 137.169], ['C', ' SD ', 174.213, 97.81, 136.466], ['C', ' CE ', 174.511, 98.334, 134.806], ['C', ' H ', 173.779, 99.854, 139.946], ['C', ' HA ', 175.932, 99.395, 138.105], ['C', ' HB ', 173.491, 101.206, 137.898], ['C', ' HB ', 174.552, 100.852, 136.551], ['C', ' HG ', 172.824, 98.892, 138.068], ['C', ' HG ', 172.565, 99.522, 136.45], ['C', ' HE ', 175.015, 97.543, 134.263], ['C', ' HE ', 173.564, 98.548, 134.321], ['C', ' HE ', 175.129, 99.221, 134.816]] AA_SCO= 1.8894736842105262 CA_SCO= 1.8324210526315787
[['C', ' N ', 175.85, 102.398, 139.387], ['C', ' CA ', 176.58, 103.656, 139.476], ['C', ' C ', 177.958, 103.476, 140.074], ['C', ' O ', 178.764, 104.404, 140.088], ['C', ' CB ', 175.796, 104.698, 140.278], ['C', ' CG ', 175.64, 104.426, 141.757], ['C', ' CD ', 174.482, 103.553, 142.056], ['C', ' OE1', 173.976, 102.927, 141.14], ['C', ' OE2', 174.097, 103.476, 143.194], ['C', ' H ', 175.039, 102.269, 139.995], ['C', ' HA ', 176.709, 104.04, 138.467], ['C', ' HB ', 176.276, 105.669, 140.171], ['C', ' HB ', 174.798, 104.783, 139.867], ['C', ' HG ', 176.537, 103.978, 142.154], ['C', ' HG ', 175.502, 105.38, 142.262]] AA_SCO= 1.861578947368421 CA_SCO= 1.726578947368421
[['C', ' N ', 178.221, 102.306, 140.631], ['C', ' CA ', 179.492, 102.038, 141.244], ['C', ' C ', 180.421, 101.338, 140.28], ['C', ' O ', 181.565, 101.051, 140.63], ['C', ' CB ', 179.278, 101.18, 142.479], ['C', ' CG ', 178.412, 101.793, 143.59], ['C', ' CD1', 178.204, 100.755, 144.671], ['C', ' CD2', 179.072, 103.04, 144.164], ['C', ' H ', 177.54, 101.546, 140.588], ['C', ' HA ', 179.959, 102.978, 141.513], ['C', ' HB ', 178.777, 100.291, 142.153], ['C', ' HB ', 180.245, 100.904, 142.897], ['C', ' HG ', 177.444, 102.062, 143.187], ['C', ' HD1', 177.575, 101.171, 145.457], ['C', ' HD1', 177.717, 99.887, 144.246], ['C', ' HD1', 179.165, 100.464, 145.09], ['C', ' HD2', 178.439, 103.449, 144.951], ['C', ' HD2', 180.047, 102.781, 144.58], ['C', ' HD2', 179.196, 103.794, 143.393]] AA_SCO= 1.8973684210526318 CA_SCO= 1.7510526315789472
[['C', ' N ', 179.945, 101.047, 139.071], ['C', ' CA ', 180.786, 100.333, 138.137], ['C', ' C ', 181.481, 101.287, 137.196], ['C', ' O ', 180.848, 102.116, 136.541], ['C', ' CB ', 179.987, 99.31, 137.337], ['C', ' CG1', 180.941, 98.614, 136.349], ['C', ' CG2', 179.319, 98.352, 138.303], ['C', ' H ', 178.998, 101.325, 138.792], ['C', ' HA ', 181.548, 99.792, 138.697], ['C', ' HB ', 179.213, 99.805, 136.753], ['C', ' HG1', 180.419, 97.888, 135.787], ['C', ' HG1', 181.372, 99.328, 135.661], ['C', ' HG1', 181.745, 98.123, 136.898], ['C', ' HG2', 178.748, 97.619, 137.748], ['C', ' HG2', 180.061, 97.861, 138.898], ['C', ' HG2', 178.648, 98.901, 138.962]] AA_SCO= 2.0947368421052635 CA_SCO= 1.7937894736842102
[['C', ' N ', 182.798, 101.157, 137.144], ['C', ' CA ', 183.67, 101.966, 136.32], ['C', ' C ', 183.817, 101.401, 134.917], ['C', ' O ', 183.719, 102.13, 133.928], ['C', ' CB ', 185.036, 101.996, 136.979], ['C', ' CG ', 185.072, 102.724, 138.299], ['C', ' CD ', 186.337, 102.492, 139.02], ['C', ' OE1', 186.857, 101.4, 138.905], ['C', ' OE2', 186.789, 103.368, 139.705], ['C', ' H ', 183.221, 100.428, 137.715], ['C', ' HA ', 183.258, 102.973, 136.256], ['C', ' HB ', 185.376, 100.974, 137.146], ['C', ' HB ', 185.751, 102.472, 136.309], ['C', ' HG ', 184.95, 103.791, 138.124], ['C', ' HG ', 184.239, 102.385, 138.92]] AA_SCO= 2.129473684210527 CA_SCO= 1.7937894736842102
[['C', ' N ', 184.063, 100.095, 134.851], ['C', ' CA ', 184.289, 99.39, 133.586], ['C', ' C ', 183.682, 98.005, 133.547], ['C', ' O ', 183.526, 97.346, 134.577], ['C', ' CB ', 185.775, 99.314, 133.231], ['C', ' CG ', 186.398, 100.653, 132.915], ['C', ' CD ', 187.826, 100.543, 132.427], ['C', ' CE ', 188.35, 101.935, 132.048], ['C', ' NZ ', 189.769, 101.926, 131.61], ['C', ' H ', 184.105, 99.592, 135.741], ['C', ' HA ', 183.814, 99.963, 132.796], ['C', ' HB ', 186.332, 98.885, 134.044], ['C', ' HB ', 185.907, 98.663, 132.379], ['C', ' HG ', 185.796, 101.165, 132.161], ['C', ' HG ', 186.405, 101.26, 133.815], ['C', ' HD ', 188.455, 100.11, 133.206], ['C', ' HD ', 187.864, 99.899, 131.544], ['C', ' HE ', 187.741, 102.323, 131.227], ['C', ' HE ', 188.251, 102.6, 132.905], ['C', ' HZ ', 190.035, 102.91, 131.361], ['C', ' HZ ', 190.361, 101.597, 132.349], ['C', ' HZ ', 189.887, 101.331, 130.797]] AA_SCO= 2.2421052631578946 CA_SCO= 1.7933684210526315
[['C', ' N ', 183.386, 97.526, 132.341], ['C', ' CA ', 182.868, 96.173, 132.171], ['C', ' C ', 183.541, 95.417, 131.014], ['C', ' O ', 183.872, 96.0, 129.974], ['C', ' CB ', 181.37, 96.237, 131.932], ['C', ' CG ', 180.573, 96.767, 133.042], ['C', ' SD ', 178.848, 96.829, 132.634], ['C', ' CE ', 178.288, 97.727, 134.045], ['C', ' H ', 183.522, 98.107, 131.52], ['C', ' HA ', 183.062, 95.616, 133.082], ['C', ' HB ', 181.173, 96.908, 131.113], ['C', ' HB ', 180.991, 95.246, 131.666], ['C', ' HG ', 180.713, 96.139, 133.924], ['C', ' HG ', 180.897, 97.773, 133.279], ['C', ' HE ', 177.233, 97.898, 133.972], ['C', ' HE ', 178.511, 97.179, 134.938], ['C', ' HE ', 178.793, 98.661, 134.092]] AA_SCO= 2.2631578947368416 CA_SCO= 1.7933684210526315
[['C', ' N ', 183.657, 94.102, 131.175], ['C', ' CA ', 184.224, 93.206, 130.153], ['C', ' C ', 183.525, 91.857, 130.152], ['C', ' O ', 182.871, 91.496, 131.123], ['C', ' CB ', 185.744, 93.052, 130.352], ['C', ' CG ', 186.516, 92.413, 129.169], ['C', ' OD1', 185.894, 91.953, 128.217], ['C', ' OD2', 187.711, 92.356, 129.248], ['C', ' H ', 183.349, 93.724, 132.077], ['C', ' HA ', 184.075, 93.646, 129.181], ['C', ' HB ', 186.172, 94.036, 130.543], ['C', ' HB ', 185.942, 92.457, 131.211]] AA_SCO= 2.36578947368421 CA_SCO= 1.8017894736842102
[['C', ' N ', 183.631, 91.142, 129.043], ['C', ' CA ', 183.057, 89.808, 128.884], ['C', ' C ', 184.078, 88.744, 128.488], ['C', ' O ', 183.726, 87.574, 128.317], ['C', ' CB ', 181.926, 89.821, 127.841], ['C', ' CG1', 182.478, 90.238, 126.449], ['C', ' CG2', 180.85, 90.756, 128.312], ['C', ' CD1', 181.514, 90.034, 125.289], ['C', ' H ', 184.215, 91.539, 128.31], ['C', ' HA ', 182.633, 89.505, 129.836], ['C', ' HB ', 181.515, 88.816, 127.746], ['C', ' HG1', 182.755, 91.288, 126.484], ['C', ' HG1', 183.365, 89.653, 126.229], ['C', ' HG2', 180.014, 90.775, 127.624], ['C', ' HG2', 180.528, 90.412, 129.247], ['C', ' HG2', 181.246, 91.754, 128.418], ['C', ' HD1', 181.998, 90.345, 124.362], ['C', ' HD1', 181.256, 88.978, 125.228], ['C', ' HD1', 180.611, 90.619, 125.43]] AA_SCO= 2.379473684210526 CA_SCO= 1.8036315789473683
[['C', ' N ', 185.322, 89.142, 128.257], ['C', ' CA ', 186.291, 88.172, 127.786], ['C', ' C ', 186.937, 87.342, 128.887], ['C', ' O ', 186.626, 87.46, 130.075], ['C', ' H ', 185.596, 90.126, 128.369], ['C', ' HA ', 185.809, 87.511, 127.068], ['C', ' HA ', 187.07, 88.706, 127.241]] AA_SCO= 2.3242105263157895 CA_SCO= 1.8024736842105262
[['C', ' N ', 187.835, 86.449, 128.466], ['C', ' CA ', 188.575, 85.547, 129.351], ['C', ' C ', 187.675, 84.573, 130.103], ['C', ' O ', 188.075, 83.997, 131.114], ['C', ' CB ', 189.367, 86.356, 130.364], ['C', ' CG ', 190.281, 87.36, 129.757], ['C', ' CD ', 190.983, 88.13, 130.815], ['C', ' CE ', 191.83, 89.198, 130.211], ['C', ' NZ ', 192.459, 90.025, 131.229], ['C', ' H ', 188.029, 86.404, 127.474], ['C', ' HA ', 189.267, 84.961, 128.744], ['C', ' HB ', 188.707, 86.857, 131.051], ['C', ' HB ', 189.981, 85.678, 130.955], ['C', ' HG ', 191.014, 86.853, 129.131], ['C', ' HG ', 189.718, 88.055, 129.141], ['C', ' HD ', 190.247, 88.601, 131.466], ['C', ' HD ', 191.604, 87.464, 131.411], ['C', ' HE ', 192.605, 88.743, 129.599], ['C', ' HE ', 191.208, 89.834, 129.581], ['C', ' HZ ', 193.017, 90.741, 130.758], ['C', ' HZ ', 191.759, 90.477, 131.792], ['C', ' HZ ', 193.058, 89.475, 131.816]] AA_SCO= 2.2142105263157896 CA_SCO= 1.7379473684210522
[['C', ' N ', 186.468, 84.364, 129.6], ['C', ' CA ', 185.543, 83.423, 130.203], ['C', ' C ', 184.763, 83.978, 131.398], ['C', ' O ', 184.138, 83.194, 132.129], ['C', ' H ', 186.194, 84.871, 128.771], ['C', ' HA ', 184.835, 83.095, 129.442], ['C', ' HA ', 186.093, 82.537, 130.515]] AA_SCO= 2.1757894736842105 CA_SCO= 1.6761052631578948
[['C', ' N ', 184.816, 85.297, 131.632], ['C', ' CA ', 184.112, 85.903, 132.763], ['C', ' C ', 183.473, 87.238, 132.417], ['C', ' O ', 183.944, 87.96, 131.549], ['C', ' CB ', 185.066, 86.115, 133.938], ['C', ' CG ', 185.692, 84.857, 134.513], ['C', ' CD ', 186.629, 85.191, 135.661], ['C', ' CE ', 187.243, 83.952, 136.301], ['C', ' NZ ', 188.179, 83.23, 135.385], ['C', ' H ', 185.365, 85.906, 131.017], ['C', ' HA ', 183.313, 85.241, 133.08], ['C', ' HB ', 185.869, 86.75, 133.624], ['C', ' HB ', 184.537, 86.635, 134.736], ['C', ' HG ', 184.91, 84.184, 134.856], ['C', ' HG ', 186.263, 84.363, 133.734], ['C', ' HD ', 187.427, 85.836, 135.302], ['C', ' HD ', 186.087, 85.717, 136.422], ['C', ' HE ', 187.791, 84.262, 137.189], ['C', ' HE ', 186.444, 83.273, 136.598], ['C', ' HZ ', 188.562, 82.426, 135.861], ['C', ' HZ ', 187.681, 82.918, 134.562], ['C', ' HZ ', 188.932, 83.845, 135.11]] AA_SCO= 2.1378947368421053 CA_SCO= 1.6765263157894736
[['C', ' N ', 182.408, 87.585, 133.125], ['C', ' CA ', 181.836, 88.912, 133.002], ['C', ' C ', 182.47, 89.712, 134.14], ['C', ' O ', 182.336, 89.369, 135.322], ['C', ' CB ', 180.307, 88.901, 133.092], ['C', ' CG ', 179.696, 90.233, 132.819], ['C', ' CD1', 179.214, 90.511, 131.569], ['C', ' CD2', 179.642, 91.22, 133.773], ['C', ' CE1', 178.699, 91.747, 131.254], ['C', ' CE2', 179.125, 92.46, 133.463], ['C', ' CZ ', 178.662, 92.722, 132.203], ['C', ' H ', 182.016, 86.932, 133.803], ['C', ' HA ', 182.13, 89.357, 132.057], ['C', ' HB ', 179.907, 88.187, 132.374], ['C', ' HB ', 180.007, 88.59, 134.041], ['C', ' HD1', 179.248, 89.727, 130.816], ['C', ' HD2', 180.025, 91.019, 134.776], ['C', ' HE1', 178.327, 91.947, 130.246], ['C', ' HE2', 179.09, 93.239, 134.21], ['C', ' HZ ', 178.262, 93.704, 131.963]] AA_SCO= 2.1447368421052633 CA_SCO= 1.6752105263157893
[['C', ' N ', 183.234, 90.722, 133.784], ['C', ' CA ', 184.019, 91.469, 134.755], ['C', ' C ', 183.353, 92.78, 135.06], ['C', ' O ', 182.929, 93.494, 134.147], ['C', ' CB ', 185.364, 91.815, 134.137], ['C', ' CG ', 186.155, 90.648, 133.73], ['C', ' CD1', 185.982, 89.982, 132.571], ['C', ' CD2', 187.251, 90.007, 134.383], ['C', ' NE1', 186.857, 88.984, 132.467], ['C', ' CE2', 187.648, 88.969, 133.562], ['C', ' CE3', 187.915, 90.219, 135.562], ['C', ' CZ2', 188.673, 88.132, 133.897], ['C', ' CZ3', 188.95, 89.389, 135.903], ['C', ' CH2', 189.318, 88.366, 135.091], ['C', ' H ', 183.238, 90.967, 132.8], ['C', ' HA ', 184.132, 90.891, 135.671], ['C', ' HB ', 185.2, 92.443, 133.283], ['C', ' HB ', 185.943, 92.389, 134.852], ['C', ' HD1', 185.232, 90.206, 131.817], ['C', ' HE1', 186.881, 88.335, 131.637], ['C', ' HE3', 187.63, 91.005, 136.209], ['C', ' HZ2', 188.981, 87.308, 133.258], ['C', ' HZ3', 189.462, 89.57, 136.846], ['C', ' HH2', 190.141, 87.719, 135.392]] AA_SCO= 2.0063157894736845 CA_SCO= 1.6708947368421052
[['C', ' N ', 183.326, 93.141, 136.332], ['C', ' CA ', 182.819, 94.427, 136.752], ['C', ' C ', 183.869, 95.142, 137.598], ['C', ' O ', 184.195, 94.703, 138.699], ['C', ' CB ', 181.515, 94.192, 137.541], ['C', ' CG1', 180.959, 95.417, 138.017], ['C', ' CG2', 180.505, 93.56, 136.651], ['C', ' H ', 183.641, 92.474, 137.043], ['C', ' HA ', 182.609, 95.038, 135.871], ['C', ' HB ', 181.725, 93.556, 138.395], ['C', ' HG1', 180.048, 95.215, 138.562], ['C', ' HG1', 181.655, 95.909, 138.657], ['C', ' HG1', 180.74, 96.026, 137.171], ['C', ' HG2', 179.593, 93.403, 137.198], ['C', ' HG2', 180.317, 94.226, 135.813], ['C', ' HG2', 180.871, 92.61, 136.289]] AA_SCO= 1.9642105263157899 CA_SCO= 1.672
[['C', ' N ', 184.375, 96.267, 137.123], ['C', ' CA ', 185.426, 96.993, 137.836], ['C', ' C ', 184.749, 98.033, 138.687], ['C', ' O ', 184.009, 98.858, 138.139], ['C', ' CB ', 186.379, 97.605, 136.829], ['C', ' CG ', 187.156, 96.558, 136.06], ['C', ' CD1', 186.61, 95.96, 134.923], ['C', ' CD2', 188.407, 96.195, 136.483], ['C', ' CE1', 187.311, 95.008, 134.238], ['C', ' CE2', 189.114, 95.239, 135.793], ['C', ' CZ ', 188.571, 94.644, 134.681], ['C', ' OH ', 189.285, 93.683, 134.01], ['C', ' H ', 184.052, 96.606, 136.212], ['C', ' HA ', 185.969, 96.316, 138.492], ['C', ' HB ', 185.818, 98.203, 136.133], ['C', ' HB ', 187.084, 98.261, 137.339], ['C', ' HD1', 185.631, 96.234, 134.575], ['C', ' HD2', 188.84, 96.659, 137.369], ['C', ' HE1', 186.876, 94.54, 133.354], ['C', ' HE2', 190.108, 94.946, 136.134], ['C', ' HH ', 188.769, 93.355, 133.268]] AA_SCO= 1.8431578947368423 CA_SCO= 1.6719473684210526
[['C', ' N ', 184.986, 98.004, 140.009], ['C', ' CA ', 184.24, 98.886, 140.91], ['C', ' C ', 185.111, 99.658, 141.893], ['C', ' O ', 184.875, 99.542, 143.103], ['C', ' CB ', 183.312, 98.059, 141.806], ['C', ' OG1', 184.098, 97.196, 142.597], ['C', ' CG2', 182.446, 97.193, 140.955], ['C', ' H ', 185.653, 97.33, 140.416], ['C', ' HA ', 183.671, 99.605, 140.32], ['C', ' HB ', 182.701, 98.709, 142.436], ['C', ' HG1', 184.543, 97.762, 143.262], ['C', ' HG2', 181.825, 96.579, 141.584], ['C', ' HG2', 181.837, 97.821, 140.319], ['C', ' HG2', 183.062, 96.544, 140.353]] AA_SCO= 1.8763157894736842 CA_SCO= 1.6643684210526313
[['C', ' N ', 186.145, 100.367, 141.432], ['C', ' CA ', 187.092, 101.104, 142.286], ['C', ' C ', 187.982, 100.187, 143.116], ['C', ' O ', 189.201, 100.162, 142.953], ['C', ' CB ', 186.392, 102.063, 143.267], ['C', ' CG ', 185.676, 103.215, 142.642], ['C', ' CD ', 184.984, 104.063, 143.682], ['C', ' OE1', 184.785, 103.612, 144.812], ['C', ' NE2', 184.622, 105.284, 143.316], ['C', ' H ', 186.306, 100.458, 140.421], ['C', ' HA ', 187.736, 101.696, 141.632], ['C', ' HB ', 185.703, 101.551, 143.911], ['C', ' HB ', 187.15, 102.492, 143.919], ['C', ' HG ', 186.399, 103.834, 142.117], ['C', ' HG ', 184.931, 102.835, 141.942], ['C', ' HE2', 184.162, 105.89, 143.968], ['C', ' HE2', 184.815, 105.603, 142.385]] AA_SCO= 2.0189473684210526 CA_SCO= 1.612315789473684
[['C', ' N ', 187.369, 99.459, 144.032], ['C', ' CA ', 188.059, 98.514, 144.879], ['C', ' C ', 187.95, 97.107, 144.306], ['C', ' O ', 186.928, 96.436, 144.475], ['C', ' CB ', 187.495, 98.553, 146.299], ['C', ' CG ', 188.252, 97.647, 147.274], ['C', ' OD1', 189.108, 96.913, 146.831], ['C', ' OD2', 187.974, 97.708, 148.452], ['C', ' H ', 186.361, 99.538, 144.095], ['C', ' HA ', 189.113, 98.785, 144.918], ['C', ' HB ', 187.526, 99.576, 146.674], ['C', ' HB ', 186.449, 98.245, 146.274]] AA_SCO= 2.050526315789474 CA_SCO= 1.6148421052631579
[['C', ' N ', 189.003, 96.68, 143.619], ['C', ' CA ', 189.082, 95.38, 142.967], ['C', ' C ', 188.065, 95.215, 141.824], ['C', ' O ', 187.293, 96.132, 141.503], ['C', ' CB ', 188.867, 94.286, 144.041], ['C', ' CG ', 189.445, 92.928, 143.686], ['C', ' OD1', 189.995, 92.835, 142.614], ['C', ' OD2', 189.338, 92.008, 144.459], ['C', ' H ', 189.802, 97.295, 143.552], ['C', ' HA ', 190.083, 95.271, 142.55], ['C', ' HB ', 189.288, 94.623, 144.995], ['C', ' HB ', 187.794, 94.147, 144.197]] AA_SCO= 1.868421052631579 CA_SCO= 1.7182105263157892
[['C', ' N ', 188.088, 94.035, 141.213], ['C', ' CA ', 187.166, 93.69, 140.149], ['C', ' C ', 186.342, 92.485, 140.566], ['C', ' O ', 186.864, 91.487, 141.058], ['C', ' CB ', 187.929, 93.408, 138.836], ['C', ' CG1', 188.878, 92.226, 138.976], ['C', ' CG2', 186.953, 93.175, 137.704], ['C', ' H ', 188.794, 93.369, 141.523], ['C', ' HA ', 186.487, 94.524, 139.985], ['C', ' HB ', 188.538, 94.274, 138.616], ['C', ' HG1', 189.421, 92.096, 138.042], ['C', ' HG1', 189.587, 92.42, 139.783], ['C', ' HG1', 188.332, 91.313, 139.19], ['C', ' HG2', 187.503, 93.03, 136.799], ['C', ' HG2', 186.332, 92.302, 137.893], ['C', ' HG2', 186.335, 94.03, 137.592]] AA_SCO= 1.8610526315789473 CA_SCO= 1.7137894736842103
[['C', ' N ', 185.051, 92.563, 140.344], ['C', ' CA ', 184.194, 91.465, 140.697], ['C', ' C ', 183.948, 90.645, 139.464], ['C', ' O ', 183.783, 91.184, 138.367], ['C', ' CB ', 182.867, 91.998, 141.226], ['C', ' CG ', 182.938, 92.96, 142.417], ['C', ' CD1', 181.518, 93.426, 142.746], ['C', ' CD2', 183.595, 92.286, 143.609], ['C', ' H ', 184.671, 93.4, 139.901], ['C', ' HA ', 184.684, 90.832, 141.432], ['C', ' HB ', 182.375, 92.529, 140.42], ['C', ' HB ', 182.244, 91.156, 141.512], ['C', ' HG ', 183.524, 93.844, 142.136], ['C', ' HD1', 181.548, 94.136, 143.574], ['C', ' HD1', 181.094, 93.906, 141.875], ['C', ' HD1', 180.901, 92.575, 143.031], ['C', ' HD2', 183.632, 92.99, 144.441], ['C', ' HD2', 183.014, 91.41, 143.901], ['C', ' HD2', 184.612, 91.984, 143.362]] AA_SCO= 1.6757894736842105 CA_SCO= 1.7044736842105261
[['C', ' N ', 183.876, 89.336, 139.604], ['C', ' CA ', 183.574, 88.572, 138.417], ['C', ' C ', 182.449, 87.615, 138.592], ['C', ' O ', 182.299, 86.957, 139.626], ['C', ' CB ', 184.758, 87.74, 137.973], ['C', ' OG1', 185.092, 86.821, 139.018], ['C', ' CG2', 185.932, 88.614, 137.659], ['C', ' H ', 184.031, 88.88, 140.494], ['C', ' HA ', 183.295, 89.248, 137.613], ['C', ' HB ', 184.473, 87.184, 137.087], ['C', ' HG1', 184.341, 86.222, 139.168], ['C', ' HG2', 186.761, 87.998, 137.33], ['C', ' HG2', 185.64, 89.295, 136.87], ['C', ' HG2', 186.232, 89.181, 138.537]] AA_SCO= 1.692105263157895 CA_SCO= 1.6978421052631578
[['C', ' N ', 181.738, 87.468, 137.505], ['C', ' CA ', 180.661, 86.539, 137.328], ['C', ' C ', 181.095, 85.525, 136.282], ['C', ' O ', 181.386, 85.918, 135.157], ['C', ' CB ', 179.467, 87.316, 136.815], ['C', ' CG ', 178.23, 86.582, 136.471], ['C', ' CD1', 177.6, 85.998, 137.721], ['C', ' CD2', 177.33, 87.538, 135.803], ['C', ' H ', 181.971, 88.113, 136.741], ['C', ' HA ', 180.432, 86.085, 138.282], ['C', ' HB ', 179.185, 88.04, 137.563], ['C', ' HB ', 179.778, 87.857, 135.972], ['C', ' HG ', 178.455, 85.762, 135.784], ['C', ' HD1', 176.678, 85.48, 137.456], ['C', ' HD1', 178.264, 85.301, 138.199], ['C', ' HD1', 177.376, 86.806, 138.408], ['C', ' HD2', 176.409, 87.026, 135.532], ['C', ' HD2', 177.122, 88.359, 136.49], ['C', ' HD2', 177.806, 87.93, 134.906]] AA_SCO= 1.5521052631578947 CA_SCO= 1.697105263157895
[['C', ' N ', 181.165, 84.231, 136.555], ['C', ' CA ', 181.592, 83.265, 135.575], ['C', ' C ', 180.719, 83.409, 134.349], ['C', ' O ', 179.503, 83.592, 134.454], ['C', ' CB ', 181.362, 81.943, 136.303], ['C', ' CG ', 181.489, 82.3, 137.766], ['C', ' CD ', 180.884, 83.684, 137.88], ['C', ' HA ', 182.652, 83.419, 135.327], ['C', ' HB ', 180.389, 81.525, 136.032], ['C', ' HB ', 182.114, 81.21, 135.979], ['C', ' HG ', 180.954, 81.556, 138.38], ['C', ' HG ', 182.543, 82.272, 138.078], ['C', ' HD ', 179.808, 83.622, 138.06], ['C', ' HD ', 181.425, 84.229, 138.672]] AA_SCO= 1.5131578947368418 CA_SCO= 1.6963684210526317
[['C', ' N ', 181.316, 83.333, 133.183], ['C', ' CA ', 180.54, 83.514, 131.991], ['C', ' C ', 179.663, 82.303, 131.904], ['C', ' O ', 180.033, 81.235, 132.398], ['C', ' CB ', 181.437, 83.733, 130.783], ['C', ' CG ', 180.845, 84.339, 129.519], ['C', ' CD1', 180.425, 85.828, 129.792], ['C', ' CD2', 181.914, 84.306, 128.439], ['C', ' H ', 182.32, 83.145, 133.089], ['C', ' HA ', 179.899, 84.384, 132.126], ['C', ' HB ', 182.176, 84.431, 131.083], ['C', ' HB ', 181.922, 82.79, 130.528], ['C', ' HG ', 179.973, 83.772, 129.193], ['C', ' HD1', 180.027, 86.261, 128.874], ['C', ' HD1', 179.664, 85.892, 130.559], ['C', ' HD1', 181.305, 86.403, 130.108], ['C', ' HD2', 181.521, 84.743, 127.519], ['C', ' HD2', 182.785, 84.888, 128.771], ['C', ' HD2', 182.215, 83.276, 128.252]] AA_SCO= 1.4794736842105263 CA_SCO= 1.6951052631578947
[['C', ' N ', 178.491, 82.497, 131.337], ['C', ' CA ', 177.412, 81.529, 131.196], ['C', ' C ', 176.514, 81.528, 132.431], ['C', ' O ', 175.407, 81.004, 132.389], ['C', ' CB ', 177.912, 80.114, 130.883], ['C', ' CG ', 178.76, 80.012, 129.602], ['C', ' CD ', 179.151, 78.576, 129.326], ['C', ' CE ', 180.037, 78.466, 128.098], ['C', ' NZ ', 180.473, 77.06, 127.854], ['C', ' H ', 178.335, 83.422, 130.952], ['C', ' HA ', 176.797, 81.841, 130.352], ['C', ' HB ', 178.44, 79.677, 131.723], ['C', ' HB ', 177.042, 79.479, 130.716], ['C', ' HG ', 178.188, 80.397, 128.76], ['C', ' HG ', 179.665, 80.603, 129.701], ['C', ' HD ', 179.689, 78.181, 130.189], ['C', ' HD ', 178.254, 77.979, 129.173], ['C', ' HE ', 179.489, 78.822, 127.227], ['C', ' HE ', 180.921, 79.09, 128.238], ['C', ' HZ ', 181.06, 77.024, 127.033], ['C', ' HZ ', 180.994, 76.724, 128.652], ['C', ' HZ ', 179.663, 76.473, 127.712]] AA_SCO= 1.513684210526316 CA_SCO= 1.6904736842105264
[['C', ' N ', 176.821, 82.367, 133.426], ['C', ' CA ', 175.861, 82.554, 134.518], ['C', ' C ', 174.88, 83.629, 134.043], ['C', ' O ', 173.891, 83.956, 134.698], ['C', ' CB ', 176.556, 82.946, 135.812], ['C', ' CG ', 177.473, 81.871, 136.357], ['C', ' CD ', 176.746, 80.641, 136.829], ['C', ' OE1', 175.834, 80.773, 137.606], ['C', ' OE2', 177.1, 79.564, 136.412], ['C', ' H ', 177.743, 82.819, 133.504], ['C', ' HA ', 175.315, 81.624, 134.686], ['C', ' HB ', 177.157, 83.826, 135.633], ['C', ' HB ', 175.816, 83.194, 136.571], ['C', ' HG ', 178.15, 81.578, 135.562], ['C', ' HG ', 178.061, 82.282, 137.169]] AA_SCO= 1.656842105263158 CA_SCO= 1.671421052631579
[['C', ' N ', 175.184, 84.121, 132.84], ['C', ' CA ', 174.496, 85.099, 132.037], ['C', ' C ', 173.814, 84.383, 130.854], ['C', ' O ', 173.267, 85.023, 129.961], ['C', ' CB ', 175.495, 86.116, 131.467], ['C', ' OG1', 176.431, 85.446, 130.595], ['C', ' CG2', 176.266, 86.735, 132.588], ['C', ' H ', 176.047, 83.782, 132.455], ['C', ' HA ', 173.758, 85.613, 132.646], ['C', ' HB ', 174.97, 86.887, 130.931], ['C', ' HG1', 176.009, 85.298, 129.726], ['C', ' HG2', 176.974, 87.46, 132.186], ['C', ' HG2', 175.577, 87.234, 133.254], ['C', ' HG2', 176.81, 85.971, 133.138]] AA_SCO= 1.7226315789473683 CA_SCO= 1.7555263157894736
[['C', ' N ', 173.869, 83.045, 130.824], ['C', ' CA ', 173.372, 82.242, 129.704], ['C', ' C ', 171.909, 82.458, 129.379], ['C', ' O ', 171.516, 82.389, 128.223], ['C', ' CB ', 173.587, 80.755, 129.96], ['C', ' CG ', 173.173, 79.893, 128.838], ['C', ' ND1', 173.906, 79.784, 127.677], ['C', ' CD2', 172.095, 79.097, 128.68], ['C', ' CE1', 173.297, 78.954, 126.855], ['C', ' NE2', 172.195, 78.521, 127.439], ['C', ' H ', 174.297, 82.534, 131.596], ['C', ' HA ', 173.935, 82.504, 128.807], ['C', ' HB ', 174.637, 80.567, 130.119], ['C', ' HB ', 173.055, 80.449, 130.858], ['C', ' HD1', 174.762, 80.253, 127.47], ['C', ' HD2', 171.245, 78.868, 129.323], ['C', ' HE1', 173.721, 78.733, 125.877]] AA_SCO= 1.7899999999999998 CA_SCO= 1.7933684210526315
[['C', ' N ', 171.078, 82.632, 130.388], ['C', ' CA ', 169.653, 82.806, 130.156], ['C', ' C ', 169.23, 84.27, 130.051], ['C', ' O ', 168.037, 84.568, 130.099], ['C', ' H ', 171.44, 82.637, 131.331], ['C', ' HA ', 169.373, 82.282, 129.243], ['C', ' HA ', 169.103, 82.334, 130.968]] AA_SCO= 1.916315789473684 CA_SCO= 1.6945789473684212
[['C', ' N ', 170.192, 85.188, 129.98], ['C', ' CA ', 169.878, 86.603, 129.996], ['C', ' C ', 170.071, 87.46, 128.738], ['C', ' O ', 169.779, 88.668, 128.793], ['C', ' CB ', 170.697, 87.219, 131.103], ['C', ' CG ', 170.3, 86.811, 132.448], ['C', ' CD1', 170.88, 85.736, 133.054], ['C', ' CD2', 169.351, 87.545, 133.102], ['C', ' CE1', 170.512, 85.386, 134.32], ['C', ' CE2', 168.975, 87.205, 134.362], ['C', ' CZ ', 169.551, 86.127, 134.977], ['C', ' OH ', 169.17, 85.785, 136.248], ['C', ' H ', 171.174, 84.909, 129.915], ['C', ' HA ', 168.825, 86.69, 130.263], ['C', ' HB ', 171.744, 86.951, 130.966], ['C', ' HB ', 170.633, 88.245, 131.037], ['C', ' HD1', 171.623, 85.157, 132.537], ['C', ' HD2', 168.893, 88.406, 132.614], ['C', ' HE1', 170.975, 84.523, 134.804], ['C', ' HE2', 168.216, 87.794, 134.878], ['C', ' HH ', 168.47, 86.376, 136.543]] AA_SCO= 1.933684210526316 CA_SCO= 1.6667368421052629
[['C', ' N ', 170.573, 86.908, 127.629], ['C', ' CA ', 170.849, 87.733, 126.452], ['C', ' C ', 169.599, 87.886, 125.609], ['C', ' O ', 168.66, 87.095, 125.707], ['C', ' CB ', 171.992, 87.173, 125.604], ['C', ' CG ', 171.634, 86.09, 124.591], ['C', ' CD ', 171.412, 84.772, 125.166], ['C', ' OE1', 171.092, 84.7, 126.323], ['C', ' OE2', 171.559, 83.795, 124.451], ['C', ' H ', 170.782, 85.905, 127.569], ['C', ' HA ', 171.147, 88.725, 126.779], ['C', ' HB ', 172.447, 87.999, 125.062], ['C', ' HB ', 172.761, 86.763, 126.261], ['C', ' HG ', 170.763, 86.374, 124.008], ['C', ' HG ', 172.468, 86.011, 123.894]] AA_SCO= 2.0894736842105264 CA_SCO= 1.6662105263157891
[['C', ' N ', 169.565, 88.915, 124.787], ['C', ' CA ', 168.415, 89.111, 123.926], ['C', ' C ', 168.276, 88.077, 122.828], ['C', ' O ', 169.234, 87.778, 122.107], ['C', ' CB ', 168.426, 90.489, 123.333], ['C', ' CG ', 167.226, 90.815, 122.514], ['C', ' CD ', 167.074, 92.247, 122.296], ['C', ' OE1', 167.134, 93.018, 123.256], ['C', ' NE2', 166.839, 92.677, 121.091], ['C', ' H ', 170.37, 89.55, 124.762], ['C', ' HA ', 167.526, 89.037, 124.553], ['C', ' HB ', 168.557, 91.229, 124.103], ['C', ' HB ', 169.265, 90.529, 122.67], ['C', ' HG ', 167.341, 90.37, 121.538], ['C', ' HG ', 166.326, 90.448, 123.002], ['C', ' HE2', 166.733, 93.658, 120.924], ['C', ' HE2', 166.722, 92.05, 120.3]] AA_SCO= 2.1578947368421053 CA_SCO= 1.6482631578947367
[['C', ' N ', 167.029, 87.651, 122.616], ['C', ' CA ', 166.641, 86.621, 121.657], ['C', ' C ', 167.104, 86.893, 120.241], ['C', ' O ', 167.424, 85.967, 119.499], ['C', ' CB ', 165.139, 86.467, 121.636], ['C', ' H ', 166.314, 88.005, 123.238], ['C', ' HA ', 167.081, 85.69, 121.993], ['C', ' HB ', 164.867, 85.665, 120.946], ['C', ' HB ', 164.783, 86.225, 122.636], ['C', ' HB ', 164.681, 87.398, 121.3]] AA_SCO= 2.14421052631579 CA_SCO= 1.5279473684210523
[['C', ' N ', 167.198, 88.139, 119.848], ['C', ' CA ', 167.617, 88.434, 118.488], ['C', ' C ', 168.997, 87.849, 118.101], ['C', ' O ', 169.257, 87.717, 116.894], ['C', ' H ', 166.931, 88.899, 120.45], ['C', ' HA ', 166.858, 88.047, 117.806], ['C', ' HA ', 167.621, 89.514, 118.348]] AA_SCO= 2.1789473684210527 CA_SCO= 1.5387894736842103
[['C', ' N ', 169.907, 87.524, 119.095], ['C', ' CA ', 171.21, 86.929, 118.812], ['C', ' C ', 171.256, 85.447, 119.125], ['C', ' O ', 172.306, 84.817, 119.038], ['C', ' CB ', 172.393, 87.665, 119.511], ['C', ' SG ', 172.958, 89.208, 118.698], ['C', ' H ', 169.636, 87.672, 120.068], ['C', ' HA ', 171.392, 86.998, 117.746], ['C', ' HB ', 172.104, 87.924, 120.535], ['C', ' HB ', 173.267, 87.013, 119.591]] AA_SCO= 2.1900000000000004 CA_SCO= 1.5785263157894733
[['C', ' N ', 170.086, 84.825, 119.209], ['C', ' CA ', 170.09, 83.376, 119.285], ['C', ' C ', 170.507, 82.925, 117.898], ['C', ' O ', 171.035, 81.836, 117.706], ['C', ' CB ', 168.722, 82.802, 119.664], ['C', ' CG ', 168.263, 83.107, 121.076], ['C', ' CD ', 169.08, 82.404, 122.147], ['C', ' CE ', 168.518, 82.688, 123.542], ['C', ' NZ ', 169.369, 82.093, 124.615], ['C', ' H ', 169.202, 85.348, 119.26], ['C', ' HA ', 170.846, 83.044, 119.994], ['C', ' HB ', 167.967, 83.213, 118.989], ['C', ' HB ', 168.725, 81.722, 119.529], ['C', ' HG ', 168.412, 84.161, 121.225], ['C', ' HG ', 167.206, 82.879, 121.193], ['C', ' HD ', 169.09, 81.326, 121.965], ['C', ' HD ', 170.108, 82.769, 122.137], ['C', ' HE ', 168.474, 83.77, 123.692], ['C', ' HE ', 167.513, 82.277, 123.619], ['C', ' HZ ', 168.989, 82.318, 125.522], ['C', ' HZ ', 169.434, 81.096, 124.517], ['C', ' HZ ', 170.305, 82.508, 124.538]] AA_SCO= 2.1700000000000004 CA_SCO= 1.5567894736842103
[['C', ' N ', 170.252, 83.793, 116.921], ['C', ' CA ', 170.593, 83.555, 115.545], ['C', ' C ', 171.641, 84.547, 114.952], ['C', ' O ', 171.647, 84.716, 113.729], ['C', ' CB ', 169.331, 83.543, 114.683], ['C', ' CG1', 168.59, 84.887, 114.75], ['C', ' CG2', 168.425, 82.411, 115.218], ['C', ' CD1', 167.5, 85.052, 113.7], ['C', ' H ', 169.799, 84.666, 117.161], ['C', ' HA ', 171.026, 82.559, 115.482], ['C', ' HB ', 169.6, 83.358, 113.653], ['C', ' HG1', 168.135, 85.004, 115.736], ['C', ' HG1', 169.313, 85.694, 114.608], ['C', ' HG2', 167.533, 82.335, 114.624], ['C', ' HG2', 168.95, 81.472, 115.186], ['C', ' HG2', 168.149, 82.612, 116.248], ['C', ' HD1', 167.055, 86.036, 113.815], ['C', ' HD1', 167.941, 84.967, 112.699], ['C', ' HD1', 166.731, 84.297, 113.813]] AA_SCO= 2.348421052631579 CA_SCO= 1.5290526315789474
[['C', ' N ', 172.492, 85.234, 115.795], ['C', ' CA ', 173.581, 86.116, 115.305], ['C', ' C ', 174.744, 85.165, 115.085], ['C', ' O ', 175.114, 84.4, 115.978], ['C', ' CB ', 174.043, 87.299, 116.269], ['C', ' SG ', 172.904, 88.766, 116.562], ['C', ' H ', 172.428, 85.036, 116.801], ['C', ' HA ', 173.29, 86.569, 114.354], ['C', ' HB ', 174.242, 86.876, 117.246], ['C', ' HB ', 174.998, 87.72, 115.911]] AA_SCO= 2.3247368421052634 CA_SCO= 1.5365263157894737
[['C', ' N ', 175.296, 85.201, 113.893], ['C', ' CA ', 176.389, 84.312, 113.503], ['C', ' C ', 177.728, 85.04, 113.331], ['C', ' O ', 178.819, 84.485, 113.495], ['C', ' CB ', 175.933, 83.633, 112.209], ['C', ' CG ', 175.775, 84.614, 111.055], ['C', ' CD ', 175.139, 84.002, 109.829], ['C', ' CE ', 174.913, 85.11, 108.783], ['C', ' NZ ', 174.193, 84.648, 107.575], ['C', ' H ', 174.907, 85.854, 113.225], ['C', ' HA ', 176.513, 83.556, 114.279], ['C', ' HB ', 176.63, 82.866, 111.915], ['C', ' HB ', 174.97, 83.155, 112.374], ['C', ' HG ', 175.175, 85.466, 111.361], ['C', ' HG ', 176.758, 84.978, 110.757], ['C', ' HD ', 175.79, 83.233, 109.414], ['C', ' HD ', 174.174, 83.552, 110.084], ['C', ' HE ', 174.327, 85.904, 109.245], ['C', ' HE ', 175.878, 85.516, 108.48], ['C', ' HZ ', 174.063, 85.46, 106.935], ['C', ' HZ ', 174.706, 83.932, 107.108], ['C', ' HZ ', 173.259, 84.278, 107.823]] AA_SCO= 2.5115789473684216 CA_SCO= 1.5518421052631581
[['C', ' N ', 177.649, 86.305, 113.001], ['C', ' CA ', 178.8, 87.101, 112.66], ['C', ' C ', 179.496, 87.757, 113.825], ['C', ' O ', 179.447, 88.969, 113.987], ['C', ' CB ', 178.391, 88.12, 111.614], ['C', ' CG ', 177.21, 88.91, 112.048], ['C', ' OD1', 176.443, 88.392, 112.864], ['C', ' OD2', 177.032, 89.991, 111.563], ['C', ' H ', 176.744, 86.763, 112.949], ['C', ' HA ', 179.525, 86.439, 112.186], ['C', ' HB ', 179.226, 88.8, 111.426], ['C', ' HB ', 178.164, 87.613, 110.671]] AA_SCO= 2.4821052631578944 CA_SCO= 1.5546315789473684
[['C', ' N ', 180.208, 86.959, 114.616], ['C', ' CA ', 180.891, 87.506, 115.801], ['C', ' C ', 181.716, 88.691, 115.345], ['C', ' O ', 181.661, 89.801, 115.893], ['C', ' CB ', 181.832, 86.464, 116.439], ['C', ' CG ', 182.551, 86.99, 117.616], ['C', ' CD1', 181.881, 87.138, 118.78], ['C', ' CD2', 183.864, 87.319, 117.551], ['C', ' CE1', 182.505, 87.637, 119.869], ['C', ' CE2', 184.487, 87.81, 118.65], ['C', ' CZ ', 183.806, 87.976, 119.807], ['C', ' OH ', 184.428, 88.491, 120.916], ['C', ' H ', 180.165, 85.96, 114.397], ['C', ' HA ', 180.151, 87.85, 116.526], ['C', ' HB ', 181.308, 85.577, 116.735], ['C', ' HB ', 182.573, 86.156, 115.709], ['C', ' HD1', 180.834, 86.869, 118.836], ['C', ' HD2', 184.413, 87.199, 116.636], ['C', ' HE1', 181.965, 87.768, 120.782], ['C', ' HE2', 185.523, 88.082, 118.603], ['C', ' HH ', 183.796, 88.567, 121.635]] AA_SCO= 2.444736842105263 CA_SCO= 1.3084736842105265
[['C', ' N ', 182.456, 88.441, 114.287], ['C', ' CA ', 183.292, 89.417, 113.649], ['C', ' C ', 182.441, 90.204, 112.666], ['C', ' O ', 181.823, 89.624, 111.771], ['C', ' CB ', 184.432, 88.691, 112.933], ['C', ' CG1', 185.267, 89.631, 112.179], ['C', ' CG2', 185.261, 87.978, 113.957], ['C', ' H ', 182.395, 87.511, 113.901], ['C', ' HA ', 183.693, 90.088, 114.403], ['C', ' HB ', 184.017, 87.97, 112.226], ['C', ' HG1', 186.062, 89.07, 111.697], ['C', ' HG1', 184.664, 90.137, 111.425], ['C', ' HG1', 185.697, 90.36, 112.853], ['C', ' HG2', 186.057, 87.449, 113.478], ['C', ' HG2', 185.672, 88.702, 114.656], ['C', ' HG2', 184.649, 87.27, 114.487]] AA_SCO= 2.508421052631579 CA_SCO= 1.2727894736842105
[['C', ' N ', 182.492, 91.526, 112.745], ['C', ' CA ', 181.664, 92.368, 111.893], ['C', ' C ', 182.194, 92.422, 110.474], ['C', ' O ', 182.765, 93.407, 110.021], ['C', ' CB ', 181.578, 93.768, 112.478], ['C', ' H ', 183.043, 91.934, 113.482], ['C', ' HA ', 180.672, 91.929, 111.851], ['C', ' HB ', 180.929, 94.389, 111.86], ['C', ' HB ', 181.176, 93.722, 113.474], ['C', ' HB ', 182.556, 94.201, 112.513]] AA_SCO= 2.5078947368421054 CA_SCO= 1.266263157894737
[['C', ' N ', 181.919, 91.353, 109.756], ['C', ' CA ', 182.393, 91.097, 108.408], ['C', ' C ', 181.909, 92.093, 107.366], ['C', ' O ', 182.448, 92.157, 106.267], ['C', ' CB ', 182.023, 89.683, 107.994], ['C', ' CG ', 180.567, 89.419, 107.778], ['C', ' CD ', 180.316, 87.962, 107.462], ['C', ' OE1', 181.28, 87.236, 107.318], ['C', ' OE2', 179.169, 87.573, 107.317], ['C', ' H ', 181.438, 90.607, 110.26], ['C', ' HA ', 183.47, 91.142, 108.435], ['C', ' HB ', 182.55, 89.425, 107.077], ['C', ' HB ', 182.352, 88.996, 108.774], ['C', ' HG ', 179.999, 89.704, 108.665], ['C', ' HG ', 180.223, 90.018, 106.942]] AA_SCO= 2.4568421052631577 CA_SCO= 1.266263157894737
[['C', ' N ', 180.852, 92.816, 107.66], ['C', ' CA ', 180.352, 93.806, 106.724], ['C', ' C ', 180.879, 95.221, 107.015], ['C', ' O ', 180.518, 96.19, 106.342], ['C', ' CB ', 178.832, 93.76, 106.712], ['C', ' CG ', 178.169, 92.466, 106.187], ['C', ' CD1', 176.691, 92.584, 106.379], ['C', ' CD2', 178.476, 92.262, 104.697], ['C', ' H ', 180.415, 92.691, 108.56], ['C', ' HA ', 180.714, 93.547, 105.736], ['C', ' HB ', 178.49, 93.883, 107.726], ['C', ' HB ', 178.481, 94.564, 106.149], ['C', ' HG ', 178.522, 91.61, 106.755], ['C', ' HD1', 176.198, 91.677, 106.026], ['C', ' HD1', 176.501, 92.71, 107.432], ['C', ' HD1', 176.313, 93.44, 105.824], ['C', ' HD2', 177.976, 91.36, 104.355], ['C', ' HD2', 178.109, 93.114, 104.127], ['C', ' HD2', 179.542, 92.151, 104.532]] AA_SCO= 2.3194736842105264 CA_SCO= 1.2573684210526317
[['C', ' N ', 181.695, 95.35, 108.044], ['C', ' CA ', 182.268, 96.621, 108.462], ['C', ' C ', 183.415, 96.935, 107.536], ['C', ' O ', 183.843, 96.045, 106.818], ['C', ' CB ', 182.73, 96.557, 109.893], ['C', ' H ', 181.981, 94.513, 108.558], ['C', ' HA ', 181.516, 97.399, 108.356], ['C', ' HB ', 183.153, 97.516, 110.177], ['C', ' HB ', 181.892, 96.325, 110.538], ['C', ' HB ', 183.485, 95.788, 109.985]] AA_SCO= 2.306315789473684 CA_SCO= 1.2429473684210528
[['C', ' N ', 183.925, 98.171, 107.514], ['C', ' CA ', 185.076, 98.438, 106.657], ['C', ' C ', 186.307, 97.987, 107.425], ['C', ' O ', 187.269, 97.451, 106.864], ['C', ' CB ', 185.155, 99.941, 106.367], ['C', ' CG ', 183.981, 100.438, 105.535], ['C', ' OD1', 183.858, 100.039, 104.409], ['C', ' OD2', 183.157, 101.186, 106.046], ['C', ' H ', 183.574, 98.914, 108.122], ['C', ' HA ', 184.997, 97.866, 105.729], ['C', ' HB ', 185.172, 100.485, 107.312], ['C', ' HB ', 186.076, 100.166, 105.843]] AA_SCO= 2.322105263157895 CA_SCO= 1.2287368421052631
[['C', ' N ', 186.244, 98.206, 108.725], ['C', ' CA ', 187.25, 97.798, 109.687], ['C', ' C ', 186.503, 97.334, 110.915], ['C', ' O ', 185.474, 97.913, 111.224], ['C', ' CB ', 188.243, 98.951, 109.976], ['C', ' CG1', 187.517, 100.143, 110.499], ['C', ' CG2', 189.302, 98.511, 111.019], ['C', ' H ', 185.416, 98.706, 109.066], ['C', ' HA ', 187.802, 96.959, 109.278], ['C', ' HB ', 188.732, 99.226, 109.049], ['C', ' HG1', 188.218, 100.948, 110.677], ['C', ' HG1', 186.772, 100.468, 109.776], ['C', ' HG1', 187.036, 99.888, 111.419], ['C', ' HG2', 190.0, 99.327, 111.194], ['C', ' HG2', 188.828, 98.248, 111.961], ['C', ' HG2', 189.847, 97.649, 110.644]] AA_SCO= 2.2331578947368422 CA_SCO= 1.31
[['C', ' N ', 186.983, 96.328, 111.616], ['C', ' CA ', 186.311, 95.943, 112.85], ['C', ' C ', 187.291, 95.572, 113.931], ['C', ' O ', 188.423, 95.163, 113.663], ['C', ' CB ', 185.371, 94.789, 112.615], ['C', ' OG ', 186.067, 93.659, 112.211], ['C', ' H ', 187.814, 95.84, 111.278], ['C', ' HA ', 185.743, 96.795, 113.21], ['C', ' HB ', 184.825, 94.576, 113.535], ['C', ' HB ', 184.649, 95.063, 111.859], ['C', ' HG ', 185.418, 92.959, 112.155]] AA_SCO= 2.2463157894736847 CA_SCO= 1.3149473684210526
[['C', ' N ', 186.869, 95.751, 115.178], ['C', ' CA ', 187.725, 95.429, 116.3], ['C', ' C ', 187.07, 94.66, 117.442], ['C', ' O ', 185.843, 94.602, 117.582], ['C', ' CB ', 188.293, 96.709, 116.946], ['C', ' OG1', 187.228, 97.409, 117.593], ['C', ' CG2', 188.911, 97.642, 115.897], ['C', ' H ', 185.936, 96.132, 115.331], ['C', ' HA ', 188.521, 94.815, 115.916], ['C', ' HB ', 189.058, 96.438, 117.678], ['C', ' HG1', 186.88, 96.872, 118.313], ['C', ' HG2', 189.298, 98.529, 116.389], ['C', ' HG2', 189.71, 97.131, 115.393], ['C', ' HG2', 188.162, 97.94, 115.172]] AA_SCO= 2.328421052631579 CA_SCO= 1.3012105263157896
[['C', ' N ', 187.926, 94.174, 118.33], ['C', ' CA ', 187.526, 93.532, 119.588], ['C', ' C ', 188.782, 93.12, 120.318], ['C', ' O ', 189.85, 93.23, 119.754], ['C', ' H ', 188.917, 94.251, 118.069], ['C', ' HA ', 186.959, 94.237, 120.196], ['C', ' HA ', 186.89, 92.68, 119.413]] AA_SCO= 2.2694736842105265 CA_SCO= 1.3190526315789475
[['C', ' N ', 188.696, 92.592, 121.524], ['C', ' CA ', 189.908, 92.265, 122.29], ['C', ' C ', 190.29, 90.795, 122.344], ['C', ' O ', 191.207, 90.403, 123.06], ['C', ' CB ', 189.737, 92.776, 123.691], ['C', ' OG ', 188.658, 92.151, 124.312], ['C', ' H ', 187.795, 92.468, 121.973], ['C', ' HA ', 190.74, 92.8, 121.843], ['C', ' HB ', 190.651, 92.599, 124.264], ['C', ' HB ', 189.573, 93.847, 123.667], ['C', ' HG ', 188.608, 92.547, 125.202]] AA_SCO= 2.3668421052631583 CA_SCO= 1.4374210526315792
[['C', ' N ', 189.641, 89.976, 121.558], ['C', ' CA ', 189.837, 88.537, 121.656], ['C', ' C ', 191.26, 88.047, 121.414], ['C', ' O ', 191.733, 87.16, 122.111], ['C', ' CB ', 188.915, 87.849, 120.66], ['C', ' CG1', 189.203, 86.346, 120.592], ['C', ' CG2', 187.508, 88.109, 121.06], ['C', ' H ', 188.951, 90.369, 120.938], ['C', ' HA ', 189.545, 88.235, 122.663], ['C', ' HB ', 189.087, 88.259, 119.672], ['C', ' HG1', 188.53, 85.906, 119.903], ['C', ' HG1', 190.223, 86.137, 120.271], ['C', ' HG1', 189.042, 85.909, 121.575], ['C', ' HG2', 186.856, 87.641, 120.349], ['C', ' HG2', 187.326, 87.694, 122.05], ['C', ' HG2', 187.304, 89.174, 121.081]] AA_SCO= 2.3710526315789475 CA_SCO= 1.4390526315789474
[['C', ' N ', 191.93, 88.589, 120.421], ['C', ' CA ', 193.288, 88.171, 120.079], ['C', ' C ', 194.351, 89.037, 120.741], ['C', ' O ', 195.508, 89.03, 120.326], ['C', ' H ', 191.488, 89.316, 119.879], ['C', ' HA ', 193.436, 87.132, 120.371], ['C', ' HA ', 193.413, 88.212, 118.998]] AA_SCO= 2.273684210526316 CA_SCO= 1.383842105263158
[['C', ' N ', 193.971, 89.856, 121.718], ['C', ' CA ', 194.947, 90.76, 122.284], ['C', ' C ', 195.102, 90.718, 123.812], ['C', ' O ', 194.201, 90.294, 124.531], ['C', ' CB ', 194.58, 92.14, 121.849], ['C', ' OG ', 194.728, 92.297, 120.469], ['C', ' H ', 193.01, 89.875, 122.076], ['C', ' HA ', 195.896, 90.503, 121.831], ['C', ' HB ', 193.542, 92.322, 122.123], ['C', ' HB ', 195.152, 92.83, 122.358], ['C', ' HG ', 194.58, 93.227, 120.297]] AA_SCO= 2.27842105263158 CA_SCO= 1.3896842105263159
[['C', ' N ', 196.273, 91.114, 124.342], ['C', ' CA ', 196.559, 91.297, 125.749], ['C', ' C ', 195.849, 92.538, 126.241], ['C', ' O ', 195.56, 93.428, 125.446], ['C', ' CB ', 198.072, 91.451, 125.779], ['C', ' CG ', 198.408, 92.006, 124.453], ['C', ' CD ', 197.434, 91.358, 123.486], ['C', ' HA ', 196.232, 90.407, 126.309], ['C', ' HB ', 198.359, 92.129, 126.6], ['C', ' HB ', 198.551, 90.476, 125.977], ['C', ' HG ', 198.296, 93.079, 124.484], ['C', ' HG ', 199.454, 91.814, 124.235], ['C', ' HD ', 197.244, 92.073, 122.687], ['C', ' HD ', 197.809, 90.4, 123.11]] AA_SCO= 2.262631578947369 CA_SCO= 1.4144736842105263
[['C', ' N ', 195.669, 92.659, 127.539], ['C', ' CA ', 194.979, 93.824, 128.07], ['C', ' C ', 195.543, 95.138, 127.56], ['C', ' O ', 196.749, 95.393, 127.637], ['C', ' CB ', 195.142, 93.887, 129.586], ['C', ' CG ', 194.502, 92.768, 130.367], ['C', ' OD1', 193.808, 91.943, 129.815], ['C', ' OD2', 194.714, 92.739, 131.55], ['C', ' H ', 195.941, 91.914, 128.17], ['C', ' HA ', 193.919, 93.771, 127.794], ['C', ' HB ', 196.206, 93.901, 129.824], ['C', ' HB ', 194.727, 94.833, 129.941]] AA_SCO= 2.2157894736842105 CA_SCO= 1.4152631578947368
[['C', ' N ', 194.644, 95.999, 127.084], ['C', ' CA ', 194.982, 97.323, 126.583], ['C', ' C ', 195.083, 97.377, 125.071], ['C', ' O ', 194.955, 98.453, 124.482], ['C', ' H ', 193.647, 95.716, 127.049], ['C', ' HA ', 194.23, 98.034, 126.927], ['C', ' HA ', 195.934, 97.627, 127.014]] AA_SCO= 2.2089473684210525 CA_SCO= 1.4150526315789473
[['C', ' N ', 195.201, 96.221, 124.445], ['C', ' CA ', 195.323, 96.063, 123.006], ['C', ' C ', 194.065, 95.47, 122.432], ['C', ' O ', 193.378, 94.703, 123.101], ['C', ' CB ', 196.491, 95.143, 122.697], ['C', ' CG ', 197.801, 95.676, 122.97], ['C', ' CD1', 198.399, 95.78, 124.174], ['C', ' CD2', 198.75, 96.125, 122.01], ['C', ' NE1', 199.652, 96.282, 124.027], ['C', ' CE2', 199.881, 96.503, 122.706], ['C', ' CE3', 198.737, 96.223, 120.638], ['C', ' CZ2', 200.989, 96.989, 122.072], ['C', ' CZ3', 199.848, 96.703, 119.998], ['C', ' CH2', 200.943, 97.079, 120.696], ['C', ' H ', 195.251, 95.355, 124.997], ['C', ' HA ', 195.482, 97.024, 122.544], ['C', ' HB ', 196.407, 94.277, 123.318], ['C', ' HB ', 196.446, 94.823, 121.66], ['C', ' HD1', 197.943, 95.492, 125.129], ['C', ' HE1', 200.308, 96.445, 124.78], ['C', ' HE3', 197.867, 95.919, 120.078], ['C', ' HZ2', 201.883, 97.295, 122.617], ['C', ' HZ3', 199.834, 96.77, 118.924], ['C', ' HH2', 201.812, 97.46, 120.157]] AA_SCO= 2.220526315789474 CA_SCO= 1.4127894736842106
[['C', ' N ', 193.774, 95.748, 121.175], ['C', ' CA ', 192.628, 95.107, 120.557], ['C', ' C ', 192.981, 94.618, 119.162], ['C', ' O ', 193.959, 95.048, 118.558], ['C', ' CB ', 191.46, 96.062, 120.524], ['C', ' OG ', 191.748, 97.151, 119.736], ['C', ' H ', 194.323, 96.426, 120.637], ['C', ' HA ', 192.342, 94.245, 121.152], ['C', ' HB ', 190.58, 95.566, 120.142], ['C', ' HB ', 191.232, 96.393, 121.537], ['C', ' HG ', 190.998, 97.755, 119.837]] AA_SCO= 2.3100000000000005 CA_SCO= 1.6539473684210526
[['C', ' N ', 192.234, 93.652, 118.684], ['C', ' CA ', 192.391, 93.084, 117.362], ['C', ' C ', 191.739, 94.003, 116.378], ['C', ' O ', 190.625, 94.46, 116.619], ['C', ' CB ', 191.732, 91.698, 117.292], ['C', ' OG1', 192.374, 90.833, 118.233], ['C', ' CG2', 191.833, 91.104, 115.876], ['C', ' H ', 191.463, 93.339, 119.246], ['C', ' HA ', 193.445, 92.997, 117.119], ['C', ' HB ', 190.68, 91.787, 117.566], ['C', ' HG1', 192.275, 91.214, 119.113], ['C', ' HG2', 191.368, 90.126, 115.861], ['C', ' HG2', 191.327, 91.745, 115.16], ['C', ' HG2', 192.869, 91.01, 115.593]] AA_SCO= 2.2868421052631582 CA_SCO= 1.670421052631579
[['C', ' N ', 192.423, 94.289, 115.284], ['C', ' CA ', 191.895, 95.122, 114.228], ['C', ' C ', 191.894, 94.389, 112.909], ['C', ' O ', 192.949, 93.986, 112.407], ['C', ' CB ', 192.797, 96.346, 114.032], ['C', ' CG1', 192.251, 97.26, 112.931], ['C', ' CG2', 192.965, 97.052, 115.292], ['C', ' H ', 193.354, 93.901, 115.182], ['C', ' HA ', 190.876, 95.414, 114.472], ['C', ' HB ', 193.765, 96.007, 113.702], ['C', ' HG1', 192.926, 98.102, 112.795], ['C', ' HG1', 192.17, 96.722, 111.988], ['C', ' HG1', 191.268, 97.627, 113.22], ['C', ' HG2', 193.625, 97.88, 115.107], ['C', ' HG2', 192.008, 97.408, 115.646], ['C', ' HG2', 193.406, 96.398, 116.048]] AA_SCO= 2.216315789473684 CA_SCO= 1.6768421052631581
[['C', ' N ', 190.737, 94.27, 112.302], ['C', ' CA ', 190.681, 93.631, 111.017], ['C', ' C ', 190.242, 94.62, 109.971], ['C', ' O ', 189.151, 95.185, 110.065], ['C', ' CB ', 189.686, 92.472, 110.986], ['C', ' CG1', 190.044, 91.435, 112.045], ['C', ' CG2', 189.728, 91.884, 109.578], ['C', ' CD1', 189.044, 90.332, 112.208], ['C', ' H ', 189.891, 94.596, 112.772], ['C', ' HA ', 191.67, 93.265, 110.745], ['C', ' HB ', 188.68, 92.822, 111.218], ['C', ' HG1', 190.945, 91.01, 111.829], ['C', ' HG1', 190.126, 91.941, 112.997], ['C', ' HG2', 189.086, 91.065, 109.5], ['C', ' HG2', 189.43, 92.619, 108.837], ['C', ' HG2', 190.715, 91.561, 109.346], ['C', ' HD1', 189.381, 89.667, 112.996], ['C', ' HD1', 188.084, 90.761, 112.48], ['C', ' HD1', 188.942, 89.766, 111.296]] AA_SCO= 2.2357894736842105 CA_SCO= 1.6805263157894736
[['C', ' N ', 191.057, 94.815, 108.949], ['C', ' CA ', 190.672, 95.723, 107.884], ['C', ' C ', 190.165, 94.857, 106.748], ['C', ' O ', 190.807, 93.867, 106.35], ['C', ' CB ', 191.849, 96.598, 107.463], ['C', ' OG1', 192.931, 95.751, 107.085], ['C', ' CG2', 192.273, 97.489, 108.638], ['C', ' H ', 191.958, 94.32, 108.912], ['C', ' HA ', 189.861, 96.368, 108.217], ['C', ' HB ', 191.558, 97.203, 106.621], ['C', ' HG1', 193.613, 96.234, 106.615], ['C', ' HG2', 193.118, 98.104, 108.363], ['C', ' HG2', 191.441, 98.129, 108.919], ['C', ' HG2', 192.553, 96.867, 109.483]] AA_SCO= 2.3157894736842106 CA_SCO= 1.7069473684210528
[['C', ' N ', 188.965, 95.178, 106.278], ['C', ' CA ', 188.27, 94.389, 105.282], ['C', ' C ', 187.483, 95.142, 104.218], ['C', ' O ', 186.287, 95.323, 104.382], ['C', ' CB ', 187.343, 93.45, 105.987], ['C', ' CG ', 186.41, 94.085, 106.966], ['C', ' CD ', 185.365, 93.175, 107.269], ['C', ' NE ', 185.882, 91.97, 107.817], ['C', ' CZ ', 186.135, 91.77, 109.098], ['C', ' NH1', 185.898, 92.724, 109.969], ['C', ' NH2', 186.621, 90.625, 109.46], ['C', ' H ', 188.488, 96.026, 106.606], ['C', ' HA ', 189.017, 93.792, 104.764], ['C', ' HB ', 186.76, 92.885, 105.264], ['C', ' HB ', 187.935, 92.747, 106.562], ['C', ' HG ', 186.963, 94.286, 107.882], ['C', ' HG ', 185.992, 95.0, 106.629], ['C', ' HD ', 184.649, 93.62, 107.959], ['C', ' HD ', 184.854, 92.931, 106.342], ['C', ' HE ', 186.108, 91.22, 107.148], ['C', ' HH1', 185.52, 93.608, 109.653], ['C', ' HH1', 186.11, 92.626, 110.96], ['C', ' HH2', 186.807, 89.918, 108.763], ['C', ' HH2', 186.827, 90.449, 110.428]] AA_SCO= 2.315263157894737 CA_SCO= 1.6647894736842106
[['C', ' N ', 188.119, 95.515, 103.119], ['C', ' CA ', 187.553, 96.335, 102.027], ['C', ' C ', 188.318, 97.611, 101.991], ['C', ' O ', 188.505, 98.266, 103.029], ['C', ' CB ', 186.035, 96.701, 102.141], ['C', ' OG1', 185.248, 95.524, 102.163], ['C', ' CG2', 185.577, 97.543, 100.95], ['C', ' H ', 189.095, 95.269, 103.049], ['C', ' HA ', 187.706, 95.822, 101.078], ['C', ' HB ', 185.856, 97.286, 103.05], ['C', ' HG1', 185.354, 95.165, 103.039], ['C', ' HG2', 184.517, 97.766, 101.065], ['C', ' HG2', 186.125, 98.476, 100.901], ['C', ' HG2', 185.726, 96.984, 100.026]] AA_SCO= 2.333157894736842 CA_SCO= 1.6554736842105264
[['C', ' N ', 188.773, 97.965, 100.788], ['C', ' CA ', 189.552, 99.161, 100.655], ['C', ' C ', 188.682, 100.287, 101.145], ['C', ' O ', 187.629, 100.563, 100.568], ['C', ' CB ', 189.912, 99.412, 99.192], ['C', ' CG ', 190.855, 98.355, 98.57], ['C', ' OD1', 191.324, 97.457, 99.26], ['C', ' OD2', 191.105, 98.462, 97.399], ['C', ' H ', 188.595, 97.386, 99.98], ['C', ' HA ', 190.449, 99.09, 101.261], ['C', ' HB ', 188.998, 99.447, 98.601], ['C', ' HB ', 190.385, 100.391, 99.108]] AA_SCO= 2.3636842105263156 CA_SCO= 1.6771578947368422
[['C', ' N ', 189.156, 100.931, 102.191], ['C', ' CA ', 188.514, 102.012, 102.928], ['C', ' C ', 188.971, 101.899, 104.359], ['C', ' O ', 189.449, 102.87, 104.955], ['C', ' CB ', 186.983, 101.961, 102.893], ['C', ' H ', 190.058, 100.585, 102.532], ['C', ' HA ', 188.855, 102.964, 102.528], ['C', ' HB ', 186.589, 102.776, 103.499], ['C', ' HB ', 186.594, 102.076, 101.897], ['C', ' HB ', 186.633, 101.014, 103.305]] AA_SCO= 2.2673684210526317 CA_SCO= 1.696842105263158
[['C', ' N ', 188.762, 100.705, 104.926], ['C', ' CA ', 189.12, 100.431, 106.306], ['C', ' C ', 190.618, 100.353, 106.464], ['C', ' O ', 191.18, 100.799, 107.468], ['C', ' H ', 188.392, 99.933, 104.356], ['C', ' HA ', 188.71, 101.201, 106.958], ['C', ' HA ', 188.678, 99.485, 106.604]] AA_SCO= 2.1694736842105264 CA_SCO= 1.6398947368421053
[['C', ' N ', 191.277, 99.802, 105.451], ['C', ' CA ', 192.706, 99.636, 105.501], ['C', ' C ', 193.345, 100.955, 105.24], ['C', ' O ', 194.372, 101.262, 105.814], ['C', ' CB ', 193.144, 98.663, 104.434], ['C', ' CG ', 192.694, 99.172, 103.109], ['C', ' OD1', 191.63, 99.838, 103.087], ['C', ' OD2', 193.379, 98.962, 102.136], ['C', ' H ', 190.772, 99.484, 104.622], ['C', ' HA ', 193.009, 99.295, 106.483], ['C', ' HB ', 194.23, 98.562, 104.443], ['C', ' HB ', 192.708, 97.683, 104.607]] AA_SCO= 2.143157894736842 CA_SCO= 1.6022631578947368
[['C', ' N ', 192.689, 101.749, 104.422], ['C', ' CA ', 193.183, 103.042, 104.05], ['C', ' C ', 193.186, 103.938, 105.254], ['C', ' O ', 194.22, 104.505, 105.593], ['C', ' CB ', 192.32, 103.625, 102.959], ['C', ' OG ', 192.774, 104.891, 102.586], ['C', ' H ', 191.871, 101.35, 103.983], ['C', ' HA ', 194.203, 102.937, 103.684], ['C', ' HB ', 192.322, 102.956, 102.101], ['C', ' HB ', 191.297, 103.699, 103.312], ['C', ' HG ', 192.202, 105.176, 101.872]] AA_SCO= 2.175263157894737 CA_SCO= 1.497421052631579
[['C', ' N ', 192.082, 104.008, 105.981], ['C', ' CA ', 192.11, 104.893, 107.119], ['C', ' C ', 193.025, 104.388, 108.217], ['C', ' O ', 193.647, 105.182, 108.917], ['C', ' CB ', 190.702, 105.182, 107.66], ['C', ' CG1', 190.723, 106.355, 108.693], ['C', ' CG2', 190.092, 103.955, 108.281], ['C', ' CD1', 191.129, 107.704, 108.158], ['C', ' H ', 191.232, 103.516, 105.689], ['C', ' HA ', 192.517, 105.833, 106.764], ['C', ' HB ', 190.071, 105.492, 106.829], ['C', ' HG1', 189.729, 106.444, 109.095], ['C', ' HG1', 191.393, 106.125, 109.496], ['C', ' HG2', 189.115, 104.195, 108.619], ['C', ' HG2', 190.039, 103.168, 107.547], ['C', ' HG2', 190.659, 103.613, 109.115], ['C', ' HD1', 191.08, 108.435, 108.958], ['C', ' HD1', 192.143, 107.689, 107.776], ['C', ' HD1', 190.461, 107.982, 107.371]] AA_SCO= 2.1615789473684215 CA_SCO= 1.4608947368421052
[['C', ' N ', 193.104, 103.068, 108.41], ['C', ' CA ', 193.976, 102.574, 109.446], ['C', ' C ', 195.434, 102.802, 109.032], ['C', ' O ', 196.234, 103.271, 109.822], ['C', ' CB ', 193.671, 101.116, 109.76], ['C', ' CG ', 194.346, 100.636, 110.995], ['C', ' CD1', 193.894, 101.069, 112.234], ['C', ' CD2', 195.405, 99.773, 110.95], ['C', ' CE1', 194.488, 100.663, 113.392], ['C', ' CE2', 196.006, 99.358, 112.118], ['C', ' CZ ', 195.544, 99.809, 113.336], ['C', ' H ', 192.546, 102.408, 107.863], ['C', ' HA ', 193.804, 103.146, 110.348], ['C', ' HB ', 192.591, 100.985, 109.876], ['C', ' HB ', 193.985, 100.496, 108.921], ['C', ' HD1', 193.061, 101.747, 112.275], ['C', ' HD2', 195.776, 99.423, 109.985], ['C', ' HE1', 194.12, 101.024, 114.358], ['C', ' HE2', 196.853, 98.682, 112.079], ['C', ' HZ ', 196.026, 99.485, 114.243]] AA_SCO= 2.2957894736842106 CA_SCO= 1.526315789473684
[['C', ' N ', 195.778, 102.547, 107.771], ['C', ' CA ', 197.137, 102.744, 107.272], ['C', ' C ', 197.527, 104.214, 107.154], ['C', ' O ', 198.712, 104.53, 107.143], ['C', ' CB ', 197.356, 102.042, 105.943], ['C', ' CG ', 197.398, 100.553, 106.077], ['C', ' CD ', 197.606, 99.867, 104.746], ['C', ' CE ', 197.546, 98.37, 104.932], ['C', ' NZ ', 198.673, 97.862, 105.764], ['C', ' H ', 195.094, 102.176, 107.126], ['C', ' HA ', 197.818, 102.297, 107.996], ['C', ' HB ', 196.56, 102.316, 105.25], ['C', ' HB ', 198.296, 102.376, 105.509], ['C', ' HG ', 198.219, 100.302, 106.742], ['C', ' HG ', 196.477, 100.199, 106.531], ['C', ' HD ', 196.816, 100.172, 104.053], ['C', ' HD ', 198.571, 100.144, 104.325], ['C', ' HE ', 196.61, 98.125, 105.434], ['C', ' HE ', 197.565, 97.872, 103.964], ['C', ' HZ ', 198.547, 96.854, 105.89], ['C', ' HZ ', 199.556, 98.047, 105.321], ['C', ' HZ ', 198.654, 98.292, 106.668]] AA_SCO= 2.3389473684210524 CA_SCO= 1.5422105263157893
[['C', ' N ', 196.556, 105.127, 107.092], ['C', ' CA ', 196.86, 106.557, 107.114], ['C', ' C ', 197.189, 106.981, 108.54], ['C', ' O ', 197.595, 108.119, 108.778], ['C', ' CB ', 195.709, 107.398, 106.58], ['C', ' CG ', 195.468, 107.285, 105.1], ['C', ' CD ', 194.194, 107.977, 104.697], ['C', ' OE1', 193.402, 108.382, 105.553], ['C', ' NE2', 193.985, 108.124, 103.4], ['C', ' H ', 195.582, 104.836, 106.963], ['C', ' HA ', 197.74, 106.738, 106.498], ['C', ' HB ', 194.792, 107.092, 107.089], ['C', ' HB ', 195.88, 108.447, 106.817], ['C', ' HG ', 196.287, 107.798, 104.602], ['C', ' HG ', 195.453, 106.266, 104.777], ['C', ' HE2', 193.155, 108.577, 103.074], ['C', ' HE2', 194.654, 107.779, 102.739]] AA_SCO= 2.3452631578947365 CA_SCO= 1.547
[['C', ' N ', 196.945, 106.077, 109.475], ['C', ' CA ', 197.206, 106.173, 110.876], ['C', ' C ', 198.298, 105.129, 111.058], ['C', ' O ', 198.798, 104.614, 110.062], ['C', ' CB ', 195.972, 105.938, 111.714], ['C', ' H ', 196.619, 105.157, 109.192], ['C', ' HA ', 197.621, 107.156, 111.106], ['C', ' HB ', 196.241, 106.011, 112.747], ['C', ' HB ', 195.245, 106.683, 111.488], ['C', ' HB ', 195.556, 104.957, 111.498]] AA_SCO= 2.386842105263158 CA_SCO= 1.5444736842105262
[['C', ' N ', 198.755, 104.88, 112.279], ['C', ' CA ', 199.89, 103.971, 112.584], ['C', ' C ', 201.15, 104.795, 112.264], ['C', ' O ', 202.011, 104.997, 113.12], ['C', ' CB ', 199.857, 102.613, 111.834], ['C', ' CG1', 201.119, 101.838, 112.163], ['C', ' CG2', 198.593, 101.827, 112.236], ['C', ' H ', 198.315, 105.384, 113.026], ['C', ' HA ', 199.901, 103.754, 113.651], ['C', ' HB ', 199.868, 102.762, 110.772], ['C', ' HG1', 201.107, 100.887, 111.636], ['C', ' HG1', 201.996, 102.406, 111.857], ['C', ' HG1', 201.16, 101.661, 113.239], ['C', ' HG2', 198.579, 100.878, 111.706], ['C', ' HG2', 198.594, 101.639, 113.3], ['C', ' HG2', 197.701, 102.397, 111.967]] AA_SCO= 2.3968421052631577 CA_SCO= 1.499
[['C', ' N ', 201.241, 105.3, 111.033], ['C', ' CA ', 202.216, 106.327, 110.746], ['C', ' C ', 201.416, 107.44, 111.364], ['C', ' O ', 200.308, 107.137, 111.777], ['C', ' CB ', 202.451, 106.556, 109.261], ['C', ' CG ', 201.261, 107.147, 108.491], ['C', ' CD ', 201.613, 107.395, 107.069], ['C', ' OE1', 202.641, 106.914, 106.652], ['C', ' OE2', 200.897, 108.099, 106.397], ['C', ' H ', 200.551, 105.01, 110.34], ['C', ' HA ', 203.147, 106.179, 111.292], ['C', ' HB ', 203.3, 107.223, 109.127], ['C', ' HB ', 202.703, 105.606, 108.789], ['C', ' HG ', 200.424, 106.441, 108.531], ['C', ' HG ', 200.926, 108.078, 108.933]] AA_SCO= 2.3668421052631574 CA_SCO= 1.5006842105263156
[['C', ' N ', 201.856, 108.698, 111.447], ['C', ' CA ', 200.957, 109.613, 112.174], ['C', ' C ', 200.601, 108.876, 113.472], ['C', ' O ', 199.43, 108.604, 113.746], ['C', ' CB ', 199.706, 109.963, 111.359], ['C', ' H ', 202.747, 108.983, 111.068], ['C', ' HA ', 201.498, 110.526, 112.421], ['C', ' HB ', 199.067, 110.621, 111.946], ['C', ' HB ', 200.001, 110.468, 110.441], ['C', ' HB ', 199.137, 109.077, 111.095]] AA_SCO= 2.3005263157894738 CA_SCO= 1.5065789473684208
[['C', ' N ', 201.651, 108.514, 114.223], ['C', ' CA ', 201.659, 107.567, 115.349], ['C', ' C ', 200.673, 107.693, 116.504], ['C', ' O ', 201.065, 107.739, 117.675], ['C', ' H ', 202.548, 108.863, 113.922], ['C', ' HA ', 201.542, 106.568, 114.929], ['C', ' HA ', 202.663, 107.568, 115.769]] AA_SCO= 2.2584210526315793 CA_SCO= 1.5203684210526314
[['C', ' N ', 199.393, 107.612, 116.165], ['C', ' CA ', 198.3, 107.533, 117.106], ['C', ' C ', 198.057, 106.08, 117.457], ['C', ' O ', 197.287, 105.769, 118.359], ['C', ' CB ', 197.031, 108.099, 116.486], ['C', ' CG ', 197.061, 109.572, 116.087], ['C', ' CD1', 195.785, 109.882, 115.401], ['C', ' CD2', 197.25, 110.466, 117.309], ['C', ' H ', 199.177, 107.665, 115.179], ['C', ' HA ', 198.557, 108.071, 118.011], ['C', ' HB ', 196.811, 107.52, 115.588], ['C', ' HB ', 196.212, 107.955, 117.189], ['C', ' HG ', 197.875, 109.748, 115.386], ['C', ' HD1', 195.792, 110.923, 115.091], ['C', ' HD1', 195.692, 109.237, 114.531], ['C', ' HD1', 194.947, 109.709, 116.076], ['C', ' HD2', 197.254, 111.509, 116.991], ['C', ' HD2', 196.433, 110.306, 118.015], ['C', ' HD2', 198.196, 110.246, 117.796]] AA_SCO= 2.2963157894736845 CA_SCO= 1.496736842105263
[['C', ' N ', 198.684, 105.178, 116.708], ['C', ' CA ', 198.558, 103.75, 116.944], ['C', ' C ', 199.883, 103.061, 116.901], ['C', ' O ', 200.778, 103.434, 116.143], ['C', ' CB ', 197.7, 103.004, 115.931], ['C', ' CG ', 196.377, 103.438, 115.855], ['C', ' CD1', 195.924, 104.044, 114.748], ['C', ' CD2', 195.57, 103.302, 116.913], ['C', ' CE1', 194.658, 104.499, 114.697], ['C', ' CE2', 194.325, 103.766, 116.879], ['C', ' CZ ', 193.874, 104.354, 115.77], ['C', ' H ', 199.307, 105.517, 115.994], ['C', ' HA ', 198.136, 103.602, 117.933], ['C', ' HB ', 198.134, 103.098, 114.966], ['C', ' HB ', 197.695, 101.941, 116.182], ['C', ' HD1', 196.586, 104.146, 113.901], ['C', ' HD2', 195.948, 102.822, 117.799], ['C', ' HE1', 194.277, 104.984, 113.801], ['C', ' HE2', 193.686, 103.667, 117.75], ['C', ' HZ ', 192.91, 104.703, 115.746]] AA_SCO= 2.2110526315789474 CA_SCO= 1.2996842105263158
[['C', ' N ', 199.959, 101.981, 117.634], ['C', ' CA ', 201.079, 101.08, 117.525], ['C', ' C ', 200.463, 99.747, 117.207], ['C', ' O ', 199.326, 99.479, 117.604], ['C', ' CB ', 201.953, 101.08, 118.772], ['C', ' CG ', 201.284, 100.734, 120.066], ['C', ' CD ', 202.287, 100.758, 121.189], ['C', ' OE1', 203.439, 100.962, 120.901], ['C', ' OE2', 201.914, 100.583, 122.33], ['C', ' H ', 199.191, 101.789, 118.285], ['C', ' HA ', 201.704, 101.373, 116.68], ['C', ' HB ', 202.774, 100.378, 118.631], ['C', ' HB ', 202.393, 102.071, 118.891], ['C', ' HG ', 200.494, 101.459, 120.27], ['C', ' HG ', 200.827, 99.764, 119.989]] AA_SCO= 2.2115789473684204 CA_SCO= 1.168
[['C', ' N ', 201.172, 98.919, 116.457], ['C', ' CA ', 200.568, 97.669, 116.032], ['C', ' C ', 201.536, 96.514, 115.855], ['C', ' O ', 202.728, 96.717, 115.602], ['C', ' CB ', 199.779, 97.926, 114.743], ['C', ' OG1', 199.085, 96.769, 114.389], ['C', ' CG2', 200.674, 98.324, 113.617], ['C', ' H ', 202.11, 99.162, 116.168], ['C', ' HA ', 199.859, 97.367, 116.789], ['C', ' HB ', 199.061, 98.725, 114.921], ['C', ' HG1', 198.471, 96.543, 115.118], ['C', ' HG2', 200.072, 98.502, 112.727], ['C', ' HG2', 201.208, 99.232, 113.881], ['C', ' HG2', 201.389, 97.529, 113.415]] AA_SCO= 2.248947368421052 CA_SCO= 1.221157894736842
[['C', ' N ', 201.002, 95.303, 116.001], ['C', ' CA ', 201.75, 94.061, 115.853], ['C', ' C ', 200.996, 93.113, 114.906], ['C', ' O ', 199.772, 93.052, 114.952], ['C', ' CB ', 201.849, 93.36, 117.214], ['C', ' CG ', 202.479, 94.15, 118.354], ['C', ' CD ', 203.954, 94.344, 118.183], ['C', ' CE ', 204.552, 95.04, 119.392], ['C', ' NZ ', 206.017, 95.28, 119.224], ['C', ' H ', 199.997, 95.277, 116.2], ['C', ' HA ', 202.732, 94.298, 115.47], ['C', ' HB ', 200.857, 93.07, 117.532], ['C', ' HB ', 202.42, 92.434, 117.1], ['C', ' HG ', 202.006, 95.126, 118.415], ['C', ' HG ', 202.293, 93.631, 119.289], ['C', ' HD ', 204.44, 93.375, 118.043], ['C', ' HD ', 204.143, 94.959, 117.302], ['C', ' HE ', 204.049, 95.997, 119.539], ['C', ' HE ', 204.394, 94.419, 120.275], ['C', ' HZ ', 206.383, 95.743, 120.045], ['C', ' HZ ', 206.492, 94.395, 119.096], ['C', ' HZ ', 206.171, 95.865, 118.412]] AA_SCO= 2.0921052631578942 CA_SCO= 1.259
[['C', ' N ', 201.653, 92.279, 114.095], ['C', ' CA ', 200.987, 91.292, 113.265], ['C', ' C ', 200.183, 90.431, 114.202], ['C', ' O ', 200.701, 90.068, 115.252], ['C', ' CB ', 202.156, 90.514, 112.668], ['C', ' CG ', 203.31, 91.495, 112.692], ['C', ' CD ', 203.111, 92.306, 113.962], ['C', ' HA ', 200.356, 91.774, 112.506], ['C', ' HB ', 202.352, 89.61, 113.267], ['C', ' HB ', 201.895, 90.165, 111.654], ['C', ' HG ', 204.27, 90.939, 112.706], ['C', ' HG ', 203.313, 92.11, 111.783], ['C', ' HD ', 203.597, 91.819, 114.831], ['C', ' HD ', 203.496, 93.313, 113.768]] AA_SCO= 2.1078947368421055 CA_SCO= 1.2562105263157897
[['C', ' N ', 198.988, 90.009, 113.825], ['C', ' CA ', 198.168, 89.217, 114.74], ['C', ' C ', 198.775, 87.869, 115.127], ['C', ' O ', 198.351, 87.241, 116.092], ['C', ' CB ', 196.761, 89.04, 114.181], ['C', ' CG1', 195.718, 88.652, 115.284], ['C', ' CG2', 196.754, 88.008, 113.06], ['C', ' CD1', 195.461, 89.743, 116.335], ['C', ' H ', 198.589, 90.284, 112.917], ['C', ' HA ', 198.098, 89.802, 115.657], ['C', ' HB ', 196.464, 89.978, 113.785], ['C', ' HG1', 194.782, 88.463, 114.799], ['C', ' HG1', 196.024, 87.748, 115.799], ['C', ' HG2', 195.758, 87.933, 112.653], ['C', ' HG2', 197.443, 88.315, 112.273], ['C', ' HG2', 197.054, 87.032, 113.43], ['C', ' HD1', 194.697, 89.4, 117.037], ['C', ' HD1', 196.36, 89.958, 116.896], ['C', ' HD1', 195.12, 90.653, 115.849]] AA_SCO= 2.177894736842105 CA_SCO= 1.263947368421053
[['C', ' N ', 199.701, 87.369, 114.328], ['C', ' CA ', 200.373, 86.116, 114.616], ['C', ' C ', 201.298, 86.219, 115.835], ['C', ' O ', 201.688, 85.2, 116.418], ['C', ' CB ', 201.153, 85.667, 113.392], ['C', ' CG ', 200.259, 85.387, 112.198], ['C', ' CD ', 199.877, 86.635, 111.474], ['C', ' OE1', 200.441, 87.665, 111.785], ['C', ' OE2', 199.019, 86.582, 110.634], ['C', ' H ', 199.984, 87.909, 113.502], ['C', ' HA ', 199.609, 85.369, 114.832], ['C', ' HB ', 201.879, 86.434, 113.119], ['C', ' HB ', 201.705, 84.757, 113.624], ['C', ' HG ', 200.779, 84.721, 111.513], ['C', ' HG ', 199.356, 84.882, 112.543]] AA_SCO= 2.1794736842105267 CA_SCO= 1.3421052631578951
[['C', ' N ', 201.687, 87.442, 116.19], ['C', ' CA ', 202.581, 87.701, 117.302], ['C', ' C ', 201.756, 88.168, 118.488], ['C', ' O ', 200.757, 88.848, 118.292], ['C', ' CB ', 203.591, 88.791, 116.934], ['C', ' CG ', 204.503, 88.456, 115.765], ['C', ' CD ', 205.502, 89.553, 115.486], ['C', ' OE1', 205.569, 90.475, 116.265], ['C', ' OE2', 206.182, 89.477, 114.49], ['C', ' H ', 201.308, 88.253, 115.694], ['C', ' HA ', 203.104, 86.783, 117.568], ['C', ' HB ', 203.05, 89.706, 116.679], ['C', ' HB ', 204.216, 89.011, 117.797], ['C', ' HG ', 205.034, 87.532, 115.98], ['C', ' HG ', 203.89, 88.297, 114.878]] AA_SCO= 2.247894736842105 CA_SCO= 1.3803684210526317
[['C', ' N ', 202.226, 87.877, 119.706], ['C', ' CA ', 201.605, 88.313, 120.968], ['C', ' C ', 200.319, 87.539, 121.246], ['C', ' O ', 199.256, 87.881, 120.747], ['C', ' CB ', 201.294, 89.833, 120.964], ['C', ' CG1', 200.665, 90.22, 122.267], ['C', ' CG2', 202.566, 90.637, 120.704], ['C', ' H ', 203.058, 87.307, 119.755], ['C', ' HA ', 202.306, 88.113, 121.779], ['C', ' HB ', 200.557, 90.059, 120.21], ['C', ' HG1', 200.433, 91.278, 122.233], ['C', ' HG1', 199.759, 89.655, 122.423], ['C', ' HG1', 201.355, 90.02, 123.085], ['C', ' HG2', 202.323, 91.694, 120.707], ['C', ' HG2', 203.294, 90.428, 121.484], ['C', ' HG2', 202.989, 90.373, 119.738]] AA_SCO= 2.2478947368421056 CA_SCO= 1.4225789473684214
[['C', ' N ', 200.409, 86.508, 122.074], ['C', ' CA ', 199.287, 85.598, 122.226], ['C', ' C ', 198.21, 86.182, 123.162], ['C', ' O ', 198.548, 86.981, 124.037], ['C', ' CB ', 199.782, 84.251, 122.751], ['C', ' CG ', 200.85, 83.584, 121.875], ['C', ' CD ', 200.368, 83.267, 120.45], ['C', ' CE ', 201.437, 82.483, 119.687], ['C', ' NZ ', 201.081, 82.265, 118.253], ['C', ' H ', 201.287, 86.318, 122.531], ['C', ' HA ', 198.88, 85.465, 121.244], ['C', ' HB ', 200.206, 84.388, 123.745], ['C', ' HB ', 198.962, 83.557, 122.847], ['C', ' HG ', 201.72, 84.234, 121.812], ['C', ' HG ', 201.158, 82.653, 122.352], ['C', ' HD ', 199.445, 82.69, 120.488], ['C', ' HD ', 200.181, 84.192, 119.9], ['C', ' HE ', 202.377, 83.032, 119.736], ['C', ' HE ', 201.57, 81.513, 120.167], ['C', ' HZ ', 201.82, 81.745, 117.8], ['C', ' HZ ', 200.22, 81.745, 118.188], ['C', ' HZ ', 200.973, 83.17, 117.783]] AA_SCO= 2.262631578947369 CA_SCO= 1.4596842105263161
[['C', ' N ', 196.927, 85.746, 123.06], ['C', ' CA ', 196.305, 84.682, 122.255], ['C', ' C ', 196.48, 84.975, 120.796], ['C', ' O ', 196.539, 86.127, 120.425], ['C', ' CB ', 194.821, 84.802, 122.621], ['C', ' CG ', 194.809, 85.486, 123.957], ['C', ' CD ', 195.968, 86.459, 123.892], ['C', ' HA ', 196.707, 83.701, 122.521], ['C', ' HB ', 194.281, 85.37, 121.847], ['C', ' HB ', 194.369, 83.802, 122.648], ['C', ' HG ', 193.842, 86.008, 124.088], ['C', ' HG ', 194.897, 84.758, 124.773], ['C', ' HD ', 195.663, 87.395, 123.383], ['C', ' HD ', 196.383, 86.653, 124.89]] AA_SCO= 2.2331578947368427 CA_SCO= 1.4574736842105263
[['C', ' N ', 196.609, 83.962, 119.965], ['C', ' CA ', 196.805, 84.283, 118.566], ['C', ' C ', 195.472, 84.424, 117.87], ['C', ' O ', 194.412, 84.298, 118.49], ['C', ' H ', 196.553, 83.003, 120.277], ['C', ' HA ', 197.373, 85.213, 118.471], ['C', ' HA ', 197.391, 83.501, 118.087]] AA_SCO= 2.2500000000000004 CA_SCO= 1.4533157894736841
[['C', ' N ', 195.51, 84.563, 116.549], ['C', ' CA ', 194.294, 84.73, 115.769], ['C', ' C ', 193.355, 83.559, 115.964], ['C', ' O ', 192.136, 83.745, 116.008], ['C', ' CB ', 194.602, 84.873, 114.277], ['C', ' CG ', 193.376, 85.13, 113.333], ['C', ' CD1', 192.669, 86.426, 113.704], ['C', ' CD2', 193.855, 85.188, 111.895], ['C', ' H ', 196.407, 84.618, 116.083], ['C', ' HA ', 193.807, 85.634, 116.125], ['C', ' HB ', 195.291, 85.691, 114.153], ['C', ' HB ', 195.089, 83.96, 113.936], ['C', ' HG ', 192.667, 84.318, 113.431], ['C', ' HD1', 191.842, 86.572, 113.034], ['C', ' HD1', 192.295, 86.391, 114.718], ['C', ' HD1', 193.355, 87.237, 113.601], ['C', ' HD2', 193.0, 85.347, 111.235], ['C', ' HD2', 194.566, 86.001, 111.769], ['C', ' HD2', 194.335, 84.24, 111.639]] AA_SCO= 2.2247368421052633 CA_SCO= 1.4501052631578948
[['C', ' N ', 193.92, 82.37, 116.166], ['C', ' CA ', 193.146, 81.157, 116.321], ['C', ' C ', 192.068, 81.28, 117.392], ['C', ' O ', 191.033, 80.626, 117.284], ['C', ' H ', 194.925, 82.289, 116.131], ['C', ' HA ', 192.693, 80.899, 115.365], ['C', ' HA ', 193.814, 80.336, 116.574]] AA_SCO= 2.2373684210526315 CA_SCO= 1.4463157894736838
[['C', ' N ', 192.271, 82.091, 118.432], ['C', ' CA ', 191.218, 82.187, 119.422], ['C', ' C ', 189.996, 82.854, 118.817], ['C', ' O ', 188.864, 82.503, 119.146], ['C', ' CB ', 191.673, 82.945, 120.666], ['C', ' CG ', 190.618, 83.067, 121.81], ['C', ' CD1', 190.147, 81.688, 122.282], ['C', ' CD2', 191.241, 83.819, 122.96], ['C', ' H ', 193.121, 82.657, 118.529], ['C', ' HA ', 190.953, 81.174, 119.707], ['C', ' HB ', 192.551, 82.449, 121.069], ['C', ' HB ', 191.964, 83.958, 120.367], ['C', ' HG ', 189.757, 83.611, 121.452], ['C', ' HD1', 189.419, 81.818, 123.083], ['C', ' HD1', 189.67, 81.144, 121.473], ['C', ' HD1', 190.996, 81.117, 122.654], ['C', ' HD2', 190.512, 83.931, 123.759], ['C', ' HD2', 192.102, 83.273, 123.333], ['C', ' HD2', 191.554, 84.797, 122.619]] AA_SCO= 2.234210526315789 CA_SCO= 1.4911578947368418
[['C', ' N ', 190.21, 83.838, 117.955], ['C', ' CA ', 189.113, 84.546, 117.342], ['C', ' C ', 188.424, 83.622, 116.385], ['C', ' O ', 187.2, 83.66, 116.26], ['C', ' CB ', 189.596, 85.823, 116.66], ['C', ' CG ', 188.525, 86.707, 115.999], ['C', ' CD1', 187.469, 87.119, 116.997], ['C', ' CD2', 189.196, 87.946, 115.461], ['C', ' H ', 191.16, 84.06, 117.663], ['C', ' HA ', 188.402, 84.792, 118.11], ['C', ' HB ', 190.127, 86.425, 117.396], ['C', ' HB ', 190.304, 85.536, 115.883], ['C', ' HG ', 188.044, 86.159, 115.185], ['C', ' HD1', 186.751, 87.753, 116.502], ['C', ' HD1', 186.948, 86.254, 117.396], ['C', ' HD1', 187.922, 87.667, 117.802], ['C', ' HD2', 188.45, 88.579, 114.983], ['C', ' HD2', 189.66, 88.486, 116.281], ['C', ' HD2', 189.956, 87.672, 114.738]] AA_SCO= 2.254210526315789 CA_SCO= 1.4913684210526312
[['C', ' N ', 189.216, 82.796, 115.712], ['C', ' CA ', 188.682, 81.831, 114.77], ['C', ' C ', 187.781, 80.833, 115.504], ['C', ' O ', 186.802, 80.367, 114.932], ['C', ' CB ', 189.803, 81.093, 114.053], ['C', ' CG ', 190.617, 81.951, 113.092], ['C', ' CD ', 191.798, 81.205, 112.532], ['C', ' OE1', 192.049, 80.13, 113.022], ['C', ' OE2', 192.453, 81.692, 111.639], ['C', ' H ', 190.228, 82.882, 115.864], ['C', ' HA ', 188.083, 82.36, 114.03], ['C', ' HB ', 190.467, 80.659, 114.782], ['C', ' HB ', 189.378, 80.27, 113.479], ['C', ' HG ', 189.975, 82.266, 112.275], ['C', ' HG ', 190.951, 82.835, 113.62]] AA_SCO= 2.214210526315789 CA_SCO= 1.4896315789473682
[['C', ' N ', 188.138, 80.48, 116.755], ['C', ' CA ', 187.316, 79.602, 117.592], ['C', ' C ', 186.038, 80.275, 118.086], ['C', ' O ', 184.986, 79.643, 118.088], ['C', ' CB ', 188.076, 79.109, 118.82], ['C', ' CG ', 189.16, 78.11, 118.555], ['C', ' CD ', 189.86, 77.72, 119.852], ['C', ' CE ', 190.981, 76.725, 119.606], ['C', ' NZ ', 191.695, 76.368, 120.866], ['C', ' H ', 189.032, 80.827, 117.106], ['C', ' HA ', 187.021, 78.742, 116.991], ['C', ' HB ', 188.535, 79.962, 119.316], ['C', ' HB ', 187.371, 78.669, 119.525], ['C', ' HG ', 188.725, 77.223, 118.097], ['C', ' HG ', 189.881, 78.529, 117.863], ['C', ' HD ', 190.278, 78.616, 120.316], ['C', ' HD ', 189.138, 77.28, 120.538], ['C', ' HE ', 190.565, 75.82, 119.167], ['C', ' HE ', 191.695, 77.162, 118.906], ['C', ' HZ ', 192.433, 75.707, 120.66], ['C', ' HZ ', 192.096, 77.201, 121.276], ['C', ' HZ ', 191.046, 75.952, 121.519]] AA_SCO= 2.2699999999999996 CA_SCO= 1.493736842105263
[['C', ' N ', 186.101, 81.56, 118.493], ['C', ' CA ', 184.866, 82.21, 118.955], ['C', ' C ', 183.933, 82.365, 117.769], ['C', ' O ', 182.719, 82.13, 117.866], ['C', ' CB ', 185.141, 83.588, 119.553], ['C', ' CG ', 185.423, 83.646, 121.052], ['C', ' CD1', 186.676, 82.885, 121.4], ['C', ' CD2', 185.567, 85.08, 121.432], ['C', ' H ', 187.008, 82.035, 118.538], ['C', ' HA ', 184.385, 81.573, 119.695], ['C', ' HB ', 186.008, 84.01, 119.038], ['C', ' HB ', 184.283, 84.23, 119.346], ['C', ' HG ', 184.599, 83.191, 121.594], ['C', ' HD1', 186.855, 82.949, 122.472], ['C', ' HD1', 186.584, 81.84, 121.121], ['C', ' HD1', 187.501, 83.328, 120.88], ['C', ' HD2', 185.762, 85.165, 122.499], ['C', ' HD2', 186.389, 85.489, 120.882], ['C', ' HD2', 184.67, 85.622, 121.188]] AA_SCO= 2.296842105263157 CA_SCO= 1.518631578947368
[['C', ' N ', 184.517, 82.739, 116.639], ['C', ' CA ', 183.821, 82.807, 115.388], ['C', ' C ', 183.648, 81.35, 115.111], ['C', ' O ', 184.212, 80.562, 115.834], ['C', ' CB ', 184.602, 83.546, 114.317], ['C', ' H ', 185.512, 82.973, 116.639], ['C', ' HA ', 182.842, 83.269, 115.526], ['C', ' HB ', 184.058, 83.514, 113.376], ['C', ' HB ', 184.746, 84.581, 114.623], ['C', ' HB ', 185.574, 83.068, 114.194]] AA_SCO= 2.3784210526315785 CA_SCO= 1.6974210526315787
[['C', ' N ', 182.793, 80.933, 114.22], ['C', ' CA ', 182.616, 79.489, 113.985], ['C', ' C ', 181.814, 78.854, 115.119], ['C', ' O ', 180.732, 78.349, 114.852], ['C', ' CB ', 183.936, 78.739, 113.791], ['C', ' H ', 182.302, 81.605, 113.653], ['C', ' HA ', 182.051, 79.375, 113.064], ['C', ' HB ', 183.708, 77.701, 113.566], ['C', ' HB ', 184.472, 79.178, 112.954], ['C', ' HB ', 184.589, 78.741, 114.647]] AA_SCO= 2.3736842105263154 CA_SCO= 1.8072631578947365
[['C', ' N ', 182.253, 78.911, 116.384], ['C', ' CA ', 181.377, 78.369, 117.413], ['C', ' C ', 180.097, 79.172, 117.459], ['C', ' O ', 179.009, 78.602, 117.558], ['C', ' CB ', 182.016, 78.417, 118.791], ['C', ' CG ', 183.138, 77.455, 119.026], ['C', ' CD ', 183.791, 77.72, 120.373], ['C', ' OE1', 183.446, 78.702, 121.045], ['C', ' NE2', 184.722, 76.863, 120.774], ['C', ' H ', 183.173, 79.314, 116.623], ['C', ' HA ', 181.133, 77.336, 117.162], ['C', ' HB ', 182.42, 79.422, 118.948], ['C', ' HB ', 181.258, 78.247, 119.55], ['C', ' HG ', 182.728, 76.448, 119.04], ['C', ' HG ', 183.876, 77.538, 118.238], ['C', ' HE2', 185.178, 76.995, 121.656], ['C', ' HE2', 184.969, 76.082, 120.2]] AA_SCO= 2.316315789473684 CA_SCO= 1.8143157894736839
[['C', ' N ', 180.202, 80.496, 117.332], ['C', ' CA ', 179.009, 81.312, 117.342], ['C', ' C ', 178.143, 80.974, 116.146], ['C', ' O ', 176.913, 80.952, 116.245], ['C', ' CB ', 179.355, 82.794, 117.352], ['C', ' CG ', 178.147, 83.707, 117.463], ['C', ' CD ', 178.577, 85.148, 117.603], ['C', ' CE ', 177.437, 86.099, 117.556], ['C', ' NZ ', 176.501, 85.93, 118.691], ['C', ' H ', 181.127, 80.944, 117.303], ['C', ' HA ', 178.441, 81.084, 118.243], ['C', ' HB ', 180.031, 83.008, 118.183], ['C', ' HB ', 179.884, 83.049, 116.429], ['C', ' HG ', 177.534, 83.611, 116.565], ['C', ' HG ', 177.552, 83.412, 118.323], ['C', ' HD ', 179.152, 85.298, 118.517], ['C', ' HD ', 179.175, 85.37, 116.758], ['C', ' HE ', 177.814, 87.111, 117.558], ['C', ' HE ', 176.916, 85.941, 116.635], ['C', ' HZ ', 175.756, 86.59, 118.586], ['C', ' HZ ', 176.119, 84.997, 118.685], ['C', ' HZ ', 176.942, 86.113, 119.605]] AA_SCO= 2.4589473684210525 CA_SCO= 1.8226842105263155
[['C', ' N ', 178.782, 80.724, 115.007], ['C', ' CA ', 178.038, 80.432, 113.801], ['C', ' C ', 177.281, 79.133, 113.957], ['C', ' O ', 176.113, 79.063, 113.585], ['C', ' CB ', 178.967, 80.325, 112.601], ['C', ' CG ', 179.595, 81.627, 112.194], ['C', ' CD ', 180.536, 81.471, 111.017], ['C', ' CE ', 181.2, 82.802, 110.693], ['C', ' NZ ', 182.19, 82.697, 109.584], ['C', ' H ', 179.79, 80.752, 115.007], ['C', ' HA ', 177.316, 81.228, 113.632], ['C', ' HB ', 179.742, 79.606, 112.808], ['C', ' HB ', 178.402, 79.948, 111.746], ['C', ' HG ', 178.822, 82.324, 111.915], ['C', ' HG ', 180.132, 82.048, 113.04], ['C', ' HD ', 181.303, 80.735, 111.239], ['C', ' HD ', 179.976, 81.136, 110.146], ['C', ' HE ', 180.434, 83.528, 110.417], ['C', ' HE ', 181.717, 83.16, 111.584], ['C', ' HZ ', 182.615, 83.614, 109.444], ['C', ' HZ ', 182.936, 82.063, 109.827], ['C', ' HZ ', 181.753, 82.393, 108.732]] AA_SCO= 2.4336842105263155 CA_SCO= 1.8233684210526315
[['C', ' N ', 177.914, 78.123, 114.556], ['C', ' CA ', 177.251, 76.845, 114.739], ['C', ' C ', 176.067, 76.976, 115.665], ['C', ' O ', 175.025, 76.364, 115.424], ['C', ' CB ', 178.206, 75.809, 115.322], ['C', ' CG ', 179.293, 75.331, 114.386], ['C', ' CD ', 180.24, 74.383, 115.063], ['C', ' OE1', 180.098, 74.186, 116.249], ['C', ' OE2', 181.105, 73.858, 114.403], ['C', ' H ', 178.898, 78.226, 114.814], ['C', ' HA ', 176.899, 76.496, 113.766], ['C', ' HB ', 178.697, 76.238, 116.198], ['C', ' HB ', 177.64, 74.941, 115.656], ['C', ' HG ', 178.826, 74.824, 113.542], ['C', ' HG ', 179.839, 76.183, 113.999]] AA_SCO= 2.4431578947368418 CA_SCO= 1.8145789473684213
[['C', ' N ', 176.211, 77.775, 116.723], ['C', ' CA ', 175.114, 77.942, 117.651], ['C', ' C ', 173.954, 78.597, 116.938], ['C', ' O ', 172.804, 78.162, 117.082], ['C', ' CB ', 175.561, 78.795, 118.829], ['C', ' CG ', 176.542, 78.097, 119.751], ['C', ' CD ', 177.047, 79.029, 120.843], ['C', ' CE ', 178.121, 78.357, 121.686], ['C', ' NZ ', 178.69, 79.283, 122.705], ['C', ' H ', 177.122, 78.216, 116.898], ['C', ' HA ', 174.794, 76.963, 118.005], ['C', ' HB ', 176.046, 79.697, 118.453], ['C', ' HB ', 174.694, 79.104, 119.411], ['C', ' HG ', 176.042, 77.249, 120.217], ['C', ' HG ', 177.38, 77.719, 119.178], ['C', ' HD ', 177.466, 79.926, 120.384], ['C', ' HD ', 176.219, 79.322, 121.487], ['C', ' HE ', 177.691, 77.495, 122.192], ['C', ' HE ', 178.926, 78.018, 121.029], ['C', ' HZ ', 179.4, 78.801, 123.237], ['C', ' HZ ', 179.105, 80.081, 122.24], ['C', ' HZ ', 177.959, 79.598, 123.326]] AA_SCO= 2.4468421052631575 CA_SCO= 1.814526315789474
[['C', ' N ', 174.252, 79.608, 116.114], ['C', ' CA ', 173.196, 80.255, 115.382], ['C', ' C ', 172.565, 79.274, 114.422], ['C', ' O ', 171.354, 79.149, 114.385], ['C', ' CB ', 173.732, 81.455, 114.627], ['C', ' H ', 175.213, 79.959, 116.048], ['C', ' HA ', 172.438, 80.582, 116.09], ['C', ' HB ', 172.933, 81.946, 114.085], ['C', ' HB ', 174.172, 82.149, 115.339], ['C', ' HB ', 174.493, 81.124, 113.926]] AA_SCO= 2.4073684210526314 CA_SCO= 1.8097894736842106
[['C', ' N ', 173.352, 78.45, 113.742], ['C', ' CA ', 172.757, 77.534, 112.782], ['C', ' C ', 171.81, 76.558, 113.44], ['C', ' O ', 170.76, 76.231, 112.876], ['C', ' CB ', 173.834, 76.777, 112.023], ['C', ' CG ', 174.608, 77.621, 111.028], ['C', ' CD ', 175.757, 76.879, 110.431], ['C', ' OE1', 176.012, 75.784, 110.875], ['C', ' OE2', 176.383, 77.396, 109.536], ['C', ' H ', 174.368, 78.53, 113.809], ['C', ' HA ', 172.192, 78.119, 112.061], ['C', ' HB ', 174.548, 76.365, 112.736], ['C', ' HB ', 173.387, 75.94, 111.488], ['C', ' HG ', 173.93, 77.914, 110.229], ['C', ' HG ', 174.958, 78.524, 111.505]] AA_SCO= 2.311052631578947 CA_SCO= 1.876
[['C', ' N ', 172.159, 76.083, 114.627], ['C', ' CA ', 171.283, 75.158, 115.315], ['C', ' C ', 169.974, 75.839, 115.678], ['C', ' O ', 168.9, 75.236, 115.552], ['C', ' CB ', 171.977, 74.611, 116.552], ['C', ' CG ', 173.111, 73.662, 116.219], ['C', ' CD ', 173.843, 73.185, 117.454], ['C', ' CE ', 175.006, 72.279, 117.073], ['C', ' NZ ', 175.787, 71.834, 118.261], ['C', ' H ', 173.076, 76.335, 115.015], ['C', ' HA ', 171.057, 74.331, 114.643], ['C', ' HB ', 172.392, 75.444, 117.128], ['C', ' HB ', 171.258, 74.094, 117.183], ['C', ' HG ', 172.703, 72.799, 115.695], ['C', ' HG ', 173.814, 74.158, 115.556], ['C', ' HD ', 174.228, 74.049, 118.0], ['C', ' HD ', 173.159, 72.638, 118.101], ['C', ' HE ', 174.619, 71.402, 116.556], ['C', ' HE ', 175.671, 72.823, 116.398], ['C', ' HZ ', 176.548, 71.239, 117.959], ['C', ' HZ ', 176.163, 72.641, 118.738], ['C', ' HZ ', 175.187, 71.319, 118.89]] AA_SCO= 2.2973684210526315 CA_SCO= 1.869578947368421
[['C', ' N ', 170.053, 77.096, 116.11], ['C', ' CA ', 168.859, 77.821, 116.488], ['C', ' C ', 168.036, 78.231, 115.281], ['C', ' O ', 166.807, 78.212, 115.336], ['C', ' CB ', 169.248, 79.021, 117.299], ['C', ' CG ', 169.738, 78.629, 118.647], ['C', ' OD1', 169.372, 77.577, 119.188], ['C', ' ND2', 170.579, 79.441, 119.207], ['C', ' H ', 170.98, 77.524, 116.248], ['C', ' HA ', 168.239, 77.166, 117.099], ['C', ' HB ', 170.046, 79.56, 116.782], ['C', ' HB ', 168.404, 79.699, 117.402], ['C', ' HD2', 170.956, 79.23, 120.105], ['C', ' HD2', 170.861, 80.291, 118.72]] AA_SCO= 2.2989473684210524 CA_SCO= 1.8738947368421055
[['C', ' N ', 168.697, 78.545, 114.178], ['C', ' CA ', 168.022, 78.955, 112.965], ['C', ' C ', 167.252, 77.765, 112.44], ['C', ' O ', 166.097, 77.89, 112.022], ['C', ' CB ', 169.022, 79.473, 111.913], ['C', ' CG1', 169.664, 80.779, 112.392], ['C', ' CG2', 168.291, 79.754, 110.651], ['C', ' CD1', 170.905, 81.233, 111.649], ['C', ' H ', 169.712, 78.548, 114.22], ['C', ' HA ', 167.319, 79.753, 113.201], ['C', ' HB ', 169.803, 78.736, 111.748], ['C', ' HG1', 168.916, 81.567, 112.293], ['C', ' HG1', 169.915, 80.682, 113.412], ['C', ' HG2', 168.971, 80.127, 109.924], ['C', ' HG2', 167.82, 78.858, 110.267], ['C', ' HG2', 167.537, 80.507, 110.842], ['C', ' HD1', 171.251, 82.175, 112.084], ['C', ' HD1', 171.686, 80.484, 111.753], ['C', ' HD1', 170.702, 81.389, 110.604]] AA_SCO= 2.328421052631579 CA_SCO= 1.8765263157894738
[['C', ' N ', 167.899, 76.608, 112.417], ['C', ' CA ', 167.225, 75.422, 111.959], ['C', ' C ', 166.042, 75.097, 112.854], ['C', ' O ', 164.977, 74.742, 112.346], ['C', ' CB ', 168.185, 74.263, 111.938], ['C', ' H ', 168.876, 76.56, 112.714], ['C', ' HA ', 166.853, 75.608, 110.951], ['C', ' HB ', 167.673, 73.373, 111.577], ['C', ' HB ', 169.024, 74.499, 111.284], ['C', ' HB ', 168.555, 74.089, 112.951]] AA_SCO= 2.3473684210526318 CA_SCO= 1.7639473684210527
[['C', ' N ', 166.19, 75.274, 114.176], ['C', ' CA ', 165.086, 74.99, 115.071], ['C', ' C ', 163.911, 75.899, 114.78], ['C', ' O ', 162.759, 75.464, 114.838], ['C', ' CB ', 165.516, 75.162, 116.506], ['C', ' H ', 167.099, 75.531, 114.573], ['C', ' HA ', 164.777, 73.957, 114.91], ['C', ' HB ', 164.688, 74.921, 117.166], ['C', ' HB ', 166.354, 74.497, 116.71], ['C', ' HB ', 165.824, 76.192, 116.669]] AA_SCO= 2.3742105263157893 CA_SCO= 1.6709473684210525
[['C', ' N ', 164.183, 77.161, 114.456], ['C', ' CA ', 163.087, 78.057, 114.166], ['C', ' C ', 162.306, 77.562, 112.978], ['C', ' O ', 161.069, 77.563, 113.0], ['C', ' CB ', 163.563, 79.443, 113.843], ['C', ' CG ', 164.131, 80.233, 114.965], ['C', ' CD ', 164.516, 81.555, 114.474], ['C', ' NE ', 163.343, 82.292, 114.119], ['C', ' CZ ', 162.631, 82.998, 114.978], ['C', ' NH1', 162.969, 83.115, 116.236], ['C', ' NH2', 161.57, 83.592, 114.562], ['C', ' H ', 165.151, 77.499, 114.489], ['C', ' HA ', 162.432, 78.095, 115.023], ['C', ' HB ', 164.341, 79.366, 113.104], ['C', ' HB ', 162.755, 80.006, 113.391], ['C', ' HG ', 163.381, 80.342, 115.74], ['C', ' HG ', 164.996, 79.749, 115.37], ['C', ' HD ', 165.073, 82.102, 115.229], ['C', ' HD ', 165.134, 81.447, 113.579], ['C', ' HE ', 162.98, 82.273, 113.15], ['C', ' HH1', 163.791, 82.674, 116.602], ['C', ' HH1', 162.371, 83.697, 116.831], ['C', ' HH2', 161.31, 83.497, 113.566], ['C', ' HH2', 161.038, 84.14, 115.246]] AA_SCO= 2.391578947368421 CA_SCO= 1.6195789473684208
[['C', ' N ', 163.018, 77.089, 111.952], ['C', ' CA ', 162.33, 76.583, 110.778], ['C', ' C ', 161.483, 75.367, 111.129], ['C', ' O ', 160.322, 75.269, 110.725], ['C', ' CB ', 163.313, 76.24, 109.661], ['C', ' CG ', 162.642, 75.762, 108.378], ['C', ' CD ', 163.647, 75.562, 107.256], ['C', ' CE ', 162.968, 75.035, 105.997], ['C', ' NZ ', 163.938, 74.831, 104.882], ['C', ' H ', 164.044, 77.163, 111.979], ['C', ' HA ', 161.664, 77.365, 110.413], ['C', ' HB ', 163.906, 77.109, 109.423], ['C', ' HB ', 163.997, 75.463, 110.006], ['C', ' HG ', 162.131, 74.816, 108.564], ['C', ' HG ', 161.899, 76.499, 108.07], ['C', ' HD ', 164.109, 76.517, 107.021], ['C', ' HD ', 164.422, 74.864, 107.573], ['C', ' HE ', 162.486, 74.085, 106.224], ['C', ' HE ', 162.209, 75.749, 105.677], ['C', ' HZ ', 163.447, 74.482, 104.069], ['C', ' HZ ', 164.383, 75.709, 104.653], ['C', ' HZ ', 164.641, 74.161, 105.161]] AA_SCO= 2.388888888888889 CA_SCO= 1.6045555555555557
[['C', ' N ', 162.027, 74.474, 111.952], ['C', ' CA ', 161.334, 73.25, 112.348], ['C', ' C ', 160.037, 73.557, 113.081], ['C', ' O ', 159.037, 72.854, 112.926], ['C', ' CB ', 162.229, 72.402, 113.244], ['C', ' CG ', 163.412, 71.765, 112.544], ['C', ' CD ', 164.345, 71.107, 113.506], ['C', ' OE1', 164.178, 71.323, 114.683], ['C', ' OE2', 165.215, 70.385, 113.079], ['C', ' H ', 162.999, 74.617, 112.253], ['C', ' HA ', 161.096, 72.685, 111.449], ['C', ' HB ', 162.611, 73.018, 114.051], ['C', ' HB ', 161.639, 71.606, 113.696], ['C', ' HG ', 163.044, 71.018, 111.843], ['C', ' HG ', 163.945, 72.517, 111.976]] AA_SCO= 2.474705882352941 CA_SCO= 1.5855294117647056
[['C', ' N ', 160.042, 74.638, 113.848], ['C', ' CA ', 158.892, 75.067, 114.621], ['C', ' C ', 157.888, 75.9, 113.821], ['C', ' O ', 156.871, 76.323, 114.373], ['C', ' CB ', 159.373, 75.863, 115.82], ['C', ' CG ', 160.105, 75.032, 116.848], ['C', ' SD ', 160.52, 75.947, 118.339], ['C', ' CE ', 161.894, 76.959, 117.792], ['C', ' H ', 160.931, 75.141, 113.957], ['C', ' HA ', 158.373, 74.178, 114.972], ['C', ' HB ', 160.052, 76.635, 115.464], ['C', ' HB ', 158.531, 76.358, 116.302], ['C', ' HG ', 159.479, 74.188, 117.127], ['C', ' HG ', 161.022, 74.636, 116.416], ['C', ' HE ', 162.251, 77.567, 118.622], ['C', ' HE ', 162.696, 76.323, 117.436], ['C', ' HE ', 161.566, 77.601, 117.003]] AA_SCO= 2.4587499999999998 CA_SCO= 1.5639999999999998
[['C', ' N ', 158.163, 76.156, 112.539], ['C', ' CA ', 157.262, 76.935, 111.704], ['C', ' C ', 157.343, 78.443, 111.912], ['C', ' O ', 156.372, 79.158, 111.661], ['C', ' H ', 159.01, 75.777, 112.106], ['C', ' HA ', 157.485, 76.709, 110.661], ['C', ' HA ', 156.242, 76.601, 111.881]] AA_SCO= 2.45 CA_SCO= 1.5371333333333332
[['C', ' N ', 158.472, 78.938, 112.389], ['C', ' CA ', 158.615, 80.356, 112.642], ['C', ' C ', 159.264, 81.049, 111.465], ['C', ' O ', 159.89, 80.39, 110.625], ['C', ' CB ', 159.485, 80.554, 113.87], ['C', ' CG ', 158.995, 79.929, 115.154], ['C', ' CD1', 160.057, 80.126, 116.199], ['C', ' CD2', 157.686, 80.576, 115.591], ['C', ' H ', 159.279, 78.33, 112.567], ['C', ' HA ', 157.63, 80.762, 112.808], ['C', ' HB ', 160.455, 80.129, 113.655], ['C', ' HB ', 159.617, 81.611, 114.046], ['C', ' HG ', 158.845, 78.857, 115.011], ['C', ' HD1', 159.736, 79.67, 117.136], ['C', ' HD1', 160.97, 79.663, 115.871], ['C', ' HD1', 160.226, 81.192, 116.35], ['C', ' HD2', 157.357, 80.124, 116.525], ['C', ' HD2', 157.835, 81.65, 115.739], ['C', ' HD2', 156.915, 80.42, 114.843]] AA_SCO= 2.447142857142857 CA_SCO= 1.5323571428571428
[['C', ' N ', 159.073, 82.362, 111.288], ['C', ' CA ', 159.806, 83.103, 110.307], ['C', ' C ', 161.23, 82.796, 110.658], ['C', ' O ', 161.615, 82.915, 111.83], ['C', ' CB ', 159.391, 84.541, 110.592], ['C', ' CG ', 158.0, 84.399, 111.187], ['C', ' CD ', 158.071, 83.136, 112.029], ['C', ' HA ', 159.542, 82.764, 109.294], ['C', ' HB ', 160.103, 85.016, 111.281], ['C', ' HB ', 159.403, 85.13, 109.664], ['C', ' HG ', 157.75, 85.288, 111.775], ['C', ' HG ', 157.249, 84.331, 110.388], ['C', ' HD ', 158.422, 83.365, 113.044], ['C', ' HD ', 157.081, 82.663, 112.019]] AA_SCO= 2.4123076923076923 CA_SCO= 1.5345384615384614
[['C', ' N ', 162.013, 82.445, 109.663], ['C', ' CA ', 163.375, 82.041, 109.912], ['C', ' C ', 164.407, 82.704, 109.031], ['C', ' O ', 164.645, 82.235, 107.92], ['C', ' CB ', 163.481, 80.522, 109.778], ['C', ' OG1', 162.545, 79.91, 110.676], ['C', ' CG2', 164.868, 80.073, 110.14], ['C', ' H ', 161.64, 82.398, 108.723], ['C', ' HA ', 163.614, 82.265, 110.948], ['C', ' HB ', 163.25, 80.22, 108.757], ['C', ' HG1', 161.611, 80.127, 110.419], ['C', ' HG2', 164.935, 79.005, 110.059], ['C', ' HG2', 165.6, 80.518, 109.478], ['C', ' HG2', 165.09, 80.369, 111.157]] AA_SCO= 2.4408333333333334 CA_SCO= 1.4983333333333333
[['C', ' N ', 164.918, 83.869, 109.412], ['C', ' CA ', 165.975, 84.564, 108.735], ['C', ' C ', 167.193, 83.674, 108.915], ['C', ' O ', 167.263, 82.992, 109.943], ['C', ' CB ', 166.088, 85.865, 109.516], ['C', ' CG ', 164.783, 85.963, 110.255], ['C', ' CD ', 164.406, 84.574, 110.573], ['C', ' HA ', 165.706, 84.724, 107.677], ['C', ' HB ', 166.964, 85.83, 110.18], ['C', ' HB ', 166.247, 86.707, 108.822], ['C', ' HG ', 164.896, 86.613, 111.122], ['C', ' HG ', 164.021, 86.423, 109.62], ['C', ' HD ', 164.907, 84.23, 111.491], ['C', ' HD ', 163.327, 84.546, 110.65]] AA_SCO= 2.4145454545454546 CA_SCO= 1.4595454545454545
[['C', ' N ', 168.138, 83.708, 107.967], ['C', ' CA ', 169.415, 82.963, 108.005], ['C', ' C ', 170.624, 83.917, 108.036], ['C', ' O ', 170.507, 85.065, 108.469], ['C', ' OXT', 171.756, 83.423, 107.972], ['C', ' CB ', 169.493, 81.94, 106.813], ['C', ' CG ', 168.547, 80.685, 106.952], ['C', ' CD1', 167.09, 80.762, 106.676], ['C', ' CD2', 169.112, 79.364, 107.354], ['C', ' CE1', 166.232, 79.576, 106.823], ['C', ' CE2', 168.252, 78.182, 107.496], ['C', ' CZ ', 166.814, 78.292, 107.236], ['C', ' H ', 167.984, 84.304, 107.167], ['C', ' HA ', 169.462, 82.389, 108.929], ['C', ' HB ', 169.253, 82.442, 105.874], ['C', ' HB ', 170.524, 81.58, 106.704], ['C', ' HD1', 166.646, 81.712, 106.379], ['C', ' HD2', 170.181, 79.285, 107.556], ['C', ' HE1', 165.161, 79.662, 106.633], ['C', ' HE2', 168.68, 77.225, 107.802], ['C', ' HZ ', 166.184, 77.422, 107.351]] AA_SCO= 2.401 CA_SCO= 1.4128
[['B', ' N ', 145.2, 100.621, 69.368], ['B', ' CA ', 145.368, 100.212, 70.775], ['B', ' C ', 145.026, 101.428, 71.689], ['B', ' O ', 145.19, 102.544, 71.198], ['B', ' CB ', 146.822, 99.703, 71.016], ['B', ' CG ', 147.23, 98.353, 70.244], ['B', ' CD ', 148.751, 97.944, 70.501], ['B', ' CE ', 149.204, 96.622, 69.728], ['B', ' NZ ', 148.617, 95.362, 70.319], ['B', ' H ', 145.976, 100.286, 68.816], ['B', ' H ', 144.338, 100.245, 68.998], ['B', ' H ', 145.172, 101.636, 69.325], ['B', ' HA ', 144.669, 99.39, 70.96], ['B', ' HB ', 147.551, 100.491, 70.737], ['B', ' HB ', 146.985, 99.513, 72.085], ['B', ' HG ', 146.577, 97.54, 70.587], ['B', ' HG ', 147.077, 98.475, 69.163], ['B', ' HD ', 149.399, 98.758, 70.162], ['B', ' HD ', 148.932, 97.807, 71.58], ['B', ' HE ', 148.899, 96.696, 68.682], ['B', ' HE ', 150.294, 96.545, 69.771], ['B', ' HZ ', 148.94, 94.561, 69.804], ['B', ' HZ ', 148.938, 95.285, 71.303], ['B', ' HZ ', 147.615, 95.398, 70.292]]
[['B', ' N ', 144.516, 101.247, 72.971], ['B', ' CA ', 144.144, 102.294, 73.944], ['B', ' C ', 145.322, 102.999, 74.613], ['B', ' O ', 146.466, 102.525, 74.549], ['B', ' CB ', 143.316, 101.52, 74.981], ['B', ' CG ', 143.848, 100.118, 74.968], ['B', ' CD ', 144.203, 99.842, 73.525], ['B', ' HA ', 143.506, 103.043, 73.442], ['B', ' HB ', 143.44, 101.989, 75.98], ['B', ' HB ', 142.248, 101.578, 74.739], ['B', ' HG ', 144.693, 100.046, 75.665], ['B', ' HG ', 143.072, 99.438, 75.36], ['B', ' HD ', 145.078, 99.173, 73.485], ['B', ' HD ', 143.328, 99.402, 73.015]]
[['B', ' N ', 145.024, 104.12, 75.264], ['B', ' CA ', 146.0, 104.831, 76.069], ['B', ' C ', 146.231, 104.119, 77.366], ['B', ' O ', 145.743, 102.995, 77.414], ['B', ' CB ', 145.519, 106.242, 76.332], ['B', ' CG ', 144.314, 106.332, 77.189], ['B', ' CD ', 143.828, 107.717, 77.334], ['B', ' NE ', 142.627, 107.717, 78.132], ['B', ' CZ ', 142.602, 107.734, 79.476], ['B', ' NH1', 143.707, 107.797, 80.175], ['B', ' NH2', 141.462, 107.67, 80.127], ['B', ' H ', 144.075, 104.473, 75.204], ['B', ' HA ', 146.952, 104.85, 75.566], ['B', ' HB ', 146.312, 106.811, 76.813], ['B', ' HB ', 145.261, 106.727, 75.396], ['B', ' HG ', 143.512, 105.748, 76.741], ['B', ' HG ', 144.533, 105.935, 78.177], ['B', ' HD ', 144.576, 108.349, 77.804], ['B', ' HD ', 143.582, 108.117, 76.343], ['B', ' HE ', 141.74, 107.662, 77.643], ['B', ' HH1', 144.603, 107.842, 79.732], ['B', ' HH1', 143.629, 107.796, 81.2], ['B', ' HH2', 140.587, 107.609, 79.632], ['B', ' HH2', 141.504, 107.648, 81.155]]
[['B', ' N ', 147.476, 104.304, 77.75], ['B', ' CA ', 147.815, 104.266, 79.147], ['B', ' C ', 149.149, 104.949, 79.363], ['B', ' O ', 149.987, 104.956, 78.47], ['B', ' CB ', 147.838, 102.779, 79.605], ['B', ' CG1', 148.031, 102.615, 81.072], ['B', ' CG2', 148.87, 101.994, 78.854], ['B', ' CD1', 146.883, 103.025, 81.909], ['B', ' H ', 148.132, 103.746, 77.236], ['B', ' HA ', 147.053, 104.807, 79.701], ['B', ' HB ', 146.87, 102.334, 79.395], ['B', ' HG1', 148.209, 101.578, 81.234], ['B', ' HG1', 148.903, 103.145, 81.394], ['B', ' HG2', 148.824, 100.955, 79.162], ['B', ' HG2', 148.67, 102.046, 77.807], ['B', ' HG2', 149.861, 102.394, 79.059], ['B', ' HD1', 147.112, 102.814, 82.949], ['B', ' HD1', 146.671, 104.081, 81.805], ['B', ' HD1', 146.012, 102.452, 81.609]]
[['B', ' N ', 149.346, 105.566, 80.51], ['B', ' CA ', 150.663, 106.091, 80.808], ['B', ' C ', 151.408, 105.062, 81.643], ['B', ' O ', 150.775, 104.381, 82.441], ['B', ' H ', 148.615, 105.596, 81.207], ['B', ' HA ', 151.203, 106.309, 79.906], ['B', ' HA ', 150.545, 107.006, 81.372]]
[['B', ' N ', 152.73, 104.924, 81.491], ['B', ' CA ', 153.479, 104.015, 82.345], ['B', ' C ', 154.176, 104.719, 83.469], ['B', ' O ', 155.276, 104.242, 83.759], ['B', ' CB ', 154.372, 103.094, 81.568], ['B', ' CG ', 153.649, 101.871, 80.975], ['B', ' CD1', 152.248, 101.716, 80.901], ['B', ' CD2', 154.42, 100.852, 80.584], ['B', ' CE1', 151.734, 100.568, 80.382], ['B', ' CE2', 153.899, 99.737, 80.095], ['B', ' CZ ', 152.576, 99.595, 79.965], ['B', ' OH ', 152.091, 98.481, 79.415], ['B', ' H ', 153.255, 105.494, 80.835], ['B', ' HA ', 152.764, 103.364, 82.843], ['B', ' HB ', 154.77, 103.667, 80.737], ['B', ' HB ', 155.218, 102.77, 82.143], ['B', ' HD1', 151.562, 102.466, 81.221], ['B', ' HD2', 155.487, 100.939, 80.667], ['B', ' HE1', 150.669, 100.435, 80.299], ['B', ' HE2', 154.553, 98.955, 79.801], ['B', ' HH ', 152.837, 97.899, 79.205]]
[['B', ' N ', 154.031, 106.027, 83.358], ['B', ' CA ', 154.001, 106.648, 84.657], ['B', ' C ', 152.509, 106.716, 84.83], ['B', ' O ', 151.857, 107.595, 84.261], ['B', ' CB ', 154.599, 108.07, 84.698], ['B', ' CG1', 156.037, 108.093, 84.116], ['B', ' CG2', 154.544, 108.634, 86.117], ['B', ' CD1', 157.06, 107.18, 84.782], ['B', ' H ', 154.63, 106.464, 82.663], ['B', ' HA ', 154.427, 106.003, 85.426], ['B', ' HB ', 154.004, 108.723, 84.078], ['B', ' HG1', 155.984, 107.827, 83.068], ['B', ' HG1', 156.4, 109.11, 84.19], ['B', ' HG2', 154.936, 109.65, 86.122], ['B', ' HG2', 153.51, 108.65, 86.472], ['B', ' HG2', 155.132, 108.018, 86.794], ['B', ' HD1', 158.021, 107.3, 84.283], ['B', ' HD1', 157.173, 107.436, 85.833], ['B', ' HD1', 156.745, 106.141, 84.697]]
[['B', ' N ', 151.952, 105.783, 85.574], ['B', ' CA ', 150.515, 105.72, 85.611], ['B', ' C ', 150.014, 106.256, 86.91], ['B', ' O ', 150.231, 105.674, 87.978], ['B', ' CB ', 149.968, 104.315, 85.504], ['B', ' CG ', 148.486, 104.325, 85.404], ['B', ' ND1', 147.696, 103.326, 85.916], ['B', ' CD2', 147.639, 105.215, 84.831], ['B', ' CE1', 146.427, 103.613, 85.671], ['B', ' NE2', 146.376, 104.747, 85.016], ['B', ' H ', 152.527, 105.09, 86.059], ['B', ' HA ', 150.101, 106.317, 84.805], ['B', ' HB ', 150.401, 103.79, 84.677], ['B', ' HB ', 150.22, 103.78, 86.398], ['B', ' HD2', 147.893, 106.136, 84.312], ['B', ' HE1', 145.567, 103.029, 85.94], ['B', ' HE2', 145.509, 105.215, 84.679]]
[['B', ' N ', 149.337, 107.366, 86.845], ['B', ' CA ', 148.885, 107.982, 88.052], ['B', ' C ', 147.462, 107.599, 88.39], ['B', ' O ', 146.542, 107.843, 87.61], ['B', ' CB ', 149.055, 109.485, 87.885], ['B', ' CG ', 148.592, 110.389, 88.995], ['B', ' CD1', 149.351, 110.145, 90.25], ['B', ' CD2', 148.815, 111.793, 88.546], ['B', ' H ', 149.168, 107.801, 85.948], ['B', ' HA ', 149.517, 107.652, 88.851], ['B', ' HB ', 150.117, 109.685, 87.725], ['B', ' HB ', 148.523, 109.784, 86.983], ['B', ' HG ', 147.551, 110.223, 89.204], ['B', ' HD1', 148.989, 110.833, 91.01], ['B', ' HD1', 149.216, 109.135, 90.608], ['B', ' HD1', 150.412, 110.321, 90.09], ['B', ' HD2', 148.509, 112.439, 89.311], ['B', ' HD2', 149.877, 111.958, 88.341], ['B', ' HD2', 148.242, 111.982, 87.647]]
[['B', ' N ', 147.283, 106.975, 89.558], ['B', ' CA ', 145.96, 106.577, 90.02], ['B', ' C ', 145.596, 107.422, 91.239], ['B', ' O ', 144.438, 107.512, 91.638], ['B', ' CB ', 145.892, 105.093, 90.332], ['B', ' OG ', 146.114, 104.331, 89.193], ['B', ' H ', 148.076, 106.752, 90.139], ['B', ' HA ', 145.234, 106.785, 89.234], ['B', ' HB ', 146.623, 104.835, 91.06], ['B', ' HB ', 144.918, 104.858, 90.751], ['B', ' HG ', 145.857, 103.441, 89.424]]
[['B', ' N ', 146.596, 108.113, 91.766], ['B', ' CA ', 146.502, 108.982, 92.92], ['B', ' C ', 147.909, 109.201, 93.493], ['B', ' O ', 148.78, 108.356, 93.32], ['B', ' H ', 147.515, 107.977, 91.392], ['B', ' HA ', 146.057, 109.934, 92.634], ['B', ' HA ', 145.86, 108.524, 93.671]]
[['B', ' N ', 148.093, 110.335, 94.191], ['B', ' CA ', 149.336, 110.792, 94.85], ['B', ' C ', 150.447, 111.174, 93.876], ['B', ' O ', 150.61, 110.573, 92.827], ['B', ' CB ', 149.894, 109.717, 95.769], ['B', ' SG ', 148.83, 109.262, 97.152], ['B', ' H ', 147.299, 110.952, 94.243], ['B', ' HA ', 149.092, 111.668, 95.454], ['B', ' HB ', 150.141, 108.812, 95.214], ['B', ' HB ', 150.811, 110.093, 96.173], ['B', ' HG ', 149.567, 108.215, 97.572]]
[['B', ' N ', 151.258, 112.16, 94.243], ['B', ' CA ', 152.362, 112.561, 93.367], ['B', ' C ', 153.778, 112.519, 93.945], ['B', ' O ', 154.714, 112.824, 93.235], ['B', ' CB ', 152.089, 113.928, 92.769], ['B', ' OG1', 151.9, 114.878, 93.825], ['B', ' CG2', 150.846, 113.855, 91.876], ['B', ' H ', 151.079, 112.651, 95.105], ['B', ' HA ', 152.371, 111.868, 92.524], ['B', ' HB ', 152.942, 114.236, 92.159], ['B', ' HG1', 151.753, 115.751, 93.413], ['B', ' HG2', 150.666, 114.827, 91.428], ['B', ' HG2', 151.013, 113.125, 91.082], ['B', ' HG2', 149.978, 113.562, 92.449]]
[['B', ' N ', 153.977, 112.099, 95.198], ['B', ' CA ', 155.346, 112.095, 95.79], ['B', ' C ', 156.211, 110.968, 95.236], ['B', ' O ', 157.442, 110.942, 95.357], ['B', ' H ', 153.182, 111.83, 95.755], ['B', ' HA ', 155.84, 113.046, 95.592], ['B', ' HA ', 155.271, 111.992, 96.872]]
[['B', ' N ', 155.549, 110.065, 94.568], ['B', ' CA ', 156.147, 108.909, 93.971], ['B', ' C ', 156.63, 109.28, 92.581], ['B', ' O ', 157.329, 108.527, 91.915], ['B', ' CB ', 155.087, 107.84, 93.965], ['B', ' CG ', 154.702, 107.414, 95.38], ['B', ' OD1', 155.55, 107.167, 96.188], ['B', ' OD2', 153.536, 107.411, 95.649], ['B', ' H ', 154.549, 110.174, 94.506], ['B', ' HA ', 156.996, 108.587, 94.557], ['B', ' HB ', 154.194, 108.23, 93.488], ['B', ' HB ', 155.418, 107.0, 93.382]]
[['B', ' N ', 156.279, 110.486, 92.169], ['B', ' CA ', 156.65, 111.073, 90.913], ['B', ' C ', 157.487, 112.264, 91.297], ['B', ' O ', 157.397, 112.75, 92.415], ['B', ' CB ', 155.436, 111.472, 90.096], ['B', ' H ', 155.718, 111.08, 92.774], ['B', ' HA ', 157.261, 110.37, 90.349], ['B', ' HB ', 155.754, 111.943, 89.169], ['B', ' HB ', 154.846, 110.583, 89.869], ['B', ' HB ', 154.828, 112.175, 90.67]]
[['B', ' N ', 158.355, 112.721, 90.424], ['B', ' CA ', 159.175, 113.883, 90.766], ['B', ' C ', 159.929, 113.649, 92.069], ['B', ' O ', 160.067, 114.541, 92.903], ['B', ' CB ', 158.324, 115.144, 90.85], ['B', ' CG ', 157.63, 115.455, 89.558], ['B', ' SD ', 158.795, 115.669, 88.212], ['B', ' CE ', 157.723, 115.973, 86.883], ['B', ' H ', 158.424, 112.299, 89.509], ['B', ' HA ', 159.911, 114.015, 89.983], ['B', ' HB ', 157.576, 115.054, 91.635], ['B', ' HB ', 158.96, 115.995, 91.103], ['B', ' HG ', 156.941, 114.65, 89.308], ['B', ' HG ', 157.051, 116.374, 89.67], ['B', ' HE ', 158.296, 116.135, 85.976], ['B', ' HE ', 157.06, 115.122, 86.747], ['B', ' HE ', 157.131, 116.859, 87.102]]
[['B', ' N ', 160.424, 112.426, 92.184], ['B', ' CA ', 161.224, 111.877, 93.252], ['B', ' C ', 162.192, 111.024, 92.476], ['B', ' O ', 163.363, 110.886, 92.796], ['B', ' CB ', 160.324, 111.206, 94.256], ['B', ' OG ', 159.559, 110.193, 93.711], ['B', ' H ', 160.238, 111.786, 91.434], ['B', ' HA ', 161.772, 112.672, 93.759], ['B', ' HB ', 160.912, 110.813, 95.088], ['B', ' HB ', 159.656, 111.964, 94.652], ['B', ' HG ', 158.741, 110.205, 94.303]]
[['B', ' N ', 161.723, 110.613, 91.302], ['B', ' CA ', 162.534, 109.926, 90.298], ['B', ' C ', 163.579, 110.922, 89.807], ['B', ' O ', 164.754, 110.612, 89.621], ['B', ' CB ', 161.65, 109.446, 89.132], ['B', ' CG ', 162.341, 108.657, 87.978], ['B', ' CD1', 161.332, 107.65, 87.383], ['B', ' CD2', 162.808, 109.623, 86.863], ['B', ' H ', 160.734, 110.732, 91.138], ['B', ' HA ', 163.04, 109.078, 90.758], ['B', ' HB ', 160.871, 108.805, 89.544], ['B', ' HB ', 161.172, 110.315, 88.685], ['B', ' HG ', 163.201, 108.118, 88.362], ['B', ' HD1', 161.808, 107.089, 86.577], ['B', ' HD1', 161.003, 106.956, 88.151], ['B', ' HD1', 160.468, 108.183, 86.987], ['B', ' HD2', 163.277, 109.042, 86.069], ['B', ' HD2', 161.949, 110.159, 86.46], ['B', ' HD2', 163.525, 110.337, 87.224]]
[['B', ' N ', 163.134, 112.156, 89.627], ['B', ' CA ', 163.903, 113.255, 89.09], ['B', ' C ', 164.907, 113.788, 90.104], ['B', ' O ', 165.722, 114.658, 89.803], ['B', ' CB ', 162.972, 114.375, 88.606], ['B', ' OG1', 162.179, 114.825, 89.692], ['B', ' CG2', 162.08, 113.852, 87.489], ['B', ' H ', 162.174, 112.356, 89.846], ['B', ' HA ', 164.461, 112.886, 88.229], ['B', ' HB ', 163.551, 115.207, 88.237], ['B', ' HG1', 161.69, 115.617, 89.424], ['B', ' HG2', 161.427, 114.648, 87.144], ['B', ' HG2', 162.704, 113.514, 86.663], ['B', ' HG2', 161.479, 113.021, 87.848]]
[['B', ' N ', 164.93, 113.237, 91.311], ['B', ' CA ', 165.901, 113.694, 92.275], ['B', ' C ', 167.201, 112.926, 92.087], ['B', ' O ', 168.156, 113.079, 92.841], ['B', ' CB ', 165.381, 113.663, 93.69], ['B', ' CG ', 164.295, 114.694, 93.945], ['B', ' CD ', 163.894, 114.677, 95.34], ['B', ' OE1', 164.351, 113.782, 96.0], ['B', ' OE2', 163.145, 115.51, 95.772], ['B', ' H ', 164.297, 112.483, 91.589], ['B', ' HA ', 166.116, 114.74, 92.067], ['B', ' HB ', 164.957, 112.687, 93.905], ['B', ' HB ', 166.198, 113.838, 94.389], ['B', ' HG ', 164.668, 115.685, 93.693], ['B', ' HG ', 163.435, 114.484, 93.308]]
[['B', ' N ', 167.263, 112.135, 91.014], ['B', ' CA ', 168.5, 111.499, 90.617], ['B', ' C ', 169.443, 112.609, 90.169], ['B', ' O ', 170.66, 112.429, 90.079], ['B', ' CB ', 168.258, 110.527, 89.502], ['B', ' CG ', 167.642, 109.33, 89.976], ['B', ' OD1', 167.939, 108.911, 91.085], ['B', ' ND2', 166.779, 108.758, 89.201], ['B', ' H ', 166.417, 111.951, 90.47], ['B', ' HA ', 168.948, 110.997, 91.475], ['B', ' HB ', 167.621, 110.984, 88.74], ['B', ' HB ', 169.188, 110.28, 89.049], ['B', ' HD2', 166.302, 107.935, 89.503], ['B', ' HD2', 166.565, 109.156, 88.312]]
[['B', ' N ', 168.855, 113.734, 89.769], ['B', ' CA ', 169.526, 114.955, 89.386], ['B', ' C ', 170.565, 114.836, 88.308], ['B', ' O ', 170.315, 115.136, 87.139], ['B', ' CB ', 170.17, 115.612, 90.624], ['B', ' CG ', 169.172, 116.173, 91.618], ['B', ' CD1', 169.109, 115.759, 92.953], ['B', ' CD2', 168.309, 117.099, 91.186], ['B', ' CE1', 168.143, 116.315, 93.804], ['B', ' CE2', 167.405, 117.621, 91.994], ['B', ' CZ ', 167.287, 117.263, 93.273], ['B', ' OH ', 166.298, 117.898, 93.985], ['B', ' H ', 167.837, 113.792, 89.835], ['B', ' HA ', 168.768, 115.63, 89.013], ['B', ' HB ', 170.791, 114.889, 91.15], ['B', ' HB ', 170.824, 116.426, 90.302], ['B', ' HD1', 169.801, 115.002, 93.328], ['B', ' HD2', 168.339, 117.435, 90.172], ['B', ' HE1', 168.068, 116.007, 94.846], ['B', ' HE2', 166.749, 118.352, 91.609], ['B', ' HH ', 166.166, 117.548, 94.878]]
[['B', ' N ', 171.709, 114.295, 88.694], ['B', ' CA ', 172.908, 114.244, 87.879], ['B', ' C ', 172.719, 113.389, 86.665], ['B', ' O ', 173.318, 113.625, 85.616], ['B', ' CB ', 174.066, 113.707, 88.707], ['B', ' CG ', 174.555, 114.693, 89.803], ['B', ' OD1', 174.194, 115.869, 89.791], ['B', ' OD2', 175.292, 114.254, 90.65], ['B', ' H ', 171.737, 113.924, 89.639], ['B', ' HA ', 173.146, 115.256, 87.551], ['B', ' HB ', 173.753, 112.78, 89.192], ['B', ' HB ', 174.9, 113.464, 88.049]]
[['B', ' N ', 171.882, 112.385, 86.802], ['B', ' CA ', 171.638, 111.514, 85.676], ['B', ' C ', 170.206, 111.56, 85.208], ['B', ' O ', 169.799, 110.65, 84.492], ['B', ' CB ', 171.951, 110.04, 85.991], ['B', ' CG1', 171.025, 109.535, 87.138], ['B', ' CG2', 173.42, 109.932, 86.372], ['B', ' CD1', 171.003, 108.033, 87.346], ['B', ' H ', 171.443, 112.242, 87.719], ['B', ' HA ', 172.27, 111.826, 84.846], ['B', ' HB ', 171.761, 109.426, 85.11], ['B', ' HG1', 171.345, 110.002, 88.069], ['B', ' HG1', 170.004, 109.83, 86.929], ['B', ' HG2', 173.681, 108.902, 86.584], ['B', ' HG2', 174.028, 110.292, 85.543], ['B', ' HG2', 173.616, 110.54, 87.252], ['B', ' HD1', 170.322, 107.799, 88.164], ['B', ' HD1', 170.654, 107.548, 86.43], ['B', ' HD1', 171.995, 107.669, 87.593]]
[['B', ' N ', 169.377, 112.525, 85.621], ['B', ' CA ', 168.004, 112.305, 85.186], ['B', ' C ', 167.87, 112.641, 83.715], ['B', ' O ', 167.071, 112.029, 83.008], ['B', ' CB ', 166.973, 113.092, 85.999], ['B', ' CG ', 166.753, 114.568, 85.703], ['B', ' CD1', 165.604, 114.702, 84.692], ['B', ' CD2', 166.392, 115.262, 86.909], ['B', ' H ', 169.68, 113.337, 86.174], ['B', ' HA ', 167.767, 111.254, 85.324], ['B', ' HB ', 166.013, 112.591, 85.896], ['B', ' HB ', 167.268, 113.026, 87.049], ['B', ' HG ', 167.654, 115.018, 85.298], ['B', ' HD1', 165.432, 115.73, 84.525], ['B', ' HD1', 165.8, 114.223, 83.75], ['B', ' HD1', 164.709, 114.263, 85.125], ['B', ' HD2', 166.217, 116.308, 86.684], ['B', ' HD2', 165.513, 114.83, 87.289], ['B', ' HD2', 167.173, 115.174, 87.623]]
[['B', ' N ', 168.659, 113.604, 83.217], ['B', ' CA ', 168.513, 113.981, 81.822], ['B', ' C ', 168.82, 112.783, 80.952], ['B', ' O ', 168.129, 112.522, 79.969], ['B', ' CB ', 169.445, 115.135, 81.47], ['B', ' H ', 169.333, 114.072, 83.81], ['B', ' HA ', 167.48, 114.276, 81.649], ['B', ' HB ', 169.312, 115.403, 80.421], ['B', ' HB ', 169.231, 115.994, 82.088], ['B', ' HB ', 170.478, 114.834, 81.635]]
[['B', ' N ', 169.823, 112.008, 81.353], ['B', ' CA ', 170.19, 110.825, 80.605], ['B', ' C ', 169.215, 109.694, 80.852], ['B', ' O ', 168.776, 108.999, 79.921], ['B', ' CB ', 171.586, 110.377, 81.014], ['B', ' CG ', 172.668, 111.322, 80.602], ['B', ' CD ', 172.771, 111.42, 79.12], ['B', ' OE1', 172.886, 110.394, 78.487], ['B', ' OE2', 172.709, 112.508, 78.606], ['B', ' H ', 170.36, 112.28, 82.163], ['B', ' HA ', 170.184, 111.069, 79.542], ['B', ' HB ', 171.626, 110.267, 82.103], ['B', ' HB ', 171.796, 109.398, 80.578], ['B', ' HG ', 172.456, 112.31, 81.009], ['B', ' HG ', 173.617, 110.981, 81.013]]
[['B', ' N ', 168.753, 109.564, 82.095], ['B', ' CA ', 167.894, 108.455, 82.432], ['B', ' C ', 166.604, 108.536, 81.654], ['B', ' O ', 166.127, 107.536, 81.122], ['B', ' CB ', 167.601, 108.428, 83.937], ['B', ' CG ', 166.762, 107.234, 84.489], ['B', ' CD1', 167.493, 105.899, 84.21], ['B', ' CD2', 166.544, 107.441, 86.006], ['B', ' H ', 169.078, 110.171, 82.848], ['B', ' HA ', 168.42, 107.562, 82.177], ['B', ' HB ', 168.551, 108.44, 84.469], ['B', ' HB ', 167.063, 109.34, 84.185], ['B', ' HG ', 165.791, 107.199, 83.981], ['B', ' HD1', 166.906, 105.084, 84.592], ['B', ' HD1', 167.627, 105.756, 83.149], ['B', ' HD1', 168.468, 105.906, 84.702], ['B', ' HD2', 165.949, 106.621, 86.412], ['B', ' HD2', 167.51, 107.472, 86.515], ['B', ' HD2', 166.017, 108.384, 86.167]]
[['B', ' N ', 166.074, 109.747, 81.505], ['B', ' CA ', 164.824, 109.966, 80.797], ['B', ' C ', 164.994, 110.275, 79.309], ['B', ' O ', 164.013, 110.621, 78.646], ['B', ' CB ', 164.038, 111.106, 81.467], ['B', ' CG ', 163.552, 110.868, 82.943], ['B', ' CD1', 162.9, 112.148, 83.465], ['B', ' CD2', 162.535, 109.71, 82.989], ['B', ' H ', 166.522, 110.548, 81.965], ['B', ' HA ', 164.243, 109.048, 80.853], ['B', ' HB ', 164.685, 111.988, 81.478], ['B', ' HB ', 163.166, 111.331, 80.858], ['B', ' HG ', 164.411, 110.636, 83.579], ['B', ' HD1', 162.572, 112.0, 84.494], ['B', ' HD1', 163.628, 112.947, 83.428], ['B', ' HD1', 162.043, 112.404, 82.844], ['B', ' HD2', 162.19, 109.562, 84.003], ['B', ' HD2', 161.688, 109.959, 82.355], ['B', ' HD2', 162.988, 108.788, 82.639]]
[['B', ' N ', 166.22, 110.201, 78.786], ['B', ' CA ', 166.445, 110.491, 77.372], ['B', ' C ', 167.061, 109.31, 76.637], ['B', ' O ', 166.548, 108.88, 75.604], ['B', ' CB ', 167.381, 111.705, 77.146], ['B', ' OG1', 166.832, 112.877, 77.75], ['B', ' CG2', 167.537, 111.965, 75.653], ['B', ' H ', 166.994, 109.883, 79.362], ['B', ' HA ', 165.488, 110.71, 76.906], ['B', ' HB ', 168.362, 111.503, 77.58], ['B', ' HG1', 167.01, 112.818, 78.712], ['B', ' HG2', 168.191, 112.821, 75.508], ['B', ' HG2', 167.966, 111.106, 75.153], ['B', ' HG2', 166.561, 112.177, 75.223]]
[['B', ' N ', 168.204, 108.826, 77.13], ['B', ' CA ', 168.959, 107.798, 76.435], ['B', ' C ', 168.848, 106.4, 77.025], ['B', ' O ', 169.106, 105.415, 76.336], ['B', ' CB ', 170.41, 108.218, 76.377], ['B', ' CG ', 170.615, 109.444, 75.519], ['B', ' OD1', 169.953, 109.6, 74.486], ['B', ' ND2', 171.514, 110.314, 75.907], ['B', ' H ', 168.556, 109.177, 78.018], ['B', ' HA ', 168.579, 107.737, 75.415], ['B', ' HB ', 170.764, 108.438, 77.391], ['B', ' HB ', 171.014, 107.402, 75.986], ['B', ' HD2', 171.682, 111.137, 75.366], ['B', ' HD2', 172.056, 110.176, 76.762]]
[['B', ' N ', 168.474, 106.307, 78.288], ['B', ' CA ', 168.434, 105.019, 78.963], ['B', ' C ', 167.053, 104.381, 78.993], ['B', ' O ', 166.815, 103.362, 78.343], ['B', ' CB ', 168.928, 105.223, 80.36], ['B', ' CG ', 170.39, 105.587, 80.439], ['B', ' SD ', 170.916, 106.037, 82.092], ['B', ' CE ', 170.844, 104.481, 82.932], ['B', ' H ', 168.301, 107.167, 78.81], ['B', ' HA ', 169.102, 104.336, 78.441], ['B', ' HB ', 168.359, 105.998, 80.785], ['B', ' HB ', 168.744, 104.339, 80.932], ['B', ' HG ', 170.99, 104.745, 80.098], ['B', ' HG ', 170.587, 106.432, 79.777], ['B', ' HE ', 171.154, 104.619, 83.968], ['B', ' HE ', 169.833, 104.1, 82.907], ['B', ' HE ', 171.513, 103.77, 82.447]]
[['B', ' N ', 166.141, 104.959, 79.762], ['B', ' CA ', 164.81, 104.408, 79.891], ['B', ' C ', 163.852, 105.308, 79.139], ['B', ' O ', 163.657, 106.461, 79.503], ['B', ' CB ', 164.427, 104.325, 81.38], ['B', ' CG1', 163.013, 103.766, 81.535], ['B', ' CG2', 165.463, 103.442, 82.13], ['B', ' H ', 166.353, 105.828, 80.253], ['B', ' HA ', 164.786, 103.41, 79.454], ['B', ' HB ', 164.436, 105.335, 81.806], ['B', ' HG1', 162.752, 103.73, 82.592], ['B', ' HG1', 162.305, 104.409, 81.013], ['B', ' HG1', 162.968, 102.763, 81.115], ['B', ' HG2', 165.206, 103.396, 83.185], ['B', ' HG2', 165.456, 102.438, 81.712], ['B', ' HG2', 166.453, 103.867, 82.023]]
[['B', ' N ', 163.224, 104.786, 78.104], ['B', ' CA ', 162.389, 105.643, 77.288], ['B', ' C ', 160.962, 105.733, 77.806], ['B', ' O ', 160.163, 104.798, 77.665], ['B', ' CB ', 162.376, 105.144, 75.843], ['B', ' CG ', 161.653, 106.085, 74.908], ['B', ' OD1', 161.253, 107.123, 75.364], ['B', ' OD2', 161.518, 105.772, 73.746], ['B', ' H ', 163.378, 103.82, 77.853], ['B', ' HA ', 162.813, 106.648, 77.299], ['B', ' HB ', 163.403, 105.025, 75.493], ['B', ' HB ', 161.894, 104.168, 75.796]]
[['B', ' N ', 160.615, 106.848, 78.427], ['B', ' CA ', 159.273, 106.926, 78.939], ['B', ' C ', 158.455, 107.398, 77.8], ['B', ' O ', 158.363, 108.59, 77.521], ['B', ' CB ', 159.115, 107.925, 80.094], ['B', ' CG1', 160.091, 107.601, 81.252], ['B', ' CG2', 157.637, 107.977, 80.545], ['B', ' CD1', 159.953, 106.217, 81.866], ['B', ' H ', 161.276, 107.609, 78.513], ['B', ' HA ', 158.918, 105.943, 79.232], ['B', ' HB ', 159.395, 108.917, 79.736], ['B', ' HG1', 161.115, 107.701, 80.882], ['B', ' HG1', 159.934, 108.331, 82.042], ['B', ' HG2', 157.524, 108.71, 81.328], ['B', ' HG2', 156.997, 108.265, 79.709], ['B', ' HG2', 157.312, 107.005, 80.912], ['B', ' HD1', 160.686, 106.107, 82.665], ['B', ' HD1', 158.955, 106.08, 82.279], ['B', ' HD1', 160.137, 105.46, 81.113]]
[['B', ' N ', 157.828, 106.445, 77.174], ['B', ' CA ', 157.031, 106.739, 76.021], ['B', ' C ', 155.693, 107.324, 76.403], ['B', ' O ', 155.175, 108.165, 75.684], ['B', ' CB ', 156.921, 105.516, 75.083], ['B', ' CG1', 158.25, 105.284, 74.417], ['B', ' CG2', 156.627, 104.241, 75.852], ['B', ' H ', 158.038, 105.499, 77.487], ['B', ' HA ', 157.562, 107.5, 75.447], ['B', ' HB ', 156.159, 105.713, 74.338], ['B', ' HG1', 158.19, 104.43, 73.747], ['B', ' HG1', 158.54, 106.169, 73.846], ['B', ' HG1', 159.006, 105.094, 75.177], ['B', ' HG2', 156.571, 103.405, 75.157], ['B', ' HG2', 157.437, 104.071, 76.531], ['B', ' HG2', 155.721, 104.286, 76.404]]
[['B', ' N ', 155.102, 106.842, 77.486], ['B', ' CA ', 153.817, 107.356, 77.944], ['B', ' C ', 153.822, 107.555, 79.448], ['B', ' O ', 154.476, 106.818, 80.199], ['B', ' CB ', 152.671, 106.494, 77.476], ['B', ' CG ', 152.506, 106.468, 75.984], ['B', ' CD1', 153.305, 105.709, 75.214], ['B', ' CD2', 151.536, 107.204, 75.395], ['B', ' CE1', 153.201, 105.687, 73.89], ['B', ' CE2', 151.403, 107.161, 74.037], ['B', ' CZ ', 152.245, 106.412, 73.295], ['B', ' OH ', 152.078, 106.331, 71.944], ['B', ' H ', 155.588, 106.14, 78.025], ['B', ' HA ', 153.66, 108.335, 77.498], ['B', ' HB ', 152.817, 105.53, 77.829], ['B', ' HB ', 151.747, 106.872, 77.885], ['B', ' HD1', 154.032, 105.128, 75.669], ['B', ' HD2', 150.878, 107.807, 75.999], ['B', ' HE1', 153.873, 105.071, 73.304], ['B', ' HE2', 150.636, 107.726, 73.537], ['B', ' HH ', 151.11, 106.355, 71.762]]
[['B', ' N ', 153.034, 108.516, 79.873], ['B', ' CA ', 152.865, 108.934, 81.252], ['B', ' C ', 152.733, 110.413, 81.102], ['B', ' O ', 153.749, 111.101, 80.973], ['B', ' H ', 152.538, 109.053, 79.17], ['B', ' HA ', 151.988, 108.514, 81.724], ['B', ' HA ', 153.742, 108.677, 81.837]]
[['B', ' N ', 151.503, 110.913, 81.181], ['B', ' CA ', 151.237, 112.317, 80.907], ['B', ' C ', 152.009, 113.257, 81.793], ['B', ' O ', 152.499, 114.277, 81.326], ['B', ' CB ', 149.746, 112.571, 80.947], ['B', ' CG ', 149.032, 111.858, 79.792], ['B', ' CD ', 148.689, 110.422, 80.096], ['B', ' OE1', 148.285, 110.127, 81.221], ['B', ' NE2', 148.867, 109.522, 79.133], ['B', ' H ', 150.726, 110.289, 81.371], ['B', ' HA ', 151.541, 112.514, 79.898], ['B', ' HB ', 149.336, 112.23, 81.895], ['B', ' HB ', 149.554, 113.642, 80.87], ['B', ' HG ', 148.139, 112.376, 79.573], ['B', ' HG ', 149.687, 111.864, 78.913], ['B', ' HE2', 148.651, 108.56, 79.296], ['B', ' HE2', 149.257, 109.798, 78.222]]
[['B', ' N ', 152.313, 112.827, 82.996], ['B', ' CA ', 153.09, 113.636, 83.888], ['B', ' C ', 154.383, 114.086, 83.192], ['B', ' O ', 154.846, 115.195, 83.428], ['B', ' CB ', 153.477, 112.823, 85.138], ['B', ' OG1', 152.294, 112.32, 85.782], ['B', ' CG2', 154.286, 113.664, 86.124], ['B', ' H ', 151.928, 111.958, 83.34], ['B', ' HA ', 152.506, 114.512, 84.172], ['B', ' HB ', 154.088, 111.973, 84.83], ['B', ' HG1', 151.639, 113.036, 85.945], ['B', ' HG2', 154.545, 113.054, 86.987], ['B', ' HG2', 155.195, 114.017, 85.652], ['B', ' HG2', 153.695, 114.517, 86.45]]
[['B', ' N ', 155.044, 113.197, 82.435], ['B', ' CA ', 156.305, 113.551, 81.793], ['B', ' C ', 156.209, 113.825, 80.286], ['B', ' O ', 157.029, 114.578, 79.751], ['B', ' CB ', 157.329, 112.434, 82.027], ['B', ' CG ', 157.686, 112.107, 83.521], ['B', ' CD1', 158.669, 110.924, 83.549], ['B', ' CD2', 158.3, 113.336, 84.218], ['B', ' H ', 154.631, 112.289, 82.233], ['B', ' HA ', 156.665, 114.468, 82.245], ['B', ' HB ', 156.935, 111.522, 81.571], ['B', ' HB ', 158.249, 112.7, 81.51], ['B', ' HG ', 156.779, 111.811, 84.051], ['B', ' HD1', 158.911, 110.672, 84.581], ['B', ' HD1', 158.226, 110.065, 83.07], ['B', ' HD1', 159.58, 111.196, 83.022], ['B', ' HD2', 158.543, 113.085, 85.251], ['B', ' HD2', 159.209, 113.631, 83.695], ['B', ' HD2', 157.597, 114.165, 84.218]]
[['B', ' N ', 155.278, 113.172, 79.581], ['B', ' CA ', 155.157, 113.333, 78.125], ['B', ' C ', 153.727, 113.639, 77.68], ['B', ' O ', 152.786, 112.975, 78.092], ['B', ' CB ', 155.667, 112.069, 77.404], ['B', ' CG1', 157.146, 111.877, 77.65], ['B', ' CG2', 154.954, 110.84, 77.905], ['B', ' H ', 154.627, 112.564, 80.081], ['B', ' HA ', 155.788, 114.166, 77.823], ['B', ' HB ', 155.512, 112.187, 76.334], ['B', ' HG1', 157.488, 110.985, 77.118], ['B', ' HG1', 157.692, 112.747, 77.29], ['B', ' HG1', 157.333, 111.749, 78.711], ['B', ' HG2', 155.349, 109.992, 77.376], ['B', ' HG2', 155.139, 110.715, 78.962], ['B', ' HG2', 153.893, 110.901, 77.73]]
[['B', ' N ', 153.534, 114.517, 76.702], ['B', ' CA ', 152.155, 114.828, 76.293], ['B', ' C ', 151.671, 113.814, 75.267], ['B', ' O ', 151.506, 114.119, 74.087], ['B', ' CB ', 152.117, 116.247, 75.72], ['B', ' CG ', 150.747, 116.859, 75.556], ['B', ' OD1', 149.809, 116.315, 76.06], ['B', ' OD2', 150.667, 117.95, 75.029], ['B', ' H ', 154.312, 115.006, 76.291], ['B', ' HA ', 151.506, 114.776, 77.168], ['B', ' HB ', 152.664, 116.888, 76.378], ['B', ' HB ', 152.618, 116.259, 74.751]]
[['B', ' N ', 151.5, 112.591, 75.738], ['B', ' CA ', 151.145, 111.464, 74.902], ['B', ' C ', 150.135, 110.526, 75.512], ['B', ' O ', 150.212, 110.178, 76.695], ['B', ' CB ', 152.403, 110.656, 74.584], ['B', ' CG ', 153.479, 111.326, 73.732], ['B', ' CD1', 154.724, 110.484, 73.785], ['B', ' CD2', 152.987, 111.453, 72.297], ['B', ' H ', 151.674, 112.476, 76.733], ['B', ' HA ', 150.706, 111.852, 73.987], ['B', ' HB ', 152.863, 110.332, 75.517], ['B', ' HB ', 152.097, 109.783, 74.044], ['B', ' HG ', 153.719, 112.307, 74.128], ['B', ' HD1', 155.503, 110.947, 73.185], ['B', ' HD1', 155.063, 110.408, 74.809], ['B', ' HD1', 154.514, 109.484, 73.402], ['B', ' HD2', 153.763, 111.918, 71.692], ['B', ' HD2', 152.758, 110.462, 71.902], ['B', ' HD2', 152.096, 112.073, 72.26]]
[['B', ' N ', 149.248, 110.046, 74.67], ['B', ' CA ', 148.27, 109.03, 74.991], ['B', ' C ', 148.039, 108.195, 73.747], ['B', ' O ', 148.329, 108.644, 72.64], ['B', ' CB ', 147.017, 109.638, 75.621], ['B', ' CG ', 146.464, 110.767, 74.921], ['B', ' CD1', 145.497, 110.792, 73.988], ['B', ' CD2', 146.841, 112.128, 75.15], ['B', ' NE1', 145.253, 112.086, 73.607], ['B', ' CE2', 146.07, 112.91, 74.316], ['B', ' CE3', 147.751, 112.737, 76.003], ['B', ' CZ2', 146.187, 114.278, 74.298], ['B', ' CZ3', 147.867, 114.078, 75.988], ['B', ' CH2', 147.115, 114.844, 75.16], ['B', ' H ', 149.25, 110.406, 73.722], ['B', ' HA ', 148.688, 108.369, 75.746], ['B', ' HB ', 146.242, 108.899, 75.653], ['B', ' HB ', 147.228, 109.934, 76.645], ['B', ' HD1', 144.983, 109.917, 73.596], ['B', ' HE1', 144.572, 112.374, 72.918], ['B', ' HE3', 148.357, 112.153, 76.681], ['B', ' HZ2', 145.584, 114.908, 73.644], ['B', ' HZ3', 148.586, 114.524, 76.663], ['B', ' HH2', 147.252, 115.928, 75.186]]
[['B', ' N ', 147.557, 106.98, 73.972], ['B', ' CA ', 147.308, 105.883, 73.02], ['B', ' C ', 148.679, 105.19, 72.891], ['B', ' O ', 149.569, 105.662, 72.174], ['B', ' CB ', 146.711, 106.38, 71.708], ['B', ' CG ', 145.392, 107.195, 71.918], ['B', ' CD ', 144.276, 106.447, 72.614], ['B', ' OE1', 144.129, 105.289, 72.394], ['B', ' OE2', 143.585, 107.051, 73.404], ['B', ' H ', 147.364, 106.774, 74.935], ['B', ' HA ', 146.601, 105.173, 73.414], ['B', ' HB ', 147.427, 106.97, 71.143], ['B', ' HB ', 146.455, 105.515, 71.093], ['B', ' HG ', 145.608, 108.085, 72.473], ['B', ' HG ', 145.038, 107.507, 70.94]]
[['B', ' N ', 148.824, 104.071, 73.636], ['B', ' CA ', 150.078, 103.323, 73.866], ['B', ' C ', 150.312, 101.974, 73.136], ['B', ' O ', 149.47, 101.082, 73.224], ['B', ' CB ', 150.081, 102.998, 75.379], ['B', ' CG ', 151.115, 101.949, 75.877], ['B', ' SD ', 152.783, 102.504, 76.036], ['B', ' CE ', 152.744, 102.892, 77.704], ['B', ' H ', 147.983, 103.716, 74.094], ['B', ' HA ', 150.87, 104.008, 73.642], ['B', ' HB ', 150.269, 103.922, 75.939], ['B', ' HB ', 149.098, 102.66, 75.651], ['B', ' HG ', 150.809, 101.633, 76.852], ['B', ' HG ', 151.092, 101.07, 75.277], ['B', ' HE ', 153.707, 103.286, 78.021], ['B', ' HE ', 151.957, 103.593, 77.907], ['B', ' HE ', 152.542, 101.997, 78.223]]
[['B', ' N ', 151.46, 101.761, 72.441], ['B', ' CA ', 151.908, 100.492, 71.893], ['B', ' C ', 152.436, 99.806, 73.118], ['B', ' O ', 152.95, 100.506, 73.966], ['B', ' CB ', 153.006, 100.891, 70.916], ['B', ' CG ', 153.581, 102.143, 71.524], ['B', ' CD ', 152.402, 102.838, 72.219], ['B', ' HA ', 151.081, 99.942, 71.434], ['B', ' HB ', 153.744, 100.075, 70.835], ['B', ' HB ', 152.579, 101.046, 69.914], ['B', ' HG ', 154.383, 101.88, 72.238], ['B', ' HG ', 154.043, 102.768, 70.747], ['B', ' HD ', 152.78, 103.159, 73.171], ['B', ' HD ', 151.972, 103.65, 71.609]]
[['B', ' N ', 152.493, 98.512, 73.218], ['B', ' CA ', 152.998, 98.05, 74.496], ['B', ' C ', 154.43, 98.48, 74.831], ['B', ' O ', 155.361, 98.34, 74.037], ['B', ' CB ', 152.905, 96.533, 74.544], ['B', ' CG ', 151.478, 96.007, 74.458], ['B', ' CD ', 150.981, 95.831, 73.062], ['B', ' OE1', 151.68, 96.225, 72.143], ['B', ' OE2', 149.887, 95.313, 72.899], ['B', ' H ', 152.161, 97.855, 72.508], ['B', ' HA ', 152.348, 98.455, 75.272], ['B', ' HB ', 153.489, 96.1, 73.733], ['B', ' HB ', 153.336, 96.177, 75.485], ['B', ' HG ', 151.414, 95.058, 74.99], ['B', ' HG ', 150.837, 96.712, 74.952]]
[['B', ' N ', 154.576, 98.931, 76.07], ['B', ' CA ', 155.827, 99.297, 76.73], ['B', ' C ', 156.085, 98.154, 77.687], ['B', ' O ', 155.131, 97.531, 78.139], ['B', ' CB ', 155.766, 100.68, 77.378], ['B', ' CG ', 157.019, 101.098, 78.227], ['B', ' SD ', 156.884, 102.782, 78.938], ['B', ' CE ', 158.322, 102.919, 79.972], ['B', ' H ', 153.71, 99.017, 76.585], ['B', ' HA ', 156.635, 99.303, 75.997], ['B', ' HB ', 155.712, 101.405, 76.575], ['B', ' HB ', 154.872, 100.798, 77.915], ['B', ' HG ', 157.145, 100.405, 79.056], ['B', ' HG ', 157.914, 101.058, 77.607], ['B', ' HE ', 158.324, 103.891, 80.455], ['B', ' HE ', 158.295, 102.137, 80.737], ['B', ' HE ', 159.225, 102.812, 79.366]]
[['B', ' N ', 157.336, 97.856, 78.006], ['B', ' CA ', 157.567, 96.678, 78.824], ['B', ' C ', 157.357, 96.882, 80.325], ['B', ' O ', 156.726, 96.044, 80.982], ['B', ' CB ', 159.04, 96.333, 78.646], ['B', ' CG ', 159.412, 96.031, 77.199], ['B', ' OD1', 159.114, 94.977, 76.669], ['B', ' OD2', 159.961, 96.931, 76.609], ['B', ' H ', 158.116, 98.373, 77.616], ['B', ' HA ', 156.923, 95.875, 78.47], ['B', ' HB ', 159.658, 97.157, 79.001], ['B', ' HB ', 159.28, 95.462, 79.26]]
[['B', ' N ', 157.779, 98.023, 80.856], ['B', ' CA ', 157.671, 98.262, 82.297], ['B', ' C ', 156.794, 99.402, 82.69], ['B', ' O ', 157.095, 100.552, 82.377], ['B', ' CB ', 159.047, 98.578, 82.882], ['B', ' CG ', 159.098, 99.019, 84.391], ['B', ' CD1', 158.637, 97.869, 85.325], ['B', ' CD2', 160.521, 99.492, 84.675], ['B', ' H ', 158.235, 98.7, 80.263], ['B', ' HA ', 157.269, 97.365, 82.756], ['B', ' HB ', 159.668, 97.691, 82.783], ['B', ' HB ', 159.493, 99.374, 82.288], ['B', ' HG ', 158.421, 99.859, 84.568], ['B', ' HD1', 158.689, 98.209, 86.356], ['B', ' HD1', 157.61, 97.589, 85.104], ['B', ' HD1', 159.276, 97.01, 85.197], ['B', ' HD2', 160.606, 99.82, 85.706], ['B', ' HD2', 161.218, 98.698, 84.491], ['B', ' HD2', 160.759, 100.324, 84.013]]
[['B', ' N ', 155.775, 99.096, 83.468], ['B', ' CA ', 154.886, 100.118, 83.945], ['B', ' C ', 155.195, 100.498, 85.364], ['B', ' O ', 155.291, 99.635, 86.241], ['B', ' CB ', 153.462, 99.642, 83.87], ['B', ' H ', 155.598, 98.114, 83.701], ['B', ' HA ', 155.021, 100.994, 83.34], ['B', ' HB ', 152.817, 100.431, 84.218], ['B', ' HB ', 153.204, 99.384, 82.86], ['B', ' HB ', 153.351, 98.769, 84.497]]
[['B', ' N ', 155.317, 101.787, 85.615], ['B', ' CA ', 155.498, 102.246, 86.975], ['B', ' C ', 154.17, 102.805, 87.392], ['B', ' O ', 153.659, 103.738, 86.76], ['B', ' CB ', 156.6, 103.298, 87.061], ['B', ' CG ', 157.994, 102.863, 86.558], ['B', ' CD1', 158.955, 104.036, 86.696], ['B', ' CD2', 158.488, 101.653, 87.347], ['B', ' H ', 155.282, 102.482, 84.859], ['B', ' HA ', 155.72, 101.408, 87.634], ['B', ' HB ', 156.293, 104.163, 86.473], ['B', ' HB ', 156.698, 103.611, 88.087], ['B', ' HG ', 157.936, 102.598, 85.498], ['B', ' HD1', 159.938, 103.747, 86.331], ['B', ' HD1', 158.587, 104.877, 86.113], ['B', ' HD1', 159.028, 104.325, 87.736], ['B', ' HD2', 159.466, 101.37, 86.986], ['B', ' HD2', 158.553, 101.895, 88.397], ['B', ' HD2', 157.812, 100.82, 87.21]]
[['B', ' N ', 153.575, 102.207, 88.405], ['B', ' CA ', 152.243, 102.633, 88.793], ['B', ' C ', 152.273, 103.332, 90.152], ['B', ' O ', 152.714, 102.78, 91.162], ['B', ' CB ', 151.297, 101.43, 88.699], ['B', ' CG1', 151.279, 100.922, 87.283], ['B', ' CG2', 151.729, 100.286, 89.607], ['B', ' H ', 154.068, 101.442, 88.887], ['B', ' HA ', 151.885, 103.364, 88.07], ['B', ' HB ', 150.311, 101.772, 88.924], ['B', ' HG1', 150.579, 100.095, 87.203], ['B', ' HG1', 150.976, 101.711, 86.63], ['B', ' HG1', 152.272, 100.579, 86.993], ['B', ' HG2', 151.04, 99.457, 89.506], ['B', ' HG2', 152.718, 99.956, 89.329], ['B', ' HG2', 151.733, 100.616, 90.622]]
[['B', ' N ', 151.792, 104.569, 90.163], ['B', ' CA ', 151.91, 105.477, 91.309], ['B', ' C ', 151.143, 105.039, 92.554], ['B', ' O ', 151.612, 105.233, 93.667], ['B', ' CB ', 151.405, 106.848, 90.89], ['B', ' CG ', 152.228, 107.575, 89.748], ['B', ' CD ', 153.555, 107.981, 90.105], ['B', ' OE1', 153.744, 108.303, 91.225], ['B', ' OE2', 154.399, 108.0, 89.248], ['B', ' H ', 151.364, 104.923, 89.302], ['B', ' HA ', 152.968, 105.553, 91.575], ['B', ' HB ', 150.381, 106.746, 90.587], ['B', ' HB ', 151.402, 107.511, 91.761], ['B', ' HG ', 152.306, 106.898, 88.899], ['B', ' HG ', 151.688, 108.447, 89.417]]
[['B', ' N ', 149.978, 104.431, 92.386], ['B', ' CA ', 149.23, 103.966, 93.554], ['B', ' C ', 147.928, 104.635, 93.901], ['B', ' O ', 147.416, 105.45, 93.146], ['B', ' H ', 149.635, 104.308, 91.447], ['B', ' HA ', 149.018, 102.917, 93.411], ['B', ' HA ', 149.878, 104.038, 94.418]]
[['B', ' N ', 147.379, 104.224, 95.052], ['B', ' CA ', 146.099, 104.688, 95.572], ['B', ' C ', 144.939, 104.52, 94.619], ['B', ' O ', 144.385, 105.503, 94.128], ['B', ' CB ', 146.209, 106.127, 96.019], ['B', ' OG ', 147.153, 106.246, 97.039], ['B', ' H ', 147.9, 103.558, 95.62], ['B', ' HA ', 145.873, 104.089, 96.457], ['B', ' HB ', 146.497, 106.754, 95.181], ['B', ' HB ', 145.242, 106.477, 96.373], ['B', ' HG ', 147.105, 107.154, 97.339]]
[['B', ' N ', 144.578, 103.28, 94.318], ['B', ' CA ', 143.52, 103.069, 93.355], ['B', ' C ', 142.212, 103.281, 94.018], ['B', ' O ', 141.914, 102.636, 95.013], ['B', ' CB ', 143.517, 101.636, 92.854], ['B', ' CG1', 142.361, 101.39, 91.857], ['B', ' CG2', 144.779, 101.365, 92.305], ['B', ' H ', 145.002, 102.489, 94.808], ['B', ' HA ', 143.632, 103.77, 92.529], ['B', ' HB ', 143.36, 100.975, 93.679], ['B', ' HG1', 142.392, 100.354, 91.533], ['B', ' HG1', 141.396, 101.58, 92.327], ['B', ' HG1', 142.473, 102.04, 90.991], ['B', ' HG2', 144.793, 100.338, 91.965], ['B', ' HG2', 144.953, 102.045, 91.491], ['B', ' HG2', 145.543, 101.509, 93.061]]
[['B', ' N ', 141.403, 104.154, 93.481], ['B', ' CA ', 140.146, 104.373, 94.13], ['B', ' C ', 139.125, 103.461, 93.512], ['B', ' O ', 139.065, 103.31, 92.296], ['B', ' CB ', 139.671, 105.783, 93.992], ['B', ' SG ', 138.285, 106.092, 95.03], ['B', ' H ', 141.68, 104.687, 92.669], ['B', ' HA ', 140.227, 104.145, 95.188], ['B', ' HB ', 140.446, 106.466, 94.204], ['B', ' HB ', 139.363, 105.953, 92.968], ['B', ' HG ', 137.543, 105.047, 94.626]]
[['B', ' N ', 138.32, 102.858, 94.344], ['B', ' CA ', 137.25, 102.013, 93.881], ['B', ' C ', 136.154, 102.984, 93.549], ['B', ' O ', 136.325, 104.172, 93.794], ['B', ' CB ', 136.822, 101.022, 94.945], ['B', ' CG ', 137.921, 100.094, 95.466], ['B', ' CD1', 137.316, 99.185, 96.489], ['B', ' CD2', 138.576, 99.324, 94.335], ['B', ' H ', 138.438, 103.015, 95.35], ['B', ' HA ', 137.539, 101.5, 92.968], ['B', ' HB ', 136.445, 101.59, 95.799], ['B', ' HB ', 136.016, 100.407, 94.553], ['B', ' HG ', 138.685, 100.69, 95.974], ['B', ' HD1', 138.085, 98.538, 96.904], ['B', ' HD1', 136.881, 99.777, 97.282], ['B', ' HD1', 136.542, 98.575, 96.029], ['B', ' HD2', 139.343, 98.679, 94.748], ['B', ' HD2', 137.835, 98.718, 93.815], ['B', ' HD2', 139.04, 100.014, 93.642]]
[['B', ' N ', 135.096, 102.553, 92.879], ['B', ' CA ', 133.994, 103.44, 92.448], ['B', ' C ', 134.384, 104.201, 91.174], ['B', ' O ', 133.627, 104.24, 90.209], ['B', ' CB ', 133.59, 104.48, 93.518], ['B', ' CG ', 133.147, 103.906, 94.856], ['B', ' CD ', 131.964, 103.021, 94.725], ['B', ' OE1', 130.997, 103.346, 94.032], ['B', ' NE2', 132.013, 101.873, 95.387], ['B', ' H ', 135.016, 101.565, 92.682], ['B', ' HA ', 133.124, 102.826, 92.213], ['B', ' HB ', 134.333, 105.251, 93.665], ['B', ' HB ', 132.717, 105.006, 93.141], ['B', ' HG ', 133.962, 103.339, 95.301], ['B', ' HG ', 132.883, 104.737, 95.517], ['B', ' HE2', 131.242, 101.233, 95.339], ['B', ' HE2', 132.81, 101.651, 95.946]]
[['B', ' N ', 135.577, 104.774, 91.181], ['B', ' CA ', 136.14, 105.555, 90.094], ['B', ' C ', 136.586, 104.673, 88.945], ['B', ' O ', 137.596, 103.956, 89.028], ['B', ' CB ', 137.347, 106.321, 90.618], ['B', ' CG ', 138.02, 107.232, 89.612], ['B', ' OD1', 137.835, 107.047, 88.418], ['B', ' OD2', 138.751, 108.088, 90.032], ['B', ' H ', 136.091, 104.695, 92.051], ['B', ' HA ', 135.381, 106.251, 89.729], ['B', ' HB ', 137.041, 106.905, 91.452], ['B', ' HB ', 138.083, 105.6, 90.981]]
[['B', ' N ', 135.823, 104.747, 87.866], ['B', ' CA ', 136.02, 103.91, 86.713], ['B', ' C ', 137.244, 104.276, 85.913], ['B', ' O ', 137.665, 103.494, 85.062], ['B', ' CB ', 134.79, 103.97, 85.8], ['B', ' CG ', 134.566, 105.313, 85.042], ['B', ' CD ', 133.841, 106.374, 85.843], ['B', ' OE1', 133.852, 106.303, 87.05], ['B', ' OE2', 133.274, 107.253, 85.243], ['B', ' H ', 135.023, 105.39, 87.872], ['B', ' HA ', 136.136, 102.887, 87.062], ['B', ' HB ', 134.863, 103.18, 85.052], ['B', ' HB ', 133.897, 103.773, 86.393], ['B', ' HG ', 135.51, 105.724, 84.698], ['B', ' HG ', 133.974, 105.095, 84.155]]
[['B', ' N ', 137.825, 105.457, 86.126], ['B', ' CA ', 138.949, 105.792, 85.28], ['B', ' C ', 140.146, 105.002, 85.722], ['B', ' O ', 140.787, 104.334, 84.913], ['B', ' CB ', 139.306, 107.279, 85.345], ['B', ' CG ', 138.315, 108.208, 84.721], ['B', ' ND1', 137.971, 108.143, 83.39], ['B', ' CD2', 137.618, 109.253, 85.244], ['B', ' CE1', 137.098, 109.098, 83.114], ['B', ' NE2', 136.867, 109.798, 84.219], ['B', ' H ', 137.512, 106.084, 86.884], ['B', ' HA ', 138.731, 105.531, 84.246], ['B', ' HB ', 139.418, 107.572, 86.394], ['B', ' HB ', 140.272, 107.436, 84.862], ['B', ' HD1', 138.32, 107.486, 82.72], ['B', ' HD2', 137.579, 109.685, 86.248], ['B', ' HE1', 136.701, 109.207, 82.105]]
[['B', ' N ', 140.398, 104.984, 87.025], ['B', ' CA ', 141.554, 104.271, 87.514], ['B', ' C ', 141.367, 102.781, 87.371], ['B', ' O ', 142.305, 102.07, 87.002], ['B', ' CB ', 141.823, 104.62, 88.962], ['B', ' OG ', 142.208, 105.964, 89.091], ['B', ' H ', 139.83, 105.539, 87.661], ['B', ' HA ', 142.419, 104.569, 86.919], ['B', ' HB ', 140.92, 104.437, 89.554], ['B', ' HB ', 142.608, 103.975, 89.35], ['B', ' HG ', 142.438, 106.085, 90.016]]
[['B', ' N ', 140.153, 102.292, 87.606], ['B', ' CA ', 139.955, 100.864, 87.51], ['B', ' C ', 140.129, 100.403, 86.071], ['B', ' O ', 140.771, 99.379, 85.806], ['B', ' CB ', 138.538, 100.552, 87.979], ['B', ' CG ', 138.244, 100.814, 89.479], ['B', ' CD1', 136.753, 100.73, 89.713], ['B', ' CD2', 138.966, 99.816, 90.336], ['B', ' H ', 139.384, 102.9, 87.915], ['B', ' HA ', 140.698, 100.362, 88.122], ['B', ' HB ', 137.849, 101.158, 87.398], ['B', ' HB ', 138.331, 99.505, 87.772], ['B', ' HG ', 138.576, 101.817, 89.753], ['B', ' HD1', 136.544, 100.932, 90.757], ['B', ' HD1', 136.251, 101.478, 89.099], ['B', ' HD1', 136.391, 99.739, 89.452], ['B', ' HD2', 138.743, 100.025, 91.368], ['B', ' HD2', 138.646, 98.806, 90.09], ['B', ' HD2', 140.023, 99.909, 90.184]]
[['B', ' N ', 139.6, 101.179, 85.126], ['B', ' CA ', 139.689, 100.814, 83.734], ['B', ' C ', 141.112, 100.861, 83.239], ['B', ' O ', 141.596, 99.914, 82.602], ['B', ' CB ', 138.858, 101.755, 82.873], ['B', ' CG ', 138.884, 101.357, 81.485], ['B', ' ND1', 138.113, 100.324, 80.996], ['B', ' CD2', 139.636, 101.783, 80.461], ['B', ' CE1', 138.391, 100.147, 79.724], ['B', ' NE2', 139.311, 101.012, 79.383], ['B', ' H ', 139.065, 102.021, 85.349], ['B', ' HA ', 139.318, 99.801, 83.598], ['B', ' HB ', 137.825, 101.754, 83.215], ['B', ' HB ', 139.24, 102.775, 82.962], ['B', ' HD2', 140.391, 102.57, 80.488], ['B', ' HE1', 137.955, 99.395, 79.071], ['B', ' HE2', 139.762, 101.081, 78.461]]
[['B', ' N ', 141.792, 101.97, 83.525], ['B', ' CA ', 143.127, 102.162, 83.026], ['B', ' C ', 144.065, 101.099, 83.559], ['B', ' O ', 144.847, 100.546, 82.786], ['B', ' CB ', 143.6, 103.56, 83.396], ['B', ' CG ', 142.905, 104.694, 82.641], ['B', ' CD ', 143.332, 106.092, 83.119], ['B', ' OE1', 144.247, 106.189, 83.905], ['B', ' OE2', 142.743, 107.072, 82.688], ['B', ' H ', 141.355, 102.72, 84.071], ['B', ' HA ', 143.101, 102.079, 81.937], ['B', ' HB ', 143.426, 103.721, 84.462], ['B', ' HB ', 144.637, 103.646, 83.227], ['B', ' HG ', 143.162, 104.599, 81.585], ['B', ' HG ', 141.829, 104.588, 82.72]]
[['B', ' N ', 143.938, 100.714, 84.832], ['B', ' CA ', 144.809, 99.667, 85.324], ['B', ' C ', 144.575, 98.345, 84.656], ['B', ' O ', 145.533, 97.6, 84.431], ['B', ' CB ', 144.669, 99.477, 86.815], ['B', ' CG ', 145.266, 100.52, 87.677], ['B', ' CD1', 144.836, 100.301, 89.034], ['B', ' CD2', 146.833, 100.431, 87.624], ['B', ' H ', 143.278, 101.178, 85.466], ['B', ' HA ', 145.824, 99.963, 85.1], ['B', ' HB ', 143.599, 99.428, 87.044], ['B', ' HB ', 145.105, 98.556, 87.072], ['B', ' HG ', 144.925, 101.493, 87.37], ['B', ' HD1', 145.285, 101.062, 89.616], ['B', ' HD1', 143.749, 100.373, 89.094], ['B', ' HD1', 145.16, 99.327, 89.38], ['B', ' HD2', 147.258, 101.192, 88.28], ['B', ' HD2', 147.158, 99.449, 87.955], ['B', ' HD2', 147.204, 100.603, 86.625]]
[['B', ' N ', 143.333, 98.002, 84.346], ['B', ' CA ', 143.158, 96.729, 83.687], ['B', ' C ', 143.862, 96.749, 82.33], ['B', ' O ', 144.568, 95.793, 81.985], ['B', ' CB ', 141.68, 96.408, 83.565], ['B', ' CG ', 141.04, 96.073, 84.908], ['B', ' CD ', 139.557, 95.799, 84.776], ['B', ' CE ', 138.927, 95.512, 86.132], ['B', ' NZ ', 137.457, 95.256, 86.018], ['B', ' H ', 142.531, 98.593, 84.601], ['B', ' HA ', 143.627, 95.956, 84.293], ['B', ' HB ', 141.156, 97.275, 83.148], ['B', ' HB ', 141.538, 95.57, 82.885], ['B', ' HG ', 141.531, 95.193, 85.328], ['B', ' HG ', 141.192, 96.901, 85.597], ['B', ' HD ', 139.071, 96.675, 84.337], ['B', ' HD ', 139.397, 94.945, 84.119], ['B', ' HE ', 139.407, 94.64, 86.574], ['B', ' HE ', 139.087, 96.373, 86.787], ['B', ' HZ ', 137.073, 95.072, 86.935], ['B', ' HZ ', 137.003, 96.067, 85.62], ['B', ' HZ ', 137.297, 94.456, 85.422]]
[['B', ' N ', 143.753, 97.865, 81.597], ['B', ' CA ', 144.43, 97.947, 80.303], ['B', ' C ', 145.944, 97.912, 80.476], ['B', ' O ', 146.649, 97.262, 79.698], ['B', ' CB ', 144.022, 99.207, 79.545], ['B', ' CG ', 142.589, 99.191, 79.016], ['B', ' CD ', 142.217, 100.472, 78.336], ['B', ' OE1', 142.912, 101.422, 78.536], ['B', ' OE2', 141.231, 100.505, 77.614], ['B', ' H ', 143.144, 98.628, 81.925], ['B', ' HA ', 144.137, 97.079, 79.709], ['B', ' HB ', 144.124, 100.073, 80.205], ['B', ' HB ', 144.694, 99.36, 78.698], ['B', ' HG ', 142.479, 98.368, 78.311], ['B', ' HG ', 141.908, 99.016, 79.853]]
[['B', ' N ', 146.438, 98.563, 81.523], ['B', ' CA ', 147.855, 98.597, 81.799], ['B', ' C ', 148.381, 97.206, 82.004], ['B', ' O ', 149.407, 96.852, 81.431], ['B', ' CB ', 148.123, 99.429, 83.057], ['B', ' CG ', 149.581, 99.667, 83.46], ['B', ' CD1', 149.692, 101.036, 84.089], ['B', ' CD2', 150.004, 98.615, 84.497], ['B', ' H ', 145.799, 99.106, 82.11], ['B', ' HA ', 148.364, 99.046, 80.948], ['B', ' HB ', 147.612, 100.373, 82.983], ['B', ' HB ', 147.67, 98.901, 83.886], ['B', ' HG ', 150.228, 99.62, 82.591], ['B', ' HD1', 150.708, 101.223, 84.384], ['B', ' HD1', 149.398, 101.797, 83.385], ['B', ' HD1', 149.047, 101.088, 84.96], ['B', ' HD2', 151.012, 98.802, 84.805], ['B', ' HD2', 149.352, 98.68, 85.367], ['B', ' HD2', 149.95, 97.62, 84.095]]
[['B', ' N ', 147.7, 96.405, 82.82], ['B', ' CA ', 148.182, 95.061, 83.081], ['B', ' C ', 148.223, 94.209, 81.845], ['B', ' O ', 149.135, 93.392, 81.7], ['B', ' CB ', 147.346, 94.372, 84.116], ['B', ' CG ', 147.723, 92.876, 84.406], ['B', ' CD ', 149.064, 92.667, 85.087], ['B', ' NE ', 150.17, 92.561, 84.13], ['B', ' CZ ', 151.474, 92.36, 84.451], ['B', ' NH1', 151.862, 92.207, 85.729], ['B', ' NH2', 152.363, 92.318, 83.476], ['B', ' H ', 146.864, 96.763, 83.299], ['B', ' HA ', 149.195, 95.147, 83.47], ['B', ' HB ', 147.411, 94.95, 85.006], ['B', ' HB ', 146.301, 94.397, 83.797], ['B', ' HG ', 146.968, 92.467, 85.071], ['B', ' HG ', 147.718, 92.296, 83.485], ['B', ' HD ', 149.276, 93.502, 85.746], ['B', ' HD ', 149.027, 91.748, 85.672], ['B', ' HE ', 149.945, 92.67, 83.122], ['B', ' HH1', 151.175, 92.216, 86.501], ['B', ' HH1', 152.86, 92.079, 85.979], ['B', ' HH2', 152.086, 92.462, 82.488], ['B', ' HH2', 153.353, 92.143, 83.67]]
[['B', ' N ', 147.241, 94.374, 80.967], ['B', ' CA ', 147.208, 93.611, 79.736], ['B', ' C ', 148.379, 93.953, 78.825], ['B', ' O ', 148.886, 93.091, 78.104], ['B', ' CB ', 145.908, 93.863, 78.978], ['B', ' CG ', 144.669, 93.288, 79.626], ['B', ' CD ', 143.417, 93.646, 78.876], ['B', ' OE1', 143.513, 94.412, 77.946], ['B', ' OE2', 142.37, 93.16, 79.228], ['B', ' H ', 146.47, 95.017, 81.19], ['B', ' HA ', 147.268, 92.553, 79.989], ['B', ' HB ', 145.759, 94.938, 78.876], ['B', ' HB ', 145.989, 93.45, 77.974], ['B', ' HG ', 144.763, 92.204, 79.659], ['B', ' HG ', 144.599, 93.648, 80.647]]
[['B', ' N ', 148.795, 95.215, 78.835], ['B', ' CA ', 149.847, 95.665, 77.944], ['B', ' C ', 151.269, 95.59, 78.516], ['B', ' O ', 152.221, 95.357, 77.77], ['B', ' CB ', 149.48, 97.073, 77.544], ['B', ' CG ', 148.195, 97.053, 76.732], ['B', ' CD ', 147.65, 98.389, 76.452], ['B', ' CE ', 148.372, 99.049, 75.36], ['B', ' NZ ', 147.71, 100.245, 74.997], ['B', ' H ', 148.309, 95.893, 79.432], ['B', ' HA ', 149.822, 95.035, 77.057], ['B', ' HB ', 149.309, 97.668, 78.448], ['B', ' HB ', 150.289, 97.533, 76.993], ['B', ' HG ', 148.386, 96.54, 75.787], ['B', ' HG ', 147.432, 96.492, 77.267], ['B', ' HD ', 146.597, 98.302, 76.186], ['B', ' HD ', 147.724, 99.009, 77.35], ['B', ' HE ', 149.388, 99.289, 75.662], ['B', ' HE ', 148.407, 98.392, 74.489], ['B', ' HZ ', 148.226, 100.658, 74.233], ['B', ' HZ ', 146.775, 100.05, 74.702], ['B', ' HZ ', 147.673, 100.878, 75.783]]
[['B', ' N ', 151.416, 95.762, 79.825], ['B', ' CA ', 152.707, 95.734, 80.501], ['B', ' C ', 153.213, 94.314, 80.61], ['B', ' O ', 152.437, 93.36, 80.713], ['B', ' CB ', 152.588, 96.336, 81.888], ['B', ' H ', 150.59, 95.964, 80.385], ['B', ' HA ', 153.428, 96.299, 79.912], ['B', ' HB ', 153.557, 96.316, 82.373], ['B', ' HB ', 152.235, 97.357, 81.821], ['B', ' HB ', 151.875, 95.749, 82.458]]
[['B', ' N ', 154.524, 94.154, 80.656], ['B', ' CA ', 155.068, 92.841, 80.903], ['B', ' C ', 155.361, 92.817, 82.376], ['B', ' O ', 155.053, 91.86, 83.087], ['B', ' CB ', 156.315, 92.63, 80.079], ['B', ' CG ', 156.025, 92.567, 78.613], ['B', ' CD ', 157.278, 92.443, 77.824], ['B', ' CE ', 156.996, 92.46, 76.338], ['B', ' NZ ', 158.243, 92.555, 75.57], ['B', ' H ', 155.161, 94.947, 80.574], ['B', ' HA ', 154.33, 92.073, 80.671], ['B', ' HB ', 157.013, 93.452, 80.255], ['B', ' HB ', 156.806, 91.705, 80.382], ['B', ' HG ', 155.381, 91.712, 78.409], ['B', ' HG ', 155.497, 93.475, 78.309], ['B', ' HD ', 157.943, 93.272, 78.064], ['B', ' HD ', 157.781, 91.512, 78.079], ['B', ' HE ', 156.471, 91.55, 76.056], ['B', ' HE ', 156.371, 93.323, 76.101], ['B', ' HZ ', 158.05, 92.586, 74.585], ['B', ' HZ ', 158.695, 93.438, 75.867], ['B', ' HZ ', 158.845, 91.777, 75.773]]
[['B', ' N ', 155.858, 93.937, 82.846], ['B', ' CA ', 156.178, 94.107, 84.233], ['B', ' C ', 155.378, 95.247, 84.777], ['B', ' O ', 155.295, 96.306, 84.145], ['B', ' CB ', 157.64, 94.487, 84.381], ['B', ' CG ', 158.666, 93.543, 83.854], ['B', ' CD1', 159.976, 94.237, 83.928], ['B', ' CD2', 158.692, 92.28, 84.692], ['B', ' H ', 156.073, 94.694, 82.199], ['B', ' HA ', 155.933, 93.206, 84.797], ['B', ' HB ', 157.788, 95.42, 83.87], ['B', ' HB ', 157.839, 94.639, 85.442], ['B', ' HG ', 158.454, 93.294, 82.815], ['B', ' HD1', 160.762, 93.582, 83.554], ['B', ' HD1', 159.948, 95.147, 83.328], ['B', ' HD1', 160.166, 94.49, 84.966], ['B', ' HD2', 159.46, 91.607, 84.317], ['B', ' HD2', 158.906, 92.529, 85.735], ['B', ' HD2', 157.725, 91.777, 84.644]]
[['B', ' N ', 154.795, 95.046, 85.931], ['B', ' CA ', 154.116, 96.134, 86.588], ['B', ' C ', 154.793, 96.279, 87.916], ['B', ' O ', 154.901, 95.312, 88.677], ['B', ' CB ', 152.612, 95.881, 86.737], ['B', ' CG1', 151.955, 97.035, 87.479], ['B', ' CG2', 152.008, 95.75, 85.364], ['B', ' H ', 154.859, 94.114, 86.38], ['B', ' HA ', 154.261, 97.057, 86.027], ['B', ' HB ', 152.45, 94.967, 87.307], ['B', ' HG1', 150.887, 96.847, 87.572], ['B', ' HG1', 152.384, 97.141, 88.474], ['B', ' HG1', 152.114, 97.958, 86.924], ['B', ' HG2', 150.941, 95.566, 85.448], ['B', ' HG2', 152.18, 96.664, 84.815], ['B', ' HG2', 152.473, 94.934, 84.837]]
[['B', ' N ', 155.275, 97.473, 88.186], ['B', ' CA ', 155.945, 97.69, 89.428], ['B', ' C ', 155.269, 98.729, 90.251], ['B', ' O ', 155.164, 99.895, 89.851], ['B', ' CB ', 157.387, 98.121, 89.207], ['B', ' SG ', 158.332, 98.358, 90.732], ['B', ' H ', 155.182, 98.236, 87.508], ['B', ' HA ', 155.929, 96.773, 89.988], ['B', ' HB ', 157.899, 97.389, 88.603], ['B', ' HB ', 157.39, 99.056, 88.662], ['B', ' HG ', 157.447, 99.185, 91.348]]
[['B', ' N ', 154.829, 98.32, 91.421], ['B', ' CA ', 154.218, 99.283, 92.288], ['B', ' C ', 155.306, 100.304, 92.434], ['B', ' O ', 156.454, 99.926, 92.67], ['B', ' CB ', 153.799, 98.632, 93.579], ['B', ' H ', 154.948, 97.33, 91.669], ['B', ' HA ', 153.368, 99.743, 91.807], ['B', ' HB ', 153.4, 99.326, 94.258], ['B', ' HB ', 153.053, 97.869, 93.366], ['B', ' HB ', 154.633, 98.194, 94.025]]
[['B', ' N ', 155.008, 101.579, 92.311], ['B', ' CA ', 156.084, 102.541, 92.345], ['B', ' C ', 155.963, 103.524, 93.458], ['B', ' O ', 155.992, 104.728, 93.253], ['B', ' CB ', 156.143, 103.241, 91.013], ['B', ' CG ', 157.347, 103.996, 90.817], ['B', ' CD1', 158.566, 103.35, 90.788], ['B', ' CD2', 157.303, 105.344, 90.631], ['B', ' CE1', 159.703, 104.046, 90.584], ['B', ' CE2', 158.442, 106.037, 90.429], ['B', ' CZ ', 159.635, 105.396, 90.405], ['B', ' H ', 154.057, 101.902, 92.125], ['B', ' HA ', 157.016, 102.007, 92.495], ['B', ' HB ', 156.066, 102.5, 90.218], ['B', ' HB ', 155.289, 103.917, 90.919], ['B', ' HD1', 158.611, 102.268, 90.926], ['B', ' HD2', 156.335, 105.871, 90.655], ['B', ' HE1', 160.664, 103.533, 90.558], ['B', ' HE2', 158.398, 107.115, 90.287], ['B', ' HZ ', 160.524, 105.969, 90.239]]
[['B', ' N ', 155.819, 102.984, 94.631], ['B', ' CA ', 155.725, 103.728, 95.86], ['B', ' C ', 154.921, 102.901, 96.802], ['B', ' O ', 154.222, 101.975, 96.389], ['B', ' H ', 155.761, 101.973, 94.652], ['B', ' HA ', 156.719, 103.91, 96.272], ['B', ' HA ', 155.244, 104.689, 95.689]]
[['B', ' N ', 154.936, 103.244, 98.07], ['B', ' CA ', 154.163, 102.442, 99.009], ['B', ' C ', 152.673, 102.466, 98.73], ['B', ' O ', 152.025, 101.44, 98.858], ['B', ' CB ', 154.428, 102.876, 100.433], ['B', ' OG ', 155.743, 102.573, 100.819], ['B', ' H ', 155.494, 104.035, 98.406], ['B', ' HA ', 154.484, 101.404, 98.914], ['B', ' HB ', 154.268, 103.947, 100.522], ['B', ' HB ', 153.72, 102.383, 101.101], ['B', ' HG ', 155.845, 102.947, 101.704]]
[['B', ' N ', 152.125, 103.579, 98.217], ['B', ' CA ', 150.709, 103.762, 97.958], ['B', ' C ', 150.184, 102.803, 96.886], ['B', ' O ', 148.978, 102.596, 96.752], ['B', ' CB ', 150.401, 105.228, 97.615], ['B', ' SG ', 150.412, 106.392, 99.069], ['B', ' H ', 152.75, 104.369, 98.066], ['B', ' HA ', 150.189, 103.543, 98.882], ['B', ' HB ', 151.127, 105.604, 96.879], ['B', ' HB ', 149.419, 105.308, 97.147]]
[['B', ' N ', 151.093, 102.217, 96.116], ['B', ' CA ', 150.762, 101.266, 95.078], ['B', ' C ', 150.777, 99.809, 95.567], ['B', ' O ', 150.195, 98.936, 94.917], ['B', ' CB ', 151.738, 101.484, 93.945], ['B', ' H ', 152.087, 102.395, 96.281], ['B', ' HA ', 149.753, 101.449, 94.745], ['B', ' HB ', 151.527, 100.81, 93.134], ['B', ' HB ', 151.678, 102.494, 93.592], ['B', ' HB ', 152.735, 101.326, 94.308]]
[['B', ' N ', 151.414, 99.544, 96.703], ['B', ' CA ', 151.58, 98.218, 97.296], ['B', ' C ', 151.699, 98.446, 98.783], ['B', ' O ', 152.798, 98.68, 99.282], ['B', ' CB ', 152.778, 97.466, 96.751], ['B', ' H ', 151.79, 100.316, 97.262], ['B', ' HA ', 150.693, 97.623, 97.107], ['B', ' HB ', 152.849, 96.492, 97.259], ['B', ' HB ', 152.654, 97.307, 95.696], ['B', ' HB ', 153.679, 98.038, 96.94]]
[['B', ' N ', 150.552, 98.371, 99.451], ['B', ' CA ', 150.314, 98.782, 100.826], ['B', ' C ', 149.978, 100.236, 100.818], ['B', ' O ', 150.817, 101.09, 101.082], ['B', ' CB ', 151.484, 98.536, 101.779], ['B', ' OG1', 151.802, 97.137, 101.816], ['B', ' CG2', 151.078, 98.976, 103.13], ['B', ' H ', 149.753, 98.079, 98.922], ['B', ' HA ', 149.45, 98.261, 101.209], ['B', ' HB ', 152.353, 99.113, 101.502], ['B', ' HG1', 152.048, 96.811, 100.91], ['B', ' HG2', 151.86, 98.816, 103.798], ['B', ' HG2', 150.833, 100.02, 103.161], ['B', ' HG2', 150.224, 98.424, 103.423]]
[['B', ' N ', 148.714, 100.519, 100.545], ['B', ' CA ', 148.323, 101.885, 100.38], ['B', ' C ', 148.773, 102.654, 101.605], ['B', ' O ', 148.398, 102.282, 102.714], ['B', ' H ', 148.046, 99.784, 100.418], ['B', ' HA ', 148.711, 102.263, 99.45], ['B', ' HA ', 147.241, 101.934, 100.295]]
[['B', ' N ', 149.52, 103.744, 101.402], ['B', ' CA ', 150.062, 104.59, 102.428], ['B', ' C ', 149.132, 105.758, 102.472], ['B', ' O ', 148.628, 106.184, 101.437], ['B', ' CB ', 151.542, 104.952, 102.092], ['B', ' SG ', 152.036, 106.001, 100.493], ['B', ' H ', 149.743, 104.001, 100.457], ['B', ' HA ', 150.052, 104.068, 103.387], ['B', ' HB ', 151.965, 105.479, 102.958], ['B', ' HB ', 152.1, 104.015, 102.031]]
[['B', ' N ', 148.867, 106.289, 103.656], ['B', ' CA ', 147.98, 107.442, 103.863], ['B', ' C ', 146.516, 107.1, 103.522], ['B', ' O ', 145.647, 107.09, 104.38], ['B', ' CB ', 148.438, 108.641, 103.025], ['B', ' CG ', 149.784, 109.181, 103.418], ['B', ' CD1', 150.946, 108.645, 102.893], ['B', ' CD2', 149.9, 110.248, 104.251], ['B', ' CE1', 152.191, 109.163, 103.209], ['B', ' CE2', 151.145, 110.773, 104.575], ['B', ' CZ ', 152.289, 110.235, 104.059], ['B', ' H ', 149.343, 105.876, 104.457], ['B', ' HA ', 148.027, 107.724, 104.917], ['B', ' HB ', 148.458, 108.427, 101.969], ['B', ' HB ', 147.715, 109.446, 103.161], ['B', ' HD1', 150.871, 107.821, 102.214], ['B', ' HD2', 149.0, 110.692, 104.651], ['B', ' HE1', 153.086, 108.719, 102.774], ['B', ' HE2', 151.214, 111.617, 105.231], ['B', ' HZ ', 153.26, 110.658, 104.314]]
[['B', ' N ', 146.274, 106.681, 102.294], ['B', ' CA ', 144.99, 106.38, 101.703], ['B', ' C ', 144.213, 105.305, 102.432], ['B', ' O ', 142.985, 105.325, 102.439], ['B', ' CB ', 145.21, 105.992, 100.232], ['B', ' OG1', 143.986, 106.007, 99.561], ['B', ' CG2', 145.818, 104.601, 100.104], ['B', ' H ', 147.06, 106.662, 101.672], ['B', ' HA ', 144.39, 107.292, 101.723], ['B', ' HB ', 145.889, 106.714, 99.773], ['B', ' HG1', 143.663, 106.912, 99.498], ['B', ' HG2', 145.97, 104.377, 99.049], ['B', ' HG2', 146.77, 104.582, 100.615], ['B', ' HG2', 145.16, 103.851, 100.527]]
[['B', ' N ', 144.879, 104.402, 103.133], ['B', ' CA ', 144.158, 103.373, 103.858], ['B', ' C ', 143.398, 103.937, 105.059], ['B', ' O ', 142.601, 103.223, 105.674], ['B', ' CB ', 145.08, 102.251, 104.279], ['B', ' CG ', 145.603, 101.353, 103.155], ['B', ' CD ', 144.567, 100.416, 102.623], ['B', ' NE ', 144.034, 99.556, 103.681], ['B', ' CZ ', 144.574, 98.386, 104.119], ['B', ' NH1', 145.663, 97.892, 103.575], ['B', ' NH2', 143.987, 97.738, 105.12], ['B', ' H ', 145.892, 104.386, 103.13], ['B', ' HA ', 143.418, 102.954, 103.18], ['B', ' HB ', 145.968, 102.7, 104.704], ['B', ' HB ', 144.617, 101.639, 105.048], ['B', ' HG ', 145.904, 101.987, 102.333], ['B', ' HG ', 146.46, 100.776, 103.508], ['B', ' HD ', 143.741, 100.969, 102.18], ['B', ' HD ', 145.013, 99.789, 101.857], ['B', ' HE ', 143.19, 99.876, 104.142], ['B', ' HH1', 146.115, 98.362, 102.812], ['B', ' HH1', 146.043, 97.012, 103.915], ['B', ' HH2', 143.15, 98.113, 105.543], ['B', ' HH2', 144.392, 96.857, 105.49]]
[['B', ' N ', 143.621, 105.218, 105.374], ['B', ' CA ', 142.924, 105.902, 106.447], ['B', ' C ', 141.741, 106.701, 105.893], ['B', ' O ', 141.063, 107.398, 106.65], ['B', ' CB ', 143.852, 106.86, 107.192], ['B', ' CG ', 144.923, 106.244, 108.008], ['B', ' CD1', 146.129, 105.953, 107.448], ['B', ' CD2', 144.72, 106.024, 109.344], ['B', ' CE1', 147.123, 105.437, 108.204], ['B', ' CE2', 145.727, 105.51, 110.111], ['B', ' CZ ', 146.927, 105.214, 109.541], ['B', ' OH ', 147.951, 104.707, 110.307], ['B', ' H ', 144.316, 105.747, 104.843], ['B', ' HA ', 142.541, 105.165, 107.147], ['B', ' HB ', 144.334, 107.504, 106.49], ['B', ' HB ', 143.26, 107.497, 107.843], ['B', ' HD1', 146.305, 106.131, 106.405], ['B', ' HD2', 143.761, 106.267, 109.798], ['B', ' HE1', 148.074, 105.211, 107.75], ['B', ' HE2', 145.574, 105.34, 111.176], ['B', ' HH ', 147.739, 104.8, 111.238]]
[['B', ' N ', 141.479, 106.608, 104.583], ['B', ' CA ', 140.344, 107.292, 103.97], ['B', ' C ', 139.046, 106.7, 104.45], ['B', ' O ', 138.876, 105.477, 104.451], ['B', ' CB ', 140.402, 107.197, 102.47], ['B', ' OG ', 139.229, 107.71, 101.902], ['B', ' H ', 142.072, 106.038, 103.978], ['B', ' HA ', 140.354, 108.335, 104.246], ['B', ' HB ', 141.263, 107.769, 102.113], ['B', ' HB ', 140.543, 106.162, 102.157], ['B', ' HG ', 138.707, 106.923, 101.613]]
[['B', ' N ', 138.101, 107.557, 104.842], ['B', ' CA ', 136.812, 107.075, 105.303], ['B', ' C ', 135.642, 107.693, 104.552], ['B', ' O ', 134.501, 107.609, 104.999], ['B', ' CB ', 136.683, 107.298, 106.802], ['B', ' CG ', 137.7, 106.477, 107.654], ['B', ' CD ', 137.457, 104.992, 107.605], ['B', ' NE ', 138.425, 104.24, 108.405], ['B', ' CZ ', 139.615, 103.742, 107.955], ['B', ' NH1', 140.019, 103.908, 106.708], ['B', ' NH2', 140.384, 103.068, 108.796], ['B', ' H ', 138.272, 108.553, 104.836], ['B', ' HA ', 136.76, 106.008, 105.108], ['B', ' HB ', 136.83, 108.354, 107.029], ['B', ' HB ', 135.68, 107.027, 107.128], ['B', ' HG ', 138.707, 106.665, 107.306], ['B', ' HG ', 137.622, 106.789, 108.693], ['B', ' HD ', 136.463, 104.787, 108.002], ['B', ' HD ', 137.512, 104.62, 106.594], ['B', ' HE ', 138.187, 104.071, 109.372], ['B', ' HH1', 139.463, 104.432, 106.013], ['B', ' HH1', 140.926, 103.517, 106.398], ['B', ' HH2', 140.089, 102.93, 109.751], ['B', ' HH2', 141.268, 102.684, 108.485]]
[['B', ' N ', 135.922, 108.328, 103.427], ['B', ' CA ', 134.869, 108.928, 102.619], ['B', ' C ', 134.492, 110.294, 103.098], ['B', ' O ', 135.165, 110.887, 103.944], ['B', ' H ', 136.883, 108.367, 103.115], ['B', ' HA ', 135.195, 109.026, 101.591], ['B', ' HA ', 133.991, 108.282, 102.619]]
[['B', ' N ', 133.435, 110.833, 102.515], ['B', ' CA ', 133.074, 112.187, 102.837], ['B', ' C ', 134.013, 112.987, 101.987], ['B', ' O ', 134.646, 112.403, 101.113], ['B', ' H ', 132.922, 110.332, 101.784], ['B', ' HA ', 132.037, 112.388, 102.573], ['B', ' HA ', 133.226, 112.389, 103.895]]
[['B', ' N ', 134.158, 114.277, 102.28], ['B', ' CA ', 134.954, 115.215, 101.485], ['B', ' C ', 134.137, 115.694, 100.328], ['B', ' O ', 133.819, 114.941, 99.419], ['B', ' CB ', 136.261, 114.596, 100.967], ['B', ' CG ', 137.15, 115.494, 100.156], ['B', ' CD ', 137.702, 116.522, 100.876], ['B', ' OE1', 138.556, 116.282, 101.758], ['B', ' NE2', 137.205, 117.718, 100.571], ['B', ' H ', 133.616, 114.639, 103.048], ['B', ' HA ', 135.2, 116.078, 102.107], ['B', ' HB ', 136.805, 114.207, 101.812], ['B', ' HB ', 136.087, 113.821, 100.274], ['B', ' HG ', 137.976, 114.908, 99.797], ['B', ' HG ', 136.588, 115.912, 99.311], ['B', ' HE2', 137.498, 118.542, 101.103], ['B', ' HE2', 136.489, 117.795, 99.809]]
[['B', ' N ', 133.814, 116.97, 100.348], ['B', ' CA ', 132.958, 117.481, 99.321], ['B', ' C ', 133.62, 117.482, 98.003], ['B', ' O ', 134.85, 117.561, 97.907], ['B', ' CB ', 132.422, 118.855, 99.644], ['B', ' CG ', 131.443, 118.841, 100.757], ['B', ' CD ', 130.242, 117.994, 100.367], ['B', ' OE1', 129.779, 118.056, 99.221], ['B', ' NE2', 129.739, 117.199, 101.305], ['B', ' H ', 134.142, 117.566, 101.095], ['B', ' HA ', 132.109, 116.806, 99.228], ['B', ' HB ', 133.243, 119.516, 99.917], ['B', ' HB ', 131.952, 119.269, 98.767], ['B', ' HG ', 131.9, 118.406, 101.641], ['B', ' HG ', 131.105, 119.859, 100.962], ['B', ' HE2', 128.946, 116.62, 101.103], ['B', ' HE2', 130.144, 117.179, 102.219]]
[['B', ' N ', 132.74, 117.41, 97.008], ['B', ' CA ', 133.003, 117.271, 95.596], ['B', ' C ', 133.354, 115.832, 95.333], ['B', ' O ', 134.511, 115.477, 95.218], ['B', ' CB ', 134.09, 118.178, 95.11], ['B', ' H ', 131.768, 117.407, 97.293], ['B', ' HA ', 132.086, 117.511, 95.054], ['B', ' HB ', 134.186, 118.013, 94.051], ['B', ' HB ', 133.806, 119.201, 95.289], ['B', ' HB ', 135.034, 117.97, 95.593]]
[['B', ' N ', 132.298, 115.022, 95.23], ['B', ' CA ', 132.3, 113.564, 95.079], ['B', ' C ', 132.738, 112.74, 96.323], ['B', ' O ', 133.576, 111.833, 96.196], ['B', ' CB ', 133.217, 113.178, 93.945], ['B', ' CG ', 132.924, 113.757, 92.631], ['B', ' CD ', 131.772, 113.236, 92.006], ['B', ' OE1', 131.489, 112.036, 92.059], ['B', ' NE2', 131.083, 114.099, 91.339], ['B', ' H ', 131.397, 115.475, 95.291], ['B', ' HA ', 131.295, 113.255, 94.795], ['B', ' HB ', 134.235, 113.362, 94.164], ['B', ' HB ', 133.099, 112.121, 93.818], ['B', ' HG ', 132.797, 114.83, 92.72], ['B', ' HG ', 133.736, 113.557, 91.977], ['B', ' HE2', 130.292, 113.799, 90.779], ['B', ' HE2', 131.38, 115.064, 91.308]]
[['B', ' N ', 132.021, 112.879, 97.466], ['B', ' CA ', 132.22, 112.225, 98.763], ['B', ' C ', 132.013, 110.708, 98.738], ['B', ' O ', 132.298, 109.989, 99.709], ['B', ' CB ', 131.155, 112.892, 99.641], ['B', ' CG ', 130.111, 113.358, 98.697], ['B', ' CD ', 130.863, 113.792, 97.478], ['B', ' HA ', 133.231, 112.472, 99.12], ['B', ' HB ', 130.774, 112.171, 100.374], ['B', ' HB ', 131.611, 113.719, 100.203], ['B', ' HG ', 129.388, 112.551, 98.495], ['B', ' HG ', 129.544, 114.185, 99.153], ['B', ' HD ', 130.21, 113.676, 96.617], ['B', ' HD ', 131.2, 114.828, 97.63]]
[['B', ' N ', 131.435, 110.225, 97.646], ['B', ' CA ', 131.139, 108.824, 97.449], ['B', ' C ', 132.361, 107.964, 97.148], ['B', ' O ', 132.266, 106.742, 97.2], ['B', ' CB ', 130.15, 108.677, 96.321], ['B', ' OG ', 130.723, 109.062, 95.105], ['B', ' H ', 131.188, 110.839, 96.886], ['B', ' HA ', 130.681, 108.448, 98.363], ['B', ' HB ', 129.822, 107.637, 96.259], ['B', ' HB ', 129.272, 109.288, 96.524], ['B', ' HG ', 130.053, 108.9, 94.43]]
[['B', ' N ', 133.515, 108.566, 96.845], ['B', ' CA ', 134.68, 107.741, 96.499], ['B', ' C ', 135.113, 106.786, 97.615], ['B', ' O ', 135.129, 105.565, 97.432], ['B', ' CB ', 135.853, 108.639, 96.127], ['B', ' CG ', 135.792, 109.166, 94.741], ['B', ' ND1', 135.082, 110.268, 94.391], ['B', ' CD2', 136.365, 108.723, 93.613], ['B', ' CE1', 135.229, 110.478, 93.092], ['B', ' NE2', 136.0, 109.56, 92.611], ['B', ' H ', 133.552, 109.588, 96.811], ['B', ' HA ', 134.436, 107.135, 95.626], ['B', ' HB ', 135.853, 109.494, 96.797], ['B', ' HB ', 136.786, 108.126, 96.284], ['B', ' HD1', 134.522, 110.872, 95.008], ['B', ' HD2', 137.007, 107.904, 93.394], ['B', ' HE1', 134.76, 111.304, 92.582]]
[['B', ' N ', 135.452, 107.338, 98.773], ['B', ' CA ', 135.794, 106.593, 99.99], ['B', ' C ', 136.91, 105.55, 99.985], ['B', ' O ', 137.899, 105.69, 100.711], ['B', ' CB ', 134.53, 105.893, 100.52], ['B', ' CG ', 134.731, 105.101, 101.827], ['B', ' CD ', 133.474, 104.483, 102.383], ['B', ' OE1', 132.418, 104.695, 101.841], ['B', ' OE2', 133.582, 103.777, 103.355], ['B', ' H ', 135.431, 108.347, 98.818], ['B', ' HA ', 136.106, 107.32, 100.719], ['B', ' HB ', 133.751, 106.636, 100.689], ['B', ' HB ', 134.149, 105.198, 99.775], ['B', ' HG ', 135.439, 104.297, 101.669], ['B', ' HG ', 135.158, 105.754, 102.566]]
[['B', ' N ', 136.719, 104.474, 99.246], ['B', ' CA ', 137.584, 103.315, 99.378], ['B', ' C ', 138.679, 103.204, 98.354], ['B', ' O ', 138.431, 103.226, 97.15], ['B', ' CB ', 136.762, 102.059, 99.379], ['B', ' OG ', 137.595, 100.941, 99.427], ['B', ' H ', 135.933, 104.481, 98.603], ['B', ' HA ', 138.065, 103.381, 100.355], ['B', ' HB ', 136.094, 102.062, 100.241], ['B', ' HB ', 136.145, 102.024, 98.482], ['B', ' HG ', 137.018, 100.184, 99.566]]
[['B', ' N ', 139.897, 103.094, 98.864], ['B', ' CA ', 141.103, 102.967, 98.072], ['B', ' C ', 141.819, 101.666, 98.35], ['B', ' O ', 141.76, 101.142, 99.465], ['B', ' CB ', 142.036, 104.114, 98.361], ['B', ' CG ', 141.589, 105.427, 97.85], ['B', ' CD1', 140.629, 106.195, 98.479], ['B', ' CD2', 142.201, 105.926, 96.751], ['B', ' CE1', 140.3, 107.419, 97.974], ['B', ' CE2', 141.891, 107.143, 96.258], ['B', ' CZ ', 140.936, 107.891, 96.86], ['B', ' H ', 139.985, 103.094, 99.872], ['B', ' HA ', 140.821, 102.987, 97.032], ['B', ' HB ', 142.174, 104.2, 99.439], ['B', ' HB ', 143.014, 103.899, 97.927], ['B', ' HD1', 140.128, 105.83, 99.378], ['B', ' HD2', 142.961, 105.332, 96.268], ['B', ' HE1', 139.535, 108.029, 98.463], ['B', ' HE2', 142.408, 107.511, 95.368], ['B', ' HZ ', 140.68, 108.864, 96.455]]
[['B', ' N ', 142.478, 101.133, 97.333], ['B', ' CA ', 143.23, 99.905, 97.479], ['B', ' C ', 144.629, 100.008, 96.85], ['B', ' O ', 144.906, 100.933, 96.079], ['B', ' CB ', 142.445, 98.741, 96.827], ['B', ' CG1', 141.094, 98.579, 97.504], ['B', ' CG2', 142.277, 98.994, 95.35], ['B', ' H ', 142.445, 101.621, 96.435], ['B', ' HA ', 143.298, 99.707, 98.54], ['B', ' HB ', 142.984, 97.817, 96.966], ['B', ' HG1', 140.564, 97.742, 97.054], ['B', ' HG1', 141.242, 98.385, 98.566], ['B', ' HG1', 140.499, 99.479, 97.382], ['B', ' HG2', 141.736, 98.166, 94.9], ['B', ' HG2', 141.717, 99.921, 95.194], ['B', ' HG2', 143.254, 99.07, 94.881]]
[['B', ' N ', 145.548, 99.109, 97.203], ['B', ' CA ', 146.806, 98.888, 96.54], ['B', ' C ', 146.502, 98.415, 95.139], ['B', ' O ', 145.496, 97.753, 94.913], ['B', ' CB ', 147.429, 97.753, 97.344], ['B', ' CG ', 146.774, 97.824, 98.681], ['B', ' CD ', 145.386, 98.324, 98.427], ['B', ' HA ', 147.414, 99.804, 96.539], ['B', ' HB ', 147.248, 96.788, 96.84], ['B', ' HB ', 148.494, 97.895, 97.375], ['B', ' HG ', 146.749, 96.816, 99.135], ['B', ' HG ', 147.33, 98.444, 99.354], ['B', ' HD ', 144.714, 97.483, 98.285], ['B', ' HD ', 145.109, 98.944, 99.285]]
[['B', ' N ', 147.389, 98.665, 94.209], ['B', ' CA ', 147.176, 98.217, 92.856], ['B', ' C ', 147.143, 96.723, 92.842], ['B', ' O ', 146.309, 96.131, 92.162], ['B', ' CB ', 148.209, 98.806, 91.909], ['B', ' CG1', 147.899, 100.277, 91.831], ['B', ' CG2', 148.133, 98.123, 90.545], ['B', ' CD1', 148.859, 101.101, 91.209], ['B', ' H ', 148.259, 99.143, 94.44], ['B', ' HA ', 146.202, 98.565, 92.524], ['B', ' HB ', 149.213, 98.693, 92.329], ['B', ' HG1', 147.004, 100.382, 91.263], ['B', ' HG1', 147.737, 100.656, 92.837], ['B', ' HG2', 148.847, 98.547, 89.857], ['B', ' HG2', 148.351, 97.087, 90.661], ['B', ' HG2', 147.133, 98.236, 90.14], ['B', ' HD1', 148.499, 102.126, 91.192], ['B', ' HD1', 149.787, 101.055, 91.742], ['B', ' HD1', 148.978, 100.756, 90.219]]
[['B', ' N ', 148.002, 96.133, 93.645], ['B', ' CA ', 148.163, 94.701, 93.783], ['B', ' C ', 146.863, 93.979, 94.191], ['B', ' O ', 146.776, 92.762, 94.037], ['B', ' CB ', 149.257, 94.425, 94.799], ['B', ' H ', 148.632, 96.742, 94.153], ['B', ' HA ', 148.476, 94.306, 92.825], ['B', ' HB ', 149.422, 93.348, 94.883], ['B', ' HB ', 150.181, 94.907, 94.479], ['B', ' HB ', 148.956, 94.821, 95.764]]
[['B', ' N ', 145.868, 94.669, 94.76], ['B', ' CA ', 144.639, 93.963, 95.124], ['B', ' C ', 143.67, 93.863, 93.947], ['B', ' O ', 142.637, 93.197, 94.036], ['B', ' CB ', 143.907, 94.624, 96.287], ['B', ' CG ', 144.575, 94.489, 97.654], ['B', ' OD1', 145.393, 93.617, 97.858], ['B', ' OD2', 144.181, 95.222, 98.524], ['B', ' H ', 145.92, 95.683, 94.882], ['B', ' HA ', 144.905, 92.95, 95.427], ['B', ' HB ', 143.814, 95.692, 96.065], ['B', ' HB ', 142.898, 94.224, 96.354]]
[['B', ' N ', 143.967, 94.576, 92.869], ['B', ' CA ', 143.13, 94.606, 91.672], ['B', ' C ', 143.832, 93.914, 90.517], ['B', ' O ', 143.231, 93.195, 89.717], ['B', ' CB ', 142.868, 96.065, 91.261], ['B', ' CG ', 142.01, 96.31, 89.976], ['B', ' CD1', 140.587, 95.824, 90.182], ['B', ' CD2', 142.063, 97.778, 89.625], ['B', ' H ', 144.849, 95.087, 92.855], ['B', ' HA ', 142.199, 94.089, 91.886], ['B', ' HB ', 142.36, 96.557, 92.088], ['B', ' HB ', 143.83, 96.561, 91.127], ['B', ' HG ', 142.427, 95.742, 89.145], ['B', ' HD1', 140.014, 95.998, 89.274], ['B', ' HD1', 140.584, 94.759, 90.405], ['B', ' HD1', 140.132, 96.369, 91.009], ['B', ' HD2', 141.485, 97.967, 88.714], ['B', ' HD2', 141.655, 98.354, 90.442], ['B', ' HD2', 143.093, 98.057, 89.463]]
[['B', ' N ', 145.113, 94.203, 90.431], ['B', ' CA ', 146.015, 93.803, 89.386], ['B', ' C ', 147.06, 92.867, 89.908], ['B', ' O ', 147.612, 93.098, 90.971], ['B', ' CB ', 146.714, 95.046, 88.823], ['B', ' CG1', 145.679, 96.06, 88.299], ['B', ' CG2', 147.752, 94.711, 87.812], ['B', ' CD1', 144.751, 95.601, 87.166], ['B', ' H ', 145.511, 94.794, 91.158], ['B', ' HA ', 145.46, 93.286, 88.608], ['B', ' HB ', 147.199, 95.534, 89.637], ['B', ' HG1', 145.068, 96.369, 89.129], ['B', ' HG1', 146.233, 96.917, 87.951], ['B', ' HG2', 148.232, 95.624, 87.465], ['B', ' HG2', 148.512, 94.069, 88.232], ['B', ' HG2', 147.278, 94.212, 87.011], ['B', ' HD1', 144.081, 96.414, 86.899], ['B', ' HD1', 145.328, 95.321, 86.292], ['B', ' HD1', 144.153, 94.755, 87.489]]
[['B', ' N ', 147.371, 91.835, 89.155], ['B', ' CA ', 148.443, 90.965, 89.582], ['B', ' C ', 149.754, 91.685, 89.251], ['B', ' O ', 150.103, 91.854, 88.077], ['B', ' CB ', 148.348, 89.619, 88.853], ['B', ' CG ', 149.372, 88.591, 89.308], ['B', ' OD1', 150.261, 88.954, 90.029], ['B', ' OD2', 149.244, 87.446, 88.934], ['B', ' H ', 146.868, 91.659, 88.299], ['B', ' HA ', 148.384, 90.809, 90.659], ['B', ' HB ', 147.354, 89.199, 88.999], ['B', ' HB ', 148.48, 89.779, 87.782]]
[['B', ' N ', 150.408, 92.199, 90.293], ['B', ' CA ', 151.621, 93.004, 90.2], ['B', ' C ', 152.816, 92.171, 90.62], ['B', ' O ', 152.829, 91.629, 91.725], ['B', ' CB ', 151.494, 94.237, 91.125], ['B', ' CG1', 152.73, 95.061, 91.107], ['B', ' CG2', 150.355, 95.093, 90.677], ['B', ' H ', 150.023, 91.994, 91.207], ['B', ' HA ', 151.759, 93.33, 89.168], ['B', ' HB ', 151.33, 93.897, 92.146], ['B', ' HG1', 152.616, 95.914, 91.772], ['B', ' HG1', 153.57, 94.467, 91.439], ['B', ' HG1', 152.913, 95.414, 90.106], ['B', ' HG2', 150.274, 95.949, 91.343], ['B', ' HG2', 150.531, 95.434, 89.663], ['B', ' HG2', 149.449, 94.539, 90.701]]
[['B', ' N ', 153.793, 92.015, 89.729], ['B', ' CA ', 154.948, 91.2, 90.036], ['B', ' C ', 156.055, 91.882, 90.854], ['B', ' O ', 156.754, 91.216, 91.635], ['B', ' CB ', 155.469, 90.639, 88.721], ['B', ' CG ', 155.707, 91.739, 87.681], ['B', ' OD1', 154.734, 92.41, 87.27], ['B', ' OD2', 156.809, 91.894, 87.273], ['B', ' H ', 153.745, 92.452, 88.803], ['B', ' HA ', 154.594, 90.352, 90.625], ['B', ' HB ', 156.409, 90.11, 88.898], ['B', ' HB ', 154.75, 89.918, 88.324]]
[['B', ' N ', 156.176, 93.2, 90.733], ['B', ' CA ', 157.225, 93.946, 91.409], ['B', ' C ', 156.684, 95.04, 92.301], ['B', ' O ', 155.636, 95.617, 92.01], ['B', ' CB ', 158.092, 94.63, 90.359], ['B', ' CG ', 158.849, 93.792, 89.354], ['B', ' CD1', 159.414, 94.719, 88.292], ['B', ' CD2', 159.962, 93.046, 90.035], ['B', ' H ', 155.562, 93.721, 90.096], ['B', ' HA ', 157.807, 93.27, 92.025], ['B', ' HB ', 157.44, 95.222, 89.765], ['B', ' HB ', 158.767, 95.274, 90.856], ['B', ' HG ', 158.175, 93.086, 88.872], ['B', ' HD1', 159.959, 94.136, 87.553], ['B', ' HD1', 158.596, 95.245, 87.8], ['B', ' HD1', 160.081, 95.437, 88.756], ['B', ' HD2', 160.507, 92.456, 89.3], ['B', ' HD2', 160.644, 93.742, 90.515], ['B', ' HD2', 159.544, 92.399, 90.758]]
[['B', ' N ', 157.383, 95.346, 93.385], ['B', ' CA ', 156.971, 96.521, 94.126], ['B', ' C ', 158.121, 97.234, 94.739], ['B', ' O ', 158.928, 96.667, 95.464], ['B', ' CB ', 156.01, 96.175, 95.223], ['B', ' H ', 158.19, 94.785, 93.684], ['B', ' HA ', 156.511, 97.207, 93.424], ['B', ' HB ', 155.715, 97.082, 95.747], ['B', ' HB ', 155.148, 95.711, 94.786], ['B', ' HB ', 156.487, 95.513, 95.913]]
[['B', ' N ', 158.093, 98.525, 94.565], ['B', ' CA ', 159.078, 99.417, 95.09], ['B', ' C ', 158.447, 100.322, 96.127], ['B', ' O ', 157.908, 101.359, 95.762], ['B', ' CB ', 159.666, 100.222, 93.921], ['B', ' CG ', 160.917, 101.109, 94.165], ['B', ' CD1', 161.682, 101.203, 92.892], ['B', ' CD2', 160.491, 102.522, 94.572], ['B', ' H ', 157.371, 98.922, 93.958], ['B', ' HA ', 159.878, 98.833, 95.505], ['B', ' HB ', 159.922, 99.516, 93.137], ['B', ' HB ', 158.881, 100.868, 93.533], ['B', ' HG ', 161.559, 100.673, 94.923], ['B', ' HD1', 162.568, 101.817, 93.035], ['B', ' HD1', 161.976, 100.203, 92.609], ['B', ' HD1', 161.057, 101.638, 92.119], ['B', ' HD2', 161.354, 103.14, 94.696], ['B', ' HD2', 159.853, 102.955, 93.798], ['B', ' HD2', 159.955, 102.502, 95.499]]
[['B', ' N ', 158.415, 99.939, 97.403], ['B', ' CA ', 157.834, 100.703, 98.462], ['B', ' C ', 158.704, 101.904, 98.727], ['B', ' O ', 159.876, 101.947, 98.342], ['B', ' CB ', 157.796, 99.719, 99.626], ['B', ' CG ', 158.91, 98.764, 99.343], ['B', ' CD ', 158.914, 98.622, 97.844], ['B', ' HA ', 156.819, 101.011, 98.179], ['B', ' HB ', 157.906, 100.258, 100.576], ['B', ' HB ', 156.81, 99.231, 99.655], ['B', ' HG ', 159.865, 99.157, 99.721], ['B', ' HG ', 158.739, 97.804, 99.858], ['B', ' HD ', 159.916, 98.417, 97.543], ['B', ' HD ', 158.224, 97.825, 97.547]]
[['B', ' N ', 158.131, 102.853, 99.418], ['B', ' CA ', 158.788, 104.072, 99.835], ['B', ' C ', 157.696, 105.054, 100.133], ['B', ' O ', 156.656, 105.005, 99.458], ['B', ' H ', 157.165, 102.72, 99.701], ['B', ' HA ', 159.443, 103.917, 100.673], ['B', ' HA ', 159.387, 104.43, 99.023]]
[['B', ' N ', 157.895, 105.965, 101.123], ['B', ' CA ', 156.855, 106.929, 101.472], ['B', ' C ', 156.916, 107.963, 100.343], ['B', ' O ', 155.937, 108.164, 99.632], ['B', ' CB ', 157.04, 107.446, 102.914], ['B', ' SG ', 156.953, 106.125, 104.242], ['B', ' H ', 158.768, 105.993, 101.646], ['B', ' HA ', 155.875, 106.436, 101.437], ['B', ' HB ', 157.982, 107.909, 103.05], ['B', ' HB ', 156.28, 108.195, 103.143]]
[['B', ' N ', 158.003, 108.748, 100.181], ['B', ' CA ', 158.48, 109.181, 98.904], ['B', ' C ', 159.605, 108.187, 98.588], ['B', ' O ', 160.596, 108.209, 99.319], ['B', ' CB ', 159.01, 110.563, 99.146], ['B', ' CG ', 159.488, 110.536, 100.57], ['B', ' CD ', 158.661, 109.469, 101.275], ['B', ' HA ', 157.655, 109.181, 98.181], ['B', ' HB ', 159.811, 110.741, 98.434], ['B', ' HB ', 158.238, 111.292, 98.933], ['B', ' HG ', 160.565, 110.32, 100.605], ['B', ' HG ', 159.356, 111.522, 101.038], ['B', ' HD ', 159.392, 108.845, 101.768], ['B', ' HD ', 157.947, 109.945, 101.964]]
[['B', ' N ', 159.524, 107.269, 97.639], ['B', ' CA ', 160.602, 106.347, 97.37], ['B', ' C ', 161.804, 107.171, 97.0], ['B', ' O ', 161.671, 108.206, 96.349], ['B', ' CB ', 160.051, 105.497, 96.24], ['B', ' CG ', 158.932, 106.322, 95.654], ['B', ' CD ', 158.38, 107.133, 96.812], ['B', ' HA ', 160.831, 105.765, 98.264], ['B', ' HB ', 160.851, 105.299, 95.514], ['B', ' HB ', 159.706, 104.528, 96.625], ['B', ' HG ', 159.305, 106.974, 94.853], ['B', ' HG ', 158.163, 105.674, 95.188], ['B', ' HD ', 158.064, 108.093, 96.42], ['B', ' HD ', 157.564, 106.608, 97.341]]
[['B', ' N ', 162.967, 106.74, 97.463], ['B', ' CA ', 164.19, 107.475, 97.242], ['B', ' C ', 164.595, 107.431, 95.793], ['B', ' O ', 164.402, 106.409, 95.136], ['B', ' CB ', 165.289, 106.827, 98.069], ['B', ' OG ', 165.575, 105.542, 97.583], ['B', ' H ', 163.008, 105.879, 97.974], ['B', ' HA ', 164.015, 108.5, 97.565], ['B', ' HB ', 166.193, 107.427, 98.064], ['B', ' HB ', 164.956, 106.749, 99.099], ['B', ' HG ', 166.039, 105.066, 98.314]]
[['B', ' N ', 165.264, 108.464, 95.275], ['B', ' CA ', 165.749, 108.479, 93.927], ['B', ' C ', 166.79, 107.417, 93.681], ['B', ' O ', 166.87, 106.868, 92.588], ['B', ' CB ', 166.361, 109.872, 93.829], ['B', ' CG ', 166.632, 110.294, 95.247], ['B', ' CD ', 165.548, 109.675, 96.051], ['B', ' HA ', 164.906, 108.38, 93.229], ['B', ' HB ', 167.285, 109.834, 93.255], ['B', ' HB ', 165.693, 110.533, 93.286], ['B', ' HG ', 167.63, 109.966, 95.55], ['B', ' HG ', 166.627, 111.394, 95.309], ['B', ' HD ', 165.948, 109.473, 97.048], ['B', ' HD ', 164.662, 110.335, 96.072]]
[['B', ' N ', 167.505, 107.014, 94.725], ['B', ' CA ', 168.525, 106.017, 94.531], ['B', ' C ', 167.933, 104.653, 94.312], ['B', ' O ', 168.421, 103.909, 93.464], ['B', ' CB ', 169.491, 106.025, 95.701], ['B', ' CG ', 170.333, 107.302, 95.748], ['B', ' CD ', 171.273, 107.376, 96.902], ['B', ' OE1', 171.244, 106.496, 97.722], ['B', ' OE2', 172.034, 108.318, 96.957], ['B', ' H ', 167.431, 107.456, 95.629], ['B', ' HA ', 169.089, 106.282, 93.637], ['B', ' HB ', 168.934, 105.944, 96.639], ['B', ' HB ', 170.16, 105.167, 95.636], ['B', ' HG ', 170.908, 107.372, 94.825], ['B', ' HG ', 169.663, 108.161, 95.785]]
[['B', ' N ', 166.862, 104.309, 95.026], ['B', ' CA ', 166.315, 102.99, 94.788], ['B', ' C ', 165.659, 103.006, 93.438], ['B', ' O ', 165.656, 101.999, 92.742], ['B', ' CB ', 165.33, 102.495, 95.87], ['B', ' CG1', 165.066, 100.99, 95.732], ['B', ' CG2', 164.006, 103.185, 95.814], ['B', ' CD1', 166.21, 100.065, 96.014], ['B', ' H ', 166.466, 104.937, 95.729], ['B', ' HA ', 167.143, 102.297, 94.746], ['B', ' HB ', 165.77, 102.671, 96.844], ['B', ' HG1', 164.3, 100.759, 96.4], ['B', ' HG1', 164.712, 100.785, 94.725], ['B', ' HG2', 163.364, 102.802, 96.6], ['B', ' HG2', 164.133, 104.23, 95.948], ['B', ' HG2', 163.541, 102.995, 94.871], ['B', ' HD1', 165.874, 99.034, 95.908], ['B', ' HD1', 167.036, 100.228, 95.335], ['B', ' HD1', 166.523, 100.233, 97.024]]
[['B', ' N ', 165.08, 104.141, 93.061], ['B', ' CA ', 164.434, 104.188, 91.781], ['B', ' C ', 165.465, 104.023, 90.695], ['B', ' O ', 165.263, 103.236, 89.778], ['B', ' CB ', 163.717, 105.523, 91.598], ['B', ' CG1', 162.533, 105.589, 92.59], ['B', ' CG2', 163.275, 105.667, 90.136], ['B', ' CD1', 161.906, 106.981, 92.751], ['B', ' H ', 165.07, 104.949, 93.691], ['B', ' HA ', 163.72, 103.377, 91.707], ['B', ' HB ', 164.387, 106.34, 91.851], ['B', ' HG1', 161.779, 104.894, 92.275], ['B', ' HG1', 162.885, 105.273, 93.566], ['B', ' HG2', 162.771, 106.6, 90.019], ['B', ' HG2', 164.128, 105.649, 89.461], ['B', ' HG2', 162.606, 104.852, 89.872], ['B', ' HD1', 161.107, 106.925, 93.471], ['B', ' HD1', 162.655, 107.681, 93.115], ['B', ' HD1', 161.507, 107.341, 91.819]]
[['B', ' N ', 166.576, 104.748, 90.759], ['B', ' CA ', 167.555, 104.595, 89.71], ['B', ' C ', 168.097, 103.18, 89.684], ['B', ' O ', 168.246, 102.59, 88.616], ['B', ' CB ', 168.695, 105.561, 89.902], ['B', ' H ', 166.726, 105.415, 91.518], ['B', ' HA ', 167.072, 104.805, 88.76], ['B', ' HB ', 169.414, 105.445, 89.096], ['B', ' HB ', 168.315, 106.563, 89.907], ['B', ' HB ', 169.179, 105.356, 90.859]]
[['B', ' N ', 168.329, 102.584, 90.85], ['B', ' CA ', 168.88, 101.252, 90.855], ['B', ' C ', 167.958, 100.227, 90.259], ['B', ' O ', 168.427, 99.369, 89.511], ['B', ' CB ', 169.249, 100.824, 92.264], ['B', ' CG ', 170.472, 101.498, 92.84], ['B', ' CD ', 170.685, 101.049, 94.278], ['B', ' CE ', 171.901, 101.676, 94.918], ['B', ' NZ ', 173.164, 101.109, 94.374], ['B', ' H ', 168.188, 103.076, 91.736], ['B', ' HA ', 169.787, 101.263, 90.253], ['B', ' HB ', 168.408, 101.032, 92.929], ['B', ' HB ', 169.417, 99.75, 92.285], ['B', ' HG ', 171.334, 101.224, 92.24], ['B', ' HG ', 170.358, 102.575, 92.801], ['B', ' HD ', 169.804, 101.308, 94.869], ['B', ' HD ', 170.807, 99.967, 94.304], ['B', ' HE ', 171.886, 102.753, 94.746], ['B', ' HE ', 171.863, 101.489, 95.994], ['B', ' HZ ', 173.957, 101.532, 94.83], ['B', ' HZ ', 173.159, 100.111, 94.554], ['B', ' HZ ', 173.224, 101.271, 93.384]]
[['B', ' N ', 166.657, 100.312, 90.52], ['B', ' CA ', 165.79, 99.294, 89.984], ['B', ' C ', 165.385, 99.553, 88.551], ['B', ' O ', 165.181, 98.597, 87.801], ['B', ' CB ', 164.532, 99.18, 90.819], ['B', ' OG1', 163.851, 100.423, 90.771], ['B', ' CG2', 164.923, 98.849, 92.253], ['B', ' H ', 166.28, 101.022, 91.16], ['B', ' HA ', 166.319, 98.348, 90.029], ['B', ' HB ', 163.883, 98.41, 90.42], ['B', ' HG1', 162.961, 100.313, 91.097], ['B', ' HG2', 164.056, 98.798, 92.871], ['B', ' HG2', 165.43, 97.896, 92.264], ['B', ' HG2', 165.579, 99.602, 92.651]]
[['B', ' N ', 165.323, 100.805, 88.096], ['B', ' CA ', 164.938, 100.944, 86.7], ['B', ' C ', 166.135, 100.562, 85.853], ['B', ' O ', 165.969, 99.956, 84.795], ['B', ' CB ', 164.371, 102.338, 86.327], ['B', ' CG1', 163.138, 102.635, 87.211], ['B', ' CG2', 165.42, 103.417, 86.444], ['B', ' H ', 165.454, 101.607, 88.725], ['B', ' HA ', 164.14, 100.232, 86.493], ['B', ' HB ', 164.018, 102.308, 85.297], ['B', ' HG1', 162.702, 103.595, 86.933], ['B', ' HG1', 162.398, 101.848, 87.069], ['B', ' HG1', 163.43, 102.663, 88.257], ['B', ' HG2', 164.981, 104.369, 86.168], ['B', ' HG2', 165.773, 103.465, 87.447], ['B', ' HG2', 166.244, 103.21, 85.784]]
[['B', ' N ', 167.34, 100.883, 86.325], ['B', ' CA ', 168.533, 100.513, 85.616], ['B', ' C ', 168.737, 99.01, 85.709], ['B', ' O ', 169.059, 98.375, 84.709], ['B', ' CB ', 169.743, 101.278, 86.127], ['B', ' CG1', 171.013, 100.752, 85.459], ['B', ' CG2', 169.526, 102.753, 85.808], ['B', ' H ', 167.433, 101.417, 87.194], ['B', ' HA ', 168.402, 100.783, 84.571], ['B', ' HB ', 169.844, 101.139, 87.207], ['B', ' HG1', 171.871, 101.315, 85.825], ['B', ' HG1', 171.155, 99.699, 85.694], ['B', ' HG1', 170.93, 100.873, 84.378], ['B', ' HG2', 170.374, 103.337, 86.16], ['B', ' HG2', 169.42, 102.857, 84.746], ['B', ' HG2', 168.625, 103.113, 86.288]]
[['B', ' N ', 168.543, 98.404, 86.882], ['B', ' CA ', 168.69, 96.971, 86.948], ['B', ' C ', 167.712, 96.321, 85.977], ['B', ' O ', 168.062, 95.348, 85.315], ['B', ' CB ', 168.458, 96.48, 88.362], ['B', ' H ', 168.329, 98.917, 87.737], ['B', ' HA ', 169.702, 96.711, 86.641], ['B', ' HB ', 168.57, 95.403, 88.41], ['B', ' HB ', 169.174, 96.948, 89.035], ['B', ' HB ', 167.466, 96.747, 88.659]]
[['B', ' N ', 166.493, 96.846, 85.83], ['B', ' CA ', 165.609, 96.252, 84.84], ['B', ' C ', 166.127, 96.496, 83.431], ['B', ' O ', 166.142, 95.578, 82.617], ['B', ' CB ', 164.172, 96.766, 85.018], ['B', ' CG ', 163.416, 96.207, 86.256], ['B', ' CD1', 162.177, 96.966, 86.513], ['B', ' CD2', 163.003, 94.754, 85.961], ['B', ' H ', 166.164, 97.613, 86.423], ['B', ' HA ', 165.612, 95.18, 84.996], ['B', ' HB ', 164.217, 97.851, 85.126], ['B', ' HB ', 163.597, 96.531, 84.125], ['B', ' HG ', 164.047, 96.278, 87.133], ['B', ' HD1', 161.67, 96.549, 87.375], ['B', ' HD1', 162.421, 98.012, 86.71], ['B', ' HD1', 161.545, 96.883, 85.654], ['B', ' HD2', 162.451, 94.349, 86.808], ['B', ' HD2', 162.386, 94.75, 85.092], ['B', ' HD2', 163.86, 94.129, 85.769]]
[['B', ' N ', 166.671, 97.681, 83.165], ['B', ' CA ', 167.195, 98.032, 81.848], ['B', ' C ', 168.295, 97.063, 81.433], ['B', ' O ', 168.376, 96.648, 80.275], ['B', ' CB ', 167.775, 99.459, 81.911], ['B', ' CG ', 168.329, 100.12, 80.639], ['B', ' CD1', 167.23, 100.275, 79.596], ['B', ' CD2', 168.913, 101.487, 81.034], ['B', ' H ', 166.623, 98.415, 83.874], ['B', ' HA ', 166.381, 97.976, 81.132], ['B', ' HB ', 167.015, 100.117, 82.329], ['B', ' HB ', 168.603, 99.438, 82.597], ['B', ' HG ', 169.119, 99.495, 80.209], ['B', ' HD1', 167.64, 100.757, 78.705], ['B', ' HD1', 166.835, 99.301, 79.321], ['B', ' HD1', 166.429, 100.893, 79.997], ['B', ' HD2', 169.322, 101.981, 80.148], ['B', ' HD2', 168.127, 102.102, 81.461], ['B', ' HD2', 169.704, 101.345, 81.772]]
[['B', ' N ', 169.123, 96.684, 82.399], ['B', ' CA ', 170.239, 95.78, 82.184], ['B', ' C ', 169.959, 94.32, 82.564], ['B', ' O ', 170.888, 93.512, 82.616], ['B', ' CB ', 171.43, 96.284, 82.956], ['B', ' CG ', 171.937, 97.573, 82.414], ['B', ' OD1', 171.912, 97.828, 81.203], ['B', ' ND2', 172.417, 98.407, 83.291], ['B', ' H ', 168.994, 97.122, 83.316], ['B', ' HA ', 170.479, 95.791, 81.122], ['B', ' HB ', 171.141, 96.432, 84.001], ['B', ' HB ', 172.229, 95.547, 82.933], ['B', ' HD2', 172.78, 99.291, 82.995], ['B', ' HD2', 172.425, 98.161, 84.261]]
[['B', ' N ', 168.7, 93.99, 82.854], ['B', ' CA ', 168.247, 92.657, 83.254], ['B', ' C ', 168.953, 92.071, 84.488], ['B', ' O ', 169.136, 90.849, 84.601], ['B', ' CB ', 168.385, 91.705, 82.084], ['B', ' CG ', 167.53, 92.113, 80.93], ['B', ' OD1', 166.338, 92.408, 81.09], ['B', ' ND2', 168.114, 92.147, 79.759], ['B', ' H ', 167.97, 94.704, 82.772], ['B', ' HA ', 167.189, 92.74, 83.512], ['B', ' HB ', 169.421, 91.645, 81.758], ['B', ' HB ', 168.084, 90.707, 82.396], ['B', ' HD2', 167.594, 92.42, 78.95], ['B', ' HD2', 169.081, 91.908, 79.676]]
[['B', ' N ', 169.287, 92.899, 85.467], ['B', ' CA ', 169.946, 92.377, 86.65], ['B', ' C ', 168.936, 91.899, 87.659], ['B', ' O ', 168.53, 92.621, 88.58], ['B', ' CB ', 170.887, 93.406, 87.277], ['B', ' CG ', 171.663, 92.843, 88.488], ['B', ' OD1', 171.228, 91.838, 89.051], ['B', ' OD2', 172.684, 93.389, 88.825], ['B', ' H ', 169.08, 93.889, 85.38], ['B', ' HA ', 170.551, 91.523, 86.352], ['B', ' HB ', 171.603, 93.755, 86.521], ['B', ' HB ', 170.323, 94.26, 87.596]]
[['B', ' N ', 168.522, 90.657, 87.494], ['B', ' CA ', 167.486, 90.183, 88.367], ['B', ' C ', 167.999, 89.586, 89.653], ['B', ' O ', 167.209, 89.194, 90.507], ['B', ' CB ', 166.494, 89.307, 87.646], ['B', ' CG ', 165.724, 90.117, 86.591], ['B', ' SD ', 164.454, 89.21, 85.738], ['B', ' CE ', 163.159, 89.251, 87.005], ['B', ' H ', 168.893, 90.108, 86.712], ['B', ' HA ', 166.92, 91.046, 88.655], ['B', ' HB ', 167.016, 88.486, 87.151], ['B', ' HB ', 165.799, 88.88, 88.362], ['B', ' HG ', 165.251, 90.958, 87.082], ['B', ' HG ', 166.424, 90.511, 85.851], ['B', ' HE ', 162.272, 88.733, 86.638], ['B', ' HE ', 163.507, 88.762, 87.913], ['B', ' HE ', 162.901, 90.289, 87.23]]
[['B', ' N ', 169.312, 89.539, 89.839], ['B', ' CA ', 169.788, 89.046, 91.116], ['B', ' C ', 169.505, 90.169, 92.094], ['B', ' O ', 169.027, 89.947, 93.208], ['B', ' CB ', 171.289, 88.773, 91.099], ['B', ' CG ', 171.733, 87.576, 90.255], ['B', ' OD1', 170.929, 86.742, 89.907], ['B', ' OD2', 172.913, 87.519, 89.963], ['B', ' H ', 169.957, 89.867, 89.123], ['B', ' HA ', 169.236, 88.154, 91.407], ['B', ' HB ', 171.794, 89.662, 90.712], ['B', ' HB ', 171.636, 88.636, 92.125]]
[['B', ' N ', 169.73, 91.398, 91.62], ['B', ' CA ', 169.458, 92.592, 92.393], ['B', ' C ', 167.973, 92.769, 92.636], ['B', ' O ', 167.554, 93.085, 93.745], ['B', ' CB ', 169.983, 93.845, 91.713], ['B', ' CG ', 169.687, 95.066, 92.539], ['B', ' CD1', 170.448, 95.323, 93.657], ['B', ' CD2', 168.646, 95.914, 92.202], ['B', ' CE1', 170.176, 96.401, 94.438], ['B', ' CE2', 168.379, 96.998, 92.993], ['B', ' CZ ', 169.135, 97.239, 94.108], ['B', ' OH ', 168.847, 98.314, 94.91], ['B', ' H ', 170.175, 91.494, 90.693], ['B', ' HA ', 169.95, 92.49, 93.36], ['B', ' HB ', 171.063, 93.769, 91.565], ['B', ' HB ', 169.518, 93.959, 90.731], ['B', ' HD1', 171.268, 94.659, 93.928], ['B', ' HD2', 168.038, 95.718, 91.319], ['B', ' HE1', 170.777, 96.592, 95.324], ['B', ' HE2', 167.569, 97.668, 92.747], ['B', ' HH ', 169.51, 98.38, 95.627]]
[['B', ' N ', 167.176, 92.597, 91.586], ['B', ' CA ', 165.738, 92.809, 91.646], ['B', ' C ', 164.916, 91.698, 92.283], ['B', ' O ', 163.86, 91.99, 92.836], ['B', ' CB ', 165.236, 92.974, 90.238], ['B', ' CG ', 165.75, 94.168, 89.506], ['B', ' CD1', 165.485, 93.964, 88.1], ['B', ' CD2', 165.024, 95.426, 89.97], ['B', ' H ', 167.604, 92.368, 90.683], ['B', ' HA ', 165.567, 93.715, 92.219], ['B', ' HB ', 165.445, 92.096, 89.689], ['B', ' HB ', 164.151, 93.071, 90.285], ['B', ' HG ', 166.82, 94.275, 89.656], ['B', ' HD1', 165.834, 94.807, 87.546], ['B', ' HD1', 165.995, 93.079, 87.748], ['B', ' HD1', 164.436, 93.843, 87.988], ['B', ' HD2', 165.378, 96.274, 89.403], ['B', ' HD2', 163.957, 95.312, 89.797], ['B', ' HD2', 165.201, 95.605, 91.026]]
[['B', ' N ', 165.349, 90.441, 92.244], ['B', ' CA ', 164.536, 89.383, 92.837], ['B', ' C ', 164.026, 89.676, 94.254], ['B', ' O ', 162.933, 89.24, 94.569], ['B', ' CB ', 165.225, 88.016, 92.755], ['B', ' CG ', 164.451, 86.876, 93.425], ['B', ' CD ', 163.1, 86.575, 92.796], ['B', ' OE1', 162.984, 86.355, 91.586], ['B', ' NE2', 162.069, 86.561, 93.628], ['B', ' H ', 166.202, 90.184, 91.74], ['B', ' HA ', 163.654, 89.286, 92.207], ['B', ' HB ', 165.303, 87.749, 91.701], ['B', ' HB ', 166.235, 88.038, 93.125], ['B', ' HG ', 165.057, 85.978, 93.334], ['B', ' HG ', 164.3, 87.098, 94.481], ['B', ' HE2', 161.149, 86.369, 93.291], ['B', ' HE2', 162.209, 86.768, 94.602]]
[['B', ' N ', 164.79, 90.256, 95.184], ['B', ' CA ', 164.321, 90.658, 96.5], ['B', ' C ', 163.201, 91.725, 96.476], ['B', ' O ', 162.486, 91.88, 97.462], ['B', ' CB ', 165.608, 91.18, 97.136], ['B', ' CG ', 166.698, 90.476, 96.397], ['B', ' CD ', 166.221, 90.367, 95.017], ['B', ' HA ', 163.968, 89.76, 97.03], ['B', ' HB ', 165.684, 92.265, 97.009], ['B', ' HB ', 165.616, 90.967, 98.217], ['B', ' HG ', 167.607, 91.05, 96.42], ['B', ' HG ', 166.921, 89.504, 96.852], ['B', ' HD ', 166.462, 91.251, 94.511], ['B', ' HD ', 166.682, 89.509, 94.571]]
[['B', ' N ', 163.063, 92.478, 95.368], ['B', ' CA ', 162.028, 93.506, 95.218], ['B', ' C ', 160.802, 92.828, 94.632], ['B', ' O ', 159.638, 93.248, 94.781], ['B', ' CB ', 162.488, 94.637, 94.307], ['B', ' CG ', 161.462, 95.735, 94.203], ['B', ' SD ', 161.896, 97.09, 93.171], ['B', ' CE ', 161.596, 96.465, 91.541], ['B', ' H ', 163.664, 92.321, 94.572], ['B', ' HA ', 161.782, 93.904, 96.191], ['B', ' HB ', 163.418, 95.054, 94.68], ['B', ' HB ', 162.683, 94.239, 93.312], ['B', ' HG ', 160.529, 95.337, 93.835], ['B', ' HG ', 161.285, 96.119, 95.2], ['B', ' HE ', 161.825, 97.23, 90.803], ['B', ' HE ', 162.208, 95.59, 91.362], ['B', ' HE ', 160.57, 96.202, 91.464]]
[['B', ' N ', 161.081, 91.782, 93.895], ['B', ' CA ', 160.065, 90.998, 93.272], ['B', ' C ', 159.382, 90.33, 94.433], ['B', ' O ', 160.012, 89.975, 95.424], ['B', ' CB ', 160.695, 90.014, 92.278], ['B', ' CG ', 159.782, 89.359, 91.219], ['B', ' CD1', 160.636, 89.066, 89.99], ['B', ' CD2', 159.165, 88.07, 91.739], ['B', ' H ', 162.058, 91.535, 93.73], ['B', ' HA ', 159.348, 91.633, 92.774], ['B', ' HB ', 161.496, 90.533, 91.758], ['B', ' HB ', 161.136, 89.208, 92.849], ['B', ' HG ', 158.988, 90.052, 90.936], ['B', ' HD1', 160.017, 88.616, 89.212], ['B', ' HD1', 161.067, 89.993, 89.614], ['B', ' HD1', 161.441, 88.375, 90.26], ['B', ' HD2', 158.543, 87.63, 90.961], ['B', ' HD2', 159.952, 87.377, 91.999], ['B', ' HD2', 158.556, 88.255, 92.604]]
[['B', ' N ', 158.08, 90.238, 94.359], ['B', ' CA ', 157.274, 89.66, 95.428], ['B', ' C ', 157.142, 90.572, 96.672], ['B', ' O ', 156.408, 90.237, 97.598], ['B', ' CB ', 157.846, 88.293, 95.86], ['B', ' CG ', 156.775, 87.298, 96.368], ['B', ' OD1', 155.687, 87.302, 95.826], ['B', ' OD2', 157.063, 86.53, 97.267], ['B', ' H ', 157.622, 90.559, 93.495], ['B', ' HA ', 156.272, 89.492, 95.031], ['B', ' HB ', 158.379, 87.837, 95.028], ['B', ' HB ', 158.57, 88.441, 96.665]]
[['B', ' N ', 157.629, 91.833, 96.631], ['B', ' CA ', 157.304, 92.743, 97.742], ['B', ' C ', 155.919, 93.286, 97.457], ['B', ' O ', 155.285, 93.944, 98.273], ['B', ' CB ', 158.264, 93.931, 97.927], ['B', ' CG ', 159.699, 93.665, 98.38], ['B', ' CD1', 160.472, 95.01, 98.371], ['B', ' CD2', 159.72, 93.068, 99.776], ['B', ' H ', 158.256, 92.155, 95.88], ['B', ' HA ', 157.263, 92.173, 98.663], ['B', ' HB ', 158.348, 94.441, 96.965], ['B', ' HB ', 157.815, 94.625, 98.638], ['B', ' HG ', 160.177, 92.979, 97.685], ['B', ' HD1', 161.507, 94.838, 98.676], ['B', ' HD1', 160.453, 95.439, 97.368], ['B', ' HD1', 160.004, 95.705, 99.061], ['B', ' HD2', 160.75, 92.907, 100.073], ['B', ' HD2', 159.245, 93.752, 100.478], ['B', ' HD2', 159.199, 92.118, 99.787]]
[['B', ' N ', 155.408, 92.926, 96.289], ['B', ' CA ', 154.083, 93.26, 95.829], ['B', ' C ', 153.083, 92.471, 96.662], ['B', ' O ', 151.892, 92.772, 96.671], ['B', ' CB ', 153.947, 92.972, 94.346], ['B', ' H ', 156.006, 92.404, 95.669], ['B', ' HA ', 153.898, 94.315, 96.013], ['B', ' HB ', 152.944, 93.228, 94.012], ['B', ' HB ', 154.667, 93.554, 93.783], ['B', ' HB ', 154.124, 91.913, 94.159]]
[['B', ' N ', 153.58, 91.456, 97.388], ['B', ' CA ', 152.77, 90.636, 98.254], ['B', ' C ', 152.407, 91.386, 99.538], ['B', ' O ', 151.586, 90.904, 100.32], ['B', ' H ', 154.573, 91.222, 97.353], ['B', ' HA ', 151.864, 90.333, 97.73], ['B', ' HA ', 153.322, 89.728, 98.501]]
[['B', ' N ', 153.009, 92.556, 99.77], ['B', ' CA ', 152.67, 93.341, 100.936], ['B', ' C ', 151.622, 94.345, 100.542], ['B', ' O ', 151.906, 95.369, 99.916], ['B', ' CB ', 153.875, 94.1, 101.485], ['B', ' CG ', 154.872, 93.27, 102.152], ['B', ' CD1', 155.797, 92.581, 101.417], ['B', ' CD2', 154.883, 93.216, 103.532], ['B', ' CE1', 156.734, 91.811, 102.043], ['B', ' CE2', 155.824, 92.451, 104.172], ['B', ' CZ ', 156.748, 91.743, 103.427], ['B', ' OH ', 157.684, 90.964, 104.058], ['B', ' H ', 153.7, 92.928, 99.114], ['B', ' HA ', 152.258, 92.691, 101.707], ['B', ' HB ', 154.368, 94.626, 100.665], ['B', ' HB ', 153.53, 94.856, 102.194], ['B', ' HD1', 155.779, 92.64, 100.342], ['B', ' HD2', 154.144, 93.78, 104.11], ['B', ' HE1', 157.464, 91.256, 101.455], ['B', ' HE2', 155.841, 92.399, 105.261], ['B', ' HH ', 158.248, 90.542, 103.403]]
[['B', ' N ', 150.408, 94.081, 100.97], ['B', ' CA ', 149.279, 94.911, 100.639], ['B', ' C ', 148.812, 95.643, 101.883], ['B', ' O ', 147.945, 96.521, 101.839], ['B', ' CB ', 148.178, 94.042, 100.041], ['B', ' OG1', 147.789, 93.047, 100.997], ['B', ' CG2', 148.718, 93.36, 98.776], ['B', ' H ', 150.23, 93.227, 101.487], ['B', ' HA ', 149.583, 95.646, 99.897], ['B', ' HB ', 147.313, 94.652, 99.786], ['B', ' HG1', 146.979, 92.619, 100.684], ['B', ' HG2', 147.934, 92.738, 98.34], ['B', ' HG2', 149.014, 94.119, 98.06], ['B', ' HG2', 149.578, 92.737, 99.015]]
[['B', ' N ', 149.413, 95.282, 102.998], ['B', ' CA ', 149.12, 95.874, 104.276], ['B', ' C ', 150.402, 95.873, 105.084], ['B', ' O ', 151.107, 94.861, 105.123], ['B', ' CB ', 148.018, 95.093, 104.976], ['B', ' CG ', 147.541, 95.693, 106.274], ['B', ' CD ', 146.374, 94.941, 106.849], ['B', ' OE1', 146.597, 93.946, 107.493], ['B', ' OE2', 145.246, 95.354, 106.629], ['B', ' H ', 150.124, 94.574, 102.936], ['B', ' HA ', 148.786, 96.898, 104.136], ['B', ' HB ', 147.157, 95.005, 104.313], ['B', ' HB ', 148.371, 94.084, 105.186], ['B', ' HG ', 148.358, 95.679, 106.997], ['B', ' HG ', 147.256, 96.731, 106.105]]
[['B', ' N ', 150.733, 97.015, 105.674], ['B', ' CA ', 151.912, 97.153, 106.516], ['B', ' C ', 151.804, 98.468, 107.297], ['B', ' O ', 151.112, 99.382, 106.844], ['B', ' CB ', 153.207, 97.081, 105.703], ['B', ' H ', 150.09, 97.794, 105.619], ['B', ' HA ', 151.91, 96.318, 107.221], ['B', ' HB ', 154.049, 97.149, 106.388], ['B', ' HB ', 153.258, 96.133, 105.176], ['B', ' HB ', 153.267, 97.871, 105.007]]
[['B', ' N ', 152.466, 98.543, 108.459], ['B', ' CA ', 152.613, 99.707, 109.345], ['B', ' C ', 153.682, 99.406, 110.382], ['B', ' O ', 154.264, 98.318, 110.415], ['B', ' CB ', 151.267, 100.068, 110.04], ['B', ' SG ', 151.256, 101.546, 111.234], ['B', ' H ', 152.958, 97.68, 108.712], ['B', ' HA ', 152.939, 100.56, 108.744], ['B', ' HB ', 150.521, 100.261, 109.283], ['B', ' HB ', 150.913, 99.196, 110.603]]
[['B', ' N ', 153.92, 100.321, 111.291], ['B', ' CA ', 154.722, 99.907, 112.393], ['B', ' C ', 153.713, 98.951, 112.989], ['B', ' O ', 152.582, 98.918, 112.527], ['B', ' H ', 153.503, 101.241, 111.245], ['B', ' HA ', 155.633, 99.404, 112.067], ['B', ' HA ', 154.96, 100.733, 113.054]]
[['B', ' N ', 154.062, 98.188, 113.99], ['B', ' CA ', 153.2, 97.114, 114.527], ['B', ' C ', 153.522, 95.821, 113.76], ['B', ' O ', 153.481, 94.746, 114.347], ['B', ' CB ', 151.682, 97.337, 114.365], ['B', ' SG ', 151.045, 98.858, 115.075], ['B', ' H ', 154.981, 98.312, 114.388], ['B', ' HA ', 153.423, 96.972, 115.582], ['B', ' HB ', 151.339, 97.219, 113.333], ['B', ' HB ', 151.194, 96.533, 114.911], ['B', ' HG ', 151.523, 99.601, 114.05]]
[['B', ' N ', 154.041, 95.914, 112.526], ['B', ' CA ', 154.529, 94.718, 111.832], ['B', ' C ', 155.805, 94.33, 112.544], ['B', ' O ', 156.126, 93.161, 112.789], ['B', ' CB ', 154.841, 95.03, 110.387], ['B', ' CG ', 153.626, 95.331, 109.615], ['B', ' OD1', 152.552, 94.949, 109.998], ['B', ' OD2', 153.762, 96.019, 108.644], ['B', ' H ', 154.047, 96.809, 112.019], ['B', ' HA ', 153.794, 93.919, 111.902], ['B', ' HB ', 155.518, 95.888, 110.327], ['B', ' HB ', 155.34, 94.178, 109.926]]
[['B', ' N ', 156.439, 95.344, 113.073], ['B', ' CA ', 157.642, 95.191, 113.824], ['B', ' C ', 157.369, 94.637, 115.205], ['B', ' O ', 158.3, 94.488, 115.962], ['B', ' CB ', 158.327, 96.535, 113.957], ['B', ' CG ', 158.842, 97.155, 112.68], ['B', ' CD1', 159.283, 98.559, 112.977], ['B', ' CD2', 160.022, 96.339, 112.155], ['B', ' H ', 156.117, 96.275, 112.851], ['B', ' HA ', 158.278, 94.483, 113.312], ['B', ' HB ', 157.635, 97.231, 114.423], ['B', ' HB ', 159.179, 96.407, 114.624], ['B', ' HG ', 158.056, 97.189, 111.926], ['B', ' HD1', 159.658, 99.017, 112.063], ['B', ' HD1', 158.438, 99.139, 113.349], ['B', ' HD1', 160.064, 98.541, 113.73], ['B', ' HD2', 160.396, 96.806, 111.26], ['B', ' HD2', 160.816, 96.315, 112.905], ['B', ' HD2', 159.731, 95.328, 111.918]]
[['B', ' N ', 156.094, 94.478, 115.589], ['B', ' CA ', 155.704, 93.871, 116.847], ['B', ' C ', 154.968, 92.561, 116.569], ['B', ' O ', 154.395, 91.97, 117.493], ['B', ' CB ', 154.778, 94.782, 117.643], ['B', ' CG ', 155.362, 96.085, 118.055], ['B', ' CD ', 156.495, 95.924, 119.002], ['B', ' OE1', 156.504, 95.003, 119.822], ['B', ' NE2', 157.443, 96.828, 118.928], ['B', ' H ', 155.33, 94.672, 114.951], ['B', ' HA ', 156.591, 93.645, 117.431], ['B', ' HB ', 153.887, 94.984, 117.052], ['B', ' HB ', 154.455, 94.263, 118.544], ['B', ' HG ', 155.738, 96.593, 117.169], ['B', ' HG ', 154.593, 96.688, 118.535], ['B', ' HE2', 158.221, 96.803, 119.553], ['B', ' HE2', 157.378, 97.567, 118.255]]
[['B', ' N ', 154.914, 92.16, 115.296], ['B', ' CA ', 154.17, 90.987, 114.866], ['B', ' C ', 155.052, 89.957, 114.192], ['B', ' O ', 154.948, 88.757, 114.473], ['B', ' CB ', 153.06, 91.387, 113.879], ['B', ' OG1', 152.177, 92.325, 114.499], ['B', ' CG2', 152.264, 90.164, 113.462], ['B', ' H ', 155.418, 92.679, 114.589], ['B', ' HA ', 153.716, 90.525, 115.74], ['B', ' HB ', 153.502, 91.846, 113.001], ['B', ' HG1', 152.624, 93.203, 114.543], ['B', ' HG2', 151.48, 90.467, 112.772], ['B', ' HG2', 152.905, 89.435, 112.971], ['B', ' HG2', 151.816, 89.711, 114.346]]
[['B', ' N ', 155.881, 90.428, 113.265], ['B', ' CA ', 156.746, 89.593, 112.454], ['B', ' C ', 158.198, 89.694, 112.93], ['B', ' O ', 158.984, 88.763, 112.773], ['B', ' CB ', 156.602, 90.06, 111.024], ['B', ' CG ', 155.211, 89.866, 110.465], ['B', ' CD ', 155.089, 90.388, 109.041], ['B', ' CE ', 153.661, 90.241, 108.528], ['B', ' NZ ', 153.507, 90.763, 107.142], ['B', ' H ', 155.879, 91.422, 113.083], ['B', ' HA ', 156.427, 88.555, 112.542], ['B', ' HB ', 156.798, 91.116, 110.992], ['B', ' HB ', 157.327, 89.556, 110.389], ['B', ' HG ', 154.96, 88.807, 110.486], ['B', ' HG ', 154.5, 90.399, 111.088], ['B', ' HD ', 155.367, 91.446, 109.015], ['B', ' HD ', 155.766, 89.838, 108.387], ['B', ' HE ', 153.382, 89.188, 108.542], ['B', ' HE ', 152.99, 90.794, 109.188], ['B', ' HZ ', 152.548, 90.651, 106.839], ['B', ' HZ ', 153.75, 91.748, 107.114], ['B', ' HZ ', 154.118, 90.241, 106.527]]
[['B', ' N ', 158.544, 90.851, 113.47], ['B', ' CA ', 159.859, 91.177, 114.007], ['B', ' C ', 159.576, 91.607, 115.433], ['B', ' O ', 158.416, 91.845, 115.744], ['B', ' CB ', 160.595, 92.2, 113.12], ['B', ' CG1', 161.91, 92.636, 113.722], ['B', ' CG2', 160.887, 91.535, 111.778], ['B', ' H ', 157.827, 91.572, 113.499], ['B', ' HA ', 160.465, 90.272, 114.042], ['B', ' HB ', 159.98, 93.07, 112.976], ['B', ' HG1', 162.386, 93.324, 113.043], ['B', ' HG1', 161.739, 93.14, 114.652], ['B', ' HG1', 162.556, 91.773, 113.873], ['B', ' HG2', 161.4, 92.239, 111.124], ['B', ' HG2', 161.517, 90.658, 111.933], ['B', ' HG2', 159.966, 91.219, 111.311]]
[['B', ' N ', 160.567, 91.522, 116.336], ['B', ' CA ', 160.442, 91.766, 117.81], ['B', ' C ', 159.741, 90.576, 118.392], ['B', ' O ', 160.274, 89.834, 119.225], ['B', ' CB ', 159.667, 93.034, 118.213], ['B', ' CG1', 159.448, 93.064, 119.705], ['B', ' CG2', 160.436, 94.265, 117.827], ['B', ' H ', 161.457, 91.26, 115.945], ['B', ' HA ', 161.429, 91.822, 118.257], ['B', ' HB ', 158.716, 93.029, 117.757], ['B', ' HG1', 158.902, 93.968, 119.965], ['B', ' HG1', 158.87, 92.206, 120.031], ['B', ' HG1', 160.401, 93.058, 120.208], ['B', ' HG2', 159.85, 95.134, 118.113], ['B', ' HG2', 161.374, 94.283, 118.334], ['B', ' HG2', 160.594, 94.278, 116.752]]
[['B', ' N ', 158.562, 90.359, 117.896], ['B', ' CA ', 157.842, 89.229, 118.255], ['B', ' C ', 158.605, 88.195, 117.495], ['B', ' O ', 159.619, 88.501, 116.849], ['B', ' CB ', 156.442, 89.389, 117.763], ['B', ' CG ', 155.486, 88.594, 118.424], ['B', ' OD1', 155.776, 87.449, 118.819], ['B', ' ND2', 154.317, 89.153, 118.568], ['B', ' H ', 158.173, 91.021, 117.242], ['B', ' HA ', 157.895, 89.035, 119.326], ['B', ' HB ', 156.18, 90.416, 117.892], ['B', ' HB ', 156.41, 89.178, 116.698], ['B', ' HD2', 153.571, 88.669, 119.022], ['B', ' HD2', 154.178, 90.102, 118.2]]
[['B', ' N ', 158.209, 86.975, 117.617], ['B', ' CA ', 158.906, 85.891, 116.963], ['B', ' C ', 160.369, 85.75, 117.449], ['B', ' O ', 161.069, 84.887, 116.926], ['B', ' CB ', 158.969, 86.103, 115.439], ['B', ' CG ', 157.68, 86.43, 114.749], ['B', ' CD ', 156.655, 85.405, 114.858], ['B', ' OE1', 156.933, 84.205, 114.98], ['B', ' NE2', 155.418, 85.856, 114.798], ['B', ' H ', 157.369, 86.801, 118.168], ['B', ' HA ', 158.381, 84.96, 117.181], ['B', ' HB ', 159.694, 86.864, 115.171], ['B', ' HB ', 159.314, 85.185, 114.98], ['B', ' HG ', 157.273, 87.353, 115.151], ['B', ' HG ', 157.899, 86.574, 113.7], ['B', ' HE2', 154.643, 85.228, 114.861], ['B', ' HE2', 155.253, 86.868, 114.681]]
[['B', ' N ', 160.841, 86.563, 118.43], ['B', ' CA ', 162.195, 86.458, 118.957], ['B', ' C ', 163.261, 87.031, 118.024], ['B', ' O ', 164.425, 86.656, 118.127], ['B', ' H ', 160.264, 87.311, 118.827], ['B', ' HA ', 162.238, 86.981, 119.912], ['B', ' HA ', 162.42, 85.414, 119.163]]
[['B', ' N ', 162.885, 87.907, 117.099], ['B', ' CA ', 163.888, 88.4, 116.159], ['B', ' C ', 164.561, 89.774, 116.331], ['B', ' O ', 165.706, 89.938, 115.918], ['B', ' CB ', 163.261, 88.348, 114.773], ['B', ' CG ', 162.86, 86.978, 114.238], ['B', ' CD1', 162.188, 87.164, 112.898], ['B', ' CD2', 164.079, 86.104, 114.074], ['B', ' H ', 161.898, 88.184, 117.032], ['B', ' HA ', 164.708, 87.695, 116.189], ['B', ' HB ', 162.366, 88.961, 114.787], ['B', ' HB ', 163.925, 88.749, 114.081], ['B', ' HG ', 162.153, 86.5, 114.914], ['B', ' HD1', 161.894, 86.189, 112.505], ['B', ' HD1', 161.301, 87.786, 113.015], ['B', ' HD1', 162.873, 87.642, 112.2], ['B', ' HD2', 163.786, 85.156, 113.658], ['B', ' HD2', 164.77, 86.588, 113.399], ['B', ' HD2', 164.57, 85.925, 115.023]]
[['B', ' N ', 163.919, 90.781, 116.894], ['B', ' CA ', 164.565, 92.106, 116.838], ['B', ' C ', 165.786, 92.158, 117.722], ['B', ' O ', 165.808, 91.561, 118.801], ['B', ' CB ', 163.661, 93.257, 117.209], ['B', ' SG ', 164.395, 94.897, 116.951], ['B', ' H ', 163.02, 90.633, 117.327], ['B', ' HA ', 164.885, 92.282, 115.811], ['B', ' HB ', 162.775, 93.206, 116.629], ['B', ' HB ', 163.397, 93.176, 118.261], ['B', ' HG ', 163.235, 95.54, 116.864]]
[['B', ' N ', 166.823, 92.821, 117.226], ['B', ' CA ', 168.071, 92.956, 117.939], ['B', ' C ', 168.447, 94.405, 118.307], ['B', ' O ', 169.606, 94.701, 118.563], ['B', ' CB ', 169.172, 92.194, 117.181], ['B', ' CG1', 170.454, 91.951, 118.085], ['B', ' CG2', 169.531, 92.938, 115.899], ['B', ' CD1', 170.206, 91.143, 119.388], ['B', ' H ', 166.712, 93.292, 116.341], ['B', ' HA ', 167.95, 92.419, 118.853], ['B', ' HB ', 168.789, 91.207, 116.909], ['B', ' HG1', 171.159, 91.378, 117.493], ['B', ' HG1', 170.926, 92.875, 118.338], ['B', ' HG2', 170.279, 92.368, 115.349], ['B', ' HG2', 168.648, 93.049, 115.281], ['B', ' HG2', 169.936, 93.927, 116.131], ['B', ' HD1', 171.143, 91.009, 119.911], ['B', ' HD1', 169.532, 91.654, 120.048], ['B', ' HD1', 169.804, 90.204, 119.149]]
[['B', ' N ', 167.512, 95.348, 118.262], ['B', ' CA ', 167.894, 96.708, 118.655], ['B', ' C ', 168.79, 97.343, 117.598], ['B', ' O ', 169.718, 98.097, 117.921], ['B', ' H ', 166.556, 95.112, 118.034], ['B', ' HA ', 167.008, 97.31, 118.819], ['B', ' HA ', 168.414, 96.674, 119.609]]
[['B', ' N ', 168.547, 96.974, 116.348], ['B', ' CA ', 169.365, 97.42, 115.248], ['B', ' C ', 169.324, 98.886, 114.869], ['B', ' O ', 170.3, 99.4, 114.349], ['B', ' CB ', 168.925, 96.66, 114.019], ['B', ' SG ', 167.246, 97.067, 113.578], ['B', ' H ', 167.784, 96.342, 116.163], ['B', ' HA ', 170.389, 97.14, 115.484], ['B', ' HB ', 169.58, 96.892, 113.175], ['B', ' HB ', 168.987, 95.589, 114.201], ['B', ' HG ', 167.539, 98.263, 112.986]]
[['B', ' N ', 168.213, 99.564, 115.061], ['B', ' CA ', 168.11, 100.981, 114.714], ['B', ' C ', 167.661, 101.267, 113.275], ['B', ' O ', 167.209, 102.374, 112.986], ['B', ' H ', 167.405, 99.115, 115.477], ['B', ' HA ', 167.434, 101.488, 115.385], ['B', ' HA ', 169.07, 101.451, 114.896]]
[['B', ' N ', 167.734, 100.285, 112.368], ['B', ' CA ', 167.339, 100.565, 110.967], ['B', ' C ', 165.827, 100.804, 110.87], ['B', ' O ', 165.355, 101.671, 110.112], ['B', ' CB ', 167.679, 99.408, 110.094], ['B', ' OG1', 166.962, 98.335, 110.56], ['B', ' CG2', 169.095, 99.098, 110.15], ['B', ' H ', 168.061, 99.361, 112.622], ['B', ' HA ', 167.868, 101.454, 110.62], ['B', ' HB ', 167.399, 99.622, 109.063], ['B', ' HG1', 166.246, 98.19, 109.906], ['B', ' HG2', 169.257, 98.247, 109.514], ['B', ' HG2', 169.66, 99.932, 109.778], ['B', ' HG2', 169.404, 98.87, 111.163]]
[['B', ' N ', 165.056, 100.071, 111.694], ['B', ' CA ', 163.659, 100.259, 111.949], ['B', ' C ', 163.602, 101.405, 112.96], ['B', ' O ', 164.03, 101.271, 114.105], ['B', ' CB ', 162.962, 98.946, 112.37], ['B', ' SG ', 163.783, 97.877, 113.688], ['B', ' H ', 165.537, 99.336, 112.214], ['B', ' HA ', 163.169, 100.591, 111.023], ['B', ' HB ', 161.974, 99.182, 112.734], ['B', ' HB ', 162.825, 98.362, 111.502]]
[['B', ' N ', 163.071, 102.51, 112.472], ['B', ' CA ', 163.117, 103.862, 113.024], ['B', ' C ', 164.007, 104.73, 112.113], ['B', ' O ', 163.512, 105.747, 111.621], ['B', ' CB ', 163.628, 103.906, 114.459], ['B', ' H ', 162.685, 102.413, 111.551], ['B', ' HA ', 162.13, 104.272, 112.993], ['B', ' HB ', 163.617, 104.941, 114.8], ['B', ' HB ', 162.981, 103.315, 115.096], ['B', ' HB ', 164.651, 103.528, 114.518]]
[['B', ' N ', 165.241, 104.326, 111.751], ['B', ' CA ', 166.04, 105.182, 110.854], ['B', ' C ', 165.317, 105.446, 109.547], ['B', ' O ', 165.39, 106.539, 108.987], ['B', ' CB ', 167.358, 104.535, 110.451], ['B', ' CG ', 168.32, 105.485, 109.709], ['B', ' SD ', 169.894, 104.725, 109.379], ['B', ' CE ', 170.629, 105.668, 108.072], ['B', ' H ', 165.691, 103.486, 112.131], ['B', ' HA ', 166.234, 106.128, 111.349], ['B', ' HB ', 167.837, 104.053, 111.26], ['B', ' HB ', 167.126, 103.734, 109.751], ['B', ' HG ', 167.888, 105.846, 108.78], ['B', ' HG ', 168.503, 106.334, 110.353], ['B', ' HE ', 171.614, 105.262, 107.835], ['B', ' HE ', 169.998, 105.602, 107.192], ['B', ' HE ', 170.732, 106.706, 108.378]]
[['B', ' N ', 164.624, 104.428, 109.061], ['B', ' CA ', 163.901, 104.448, 107.8], ['B', ' C ', 162.417, 104.787, 107.897], ['B', ' O ', 161.679, 104.571, 106.936], ['B', ' CB ', 164.013, 103.098, 107.166], ['B', ' H ', 164.676, 103.543, 109.577], ['B', ' HA ', 164.378, 105.193, 107.163], ['B', ' HB ', 163.535, 103.129, 106.205], ['B', ' HB ', 165.036, 102.842, 107.047], ['B', ' HB ', 163.531, 102.359, 107.805]]
[['B', ' N ', 161.928, 105.237, 109.041], ['B', ' CA ', 160.486, 105.457, 109.14], ['B', ' C ', 159.892, 106.484, 108.17], ['B', ' O ', 158.747, 106.326, 107.757], ['B', ' CB ', 160.07, 105.794, 110.544], ['B', ' SG ', 158.278, 105.878, 110.714], ['B', ' H ', 162.553, 105.421, 109.836], ['B', ' HA ', 160.01, 104.505, 108.912], ['B', ' HB ', 160.442, 105.026, 111.209], ['B', ' HB ', 160.508, 106.73, 110.851], ['B', ' HG ', 157.999, 105.072, 109.686]]
[['B', ' N ', 160.613, 107.581, 107.903], ['B', ' CA ', 160.221, 108.692, 106.996], ['B', ' C ', 159.052, 109.583, 107.424], ['B', ' O ', 158.67, 110.489, 106.692], ['B', ' CB ', 159.865, 108.121, 105.627], ['B', ' CG ', 160.976, 107.387, 104.941], ['B', ' CD ', 160.427, 106.522, 103.884], ['B', ' OE1', 160.158, 106.805, 102.699], ['B', ' NE2', 160.202, 105.351, 104.349], ['B', ' H ', 161.54, 107.632, 108.315], ['B', ' HA ', 161.095, 109.335, 106.873], ['B', ' HB ', 159.014, 107.481, 105.696], ['B', ' HB ', 159.588, 108.941, 104.969], ['B', ' HG ', 161.65, 108.113, 104.482], ['B', ' HG ', 161.523, 106.77, 105.644], ['B', ' HE2', 159.801, 104.666, 103.766], ['B', ' HE2', 160.473, 105.121, 105.319]]
[['B', ' N ', 158.52, 109.372, 108.613], ['B', ' CA ', 157.547, 110.266, 109.22], ['B', ' C ', 158.11, 110.498, 110.596], ['B', ' O ', 157.708, 111.384, 111.354], ['B', ' CB ', 156.15, 109.674, 109.358], ['B', ' OG1', 156.18, 108.594, 110.284], ['B', ' CG2', 155.666, 109.173, 108.049], ['B', ' H ', 158.828, 108.583, 109.158], ['B', ' HA ', 157.507, 111.214, 108.68], ['B', ' HB ', 155.465, 110.442, 109.727], ['B', ' HG1', 155.228, 108.393, 110.506], ['B', ' HG2', 154.671, 108.766, 108.188], ['B', ' HG2', 155.63, 109.992, 107.335], ['B', ' HG2', 156.33, 108.394, 107.675]]
[['B', ' N ', 159.074, 109.64, 110.899], ['B', ' CA ', 159.712, 109.495, 112.187], ['B', ' C ', 158.735, 109.116, 113.292], ['B', ' O ', 158.917, 109.496, 114.446], ['B', ' CB ', 160.495, 110.74, 112.539], ['B', ' CG ', 161.611, 111.019, 111.555], ['B', ' CD ', 162.421, 112.197, 111.929], ['B', ' NE ', 163.541, 112.399, 110.986], ['B', ' CZ ', 164.442, 113.412, 111.033], ['B', ' NH1', 164.37, 114.339, 111.959], ['B', ' NH2', 165.412, 113.471, 110.138], ['B', ' H ', 159.358, 109.025, 110.153], ['B', ' HA ', 160.438, 108.687, 112.111], ['B', ' HB ', 159.846, 111.609, 112.588], ['B', ' HB ', 160.948, 110.614, 113.523], ['B', ' HG ', 162.266, 110.157, 111.517], ['B', ' HG ', 161.197, 111.178, 110.571], ['B', ' HD ', 161.792, 113.086, 111.918], ['B', ' HD ', 162.826, 112.054, 112.927], ['B', ' HE ', 163.655, 111.714, 110.251], ['B', ' HH1', 163.641, 114.322, 112.654], ['B', ' HH1', 165.051, 115.091, 111.975], ['B', ' HH2', 165.485, 112.764, 109.423], ['B', ' HH2', 166.093, 114.224, 110.182]]
[['B', ' N ', 157.731, 108.3, 112.941], ['B', ' CA ', 156.797, 107.753, 113.906], ['B', ' C ', 157.508, 106.81, 114.858], ['B', ' O ', 157.133, 106.683, 116.021], ['B', ' CB ', 155.682, 107.005, 113.212], ['B', ' H ', 157.581, 108.075, 111.958], ['B', ' HA ', 156.379, 108.579, 114.476], ['B', ' HB ', 154.978, 106.635, 113.948], ['B', ' HB ', 155.189, 107.67, 112.553], ['B', ' HB ', 156.083, 106.176, 112.652]]
[['B', ' N ', 158.506, 106.099, 114.362], ['B', ' CA ', 159.231, 105.156, 115.183], ['B', ' C ', 160.456, 105.742, 115.83], ['B', ' O ', 161.241, 106.459, 115.206], ['B', ' CB ', 159.672, 103.988, 114.341], ['B', ' CG ', 158.652, 103.092, 113.789], ['B', ' CD1', 159.304, 102.198, 112.835], ['B', ' CD2', 158.066, 102.256, 114.886], ['B', ' H ', 158.769, 106.209, 113.394], ['B', ' HA ', 158.573, 104.822, 115.975], ['B', ' HB ', 160.127, 104.417, 113.496], ['B', ' HB ', 160.407, 103.402, 114.895], ['B', ' HG ', 157.874, 103.664, 113.282], ['B', ' HD1', 158.546, 101.529, 112.441], ['B', ' HD1', 159.742, 102.78, 112.029], ['B', ' HD1', 160.083, 101.621, 113.335], ['B', ' HD2', 157.334, 101.565, 114.474], ['B', ' HD2', 158.853, 101.7, 115.361], ['B', ' HD2', 157.598, 102.868, 115.605]]
[['B', ' N ', 160.651, 105.345, 117.07], ['B', ' CA ', 161.784, 105.737, 117.889], ['B', ' C ', 162.114, 104.537, 118.759], ['B', ' O ', 161.216, 104.014, 119.412], ['B', ' CB ', 161.418, 106.965, 118.727], ['B', ' CG ', 162.594, 107.604, 119.439], ['B', ' OD1', 163.658, 107.06, 119.365], ['B', ' OD2', 162.417, 108.643, 120.045], ['B', ' H ', 159.908, 104.774, 117.491], ['B', ' HA ', 162.641, 105.963, 117.254], ['B', ' HB ', 160.953, 107.711, 118.078], ['B', ' HB ', 160.675, 106.676, 119.473]]
[['B', ' N ', 163.303, 103.961, 118.663], ['B', ' CA ', 163.506, 102.77, 119.469], ['B', ' C ', 163.787, 103.14, 120.904], ['B', ' O ', 164.637, 103.982, 121.189], ['B', ' CB ', 164.634, 101.902, 118.932], ['B', ' CG ', 164.379, 101.365, 117.555], ['B', ' SD ', 165.617, 100.283, 116.961], ['B', ' CE ', 165.073, 98.687, 117.376], ['B', ' H ', 164.043, 104.387, 118.118], ['B', ' HA ', 162.594, 102.204, 119.474], ['B', ' HB ', 165.54, 102.492, 118.886], ['B', ' HB ', 164.808, 101.068, 119.613], ['B', ' HG ', 163.474, 100.833, 117.535], ['B', ' HG ', 164.294, 102.191, 116.857], ['B', ' HE ', 165.782, 97.958, 117.017], ['B', ' HE ', 164.951, 98.6, 118.448], ['B', ' HE ', 164.141, 98.524, 116.877]]
[['B', ' N ', 163.096, 102.473, 121.815], ['B', ' CA ', 163.255, 102.703, 123.229], ['B', ' C ', 163.608, 101.384, 123.86], ['B', ' O ', 163.04, 100.349, 123.536], ['B', ' CB ', 161.957, 103.293, 123.819], ['B', ' OG1', 160.87, 102.369, 123.622], ['B', ' CG2', 161.629, 104.589, 123.075], ['B', ' H ', 162.42, 101.775, 121.506], ['B', ' HA ', 164.073, 103.402, 123.395], ['B', ' HB ', 162.084, 103.488, 124.883], ['B', ' HG1', 160.006, 102.796, 123.855], ['B', ' HG2', 160.709, 105.012, 123.48], ['B', ' HG2', 162.444, 105.3, 123.2], ['B', ' HG2', 161.487, 104.388, 122.017]]
[['B', ' N ', 164.607, 101.394, 124.72], ['B', ' CA ', 165.053, 100.183, 125.39], ['B', ' C ', 165.373, 99.074, 124.385], ['B', ' O ', 165.128, 97.899, 124.65], ['B', ' CB ', 164.006, 99.718, 126.369], ['B', ' CG ', 163.776, 100.71, 127.424], ['B', ' OD1', 164.72, 101.226, 128.037], ['B', ' ND2', 162.532, 101.018, 127.648], ['B', ' H ', 165.044, 102.276, 124.937], ['B', ' HA ', 165.973, 100.403, 125.933], ['B', ' HB ', 163.066, 99.51, 125.862], ['B', ' HB ', 164.332, 98.788, 126.833], ['B', ' HD2', 162.295, 101.691, 128.348], ['B', ' HD2', 161.817, 100.583, 127.1]]
[['B', ' N ', 165.925, 99.44, 123.23], ['B', ' CA ', 166.284, 98.457, 122.223], ['B', ' C ', 165.109, 97.941, 121.375], ['B', ' O ', 165.264, 96.93, 120.687], ['B', ' H ', 166.134, 100.414, 123.063], ['B', ' HA ', 167.034, 98.893, 121.562], ['B', ' HA ', 166.763, 97.611, 122.715]]
[['B', ' N ', 163.939, 98.577, 121.424], ['B', ' CA ', 162.798, 98.099, 120.65], ['B', ' C ', 162.066, 99.246, 119.997], ['B', ' O ', 161.876, 100.282, 120.617], ['B', ' CB ', 161.766, 97.45, 121.545], ['B', ' CG ', 162.177, 96.274, 122.278], ['B', ' CD ', 162.428, 95.129, 121.431], ['B', ' NE ', 162.707, 94.023, 122.251], ['B', ' CZ ', 163.894, 93.769, 122.798], ['B', ' NH1', 164.933, 94.562, 122.592], ['B', ' NH2', 164.02, 92.717, 123.581], ['B', ' H ', 163.812, 99.365, 122.063], ['B', ' HA ', 163.162, 97.406, 119.9], ['B', ' HB ', 161.472, 98.183, 122.299], ['B', ' HB ', 160.87, 97.2, 120.988], ['B', ' HG ', 163.065, 96.51, 122.856], ['B', ' HG ', 161.379, 96.0, 122.965], ['B', ' HD ', 161.542, 94.921, 120.852], ['B', ' HD ', 163.267, 95.289, 120.764], ['B', ' HE ', 161.948, 93.384, 122.452], ['B', ' HH1', 164.881, 95.383, 121.974], ['B', ' HH1', 165.829, 94.332, 123.046], ['B', ' HH2', 163.227, 92.114, 123.753], ['B', ' HH2', 164.916, 92.526, 124.015]]
[['B', ' N ', 161.545, 99.1, 118.793], ['B', ' CA ', 160.825, 100.159, 118.157], ['B', ' C ', 159.562, 100.444, 118.93], ['B', ' O ', 158.812, 99.517, 119.235], ['B', ' CB ', 160.547, 99.564, 116.78], ['B', ' CG ', 160.573, 98.066, 116.981], ['B', ' CD ', 161.522, 97.816, 118.108], ['B', ' HA ', 161.42, 101.066, 118.069], ['B', ' HB ', 159.571, 99.894, 116.429], ['B', ' HB ', 161.298, 99.924, 116.05], ['B', ' HG ', 159.559, 97.688, 117.186], ['B', ' HG ', 160.906, 97.576, 116.049], ['B', ' HD ', 161.085, 97.051, 118.742], ['B', ' HD ', 162.48, 97.518, 117.734]]
[['B', ' N ', 159.284, 101.716, 119.155], ['B', ' CA ', 158.069, 102.169, 119.791], ['B', ' C ', 157.39, 103.034, 118.758], ['B', ' O ', 158.039, 103.887, 118.144], ['B', ' CB ', 158.374, 102.926, 121.082], ['B', ' CG ', 157.156, 103.418, 121.832], ['B', ' CD ', 157.485, 104.084, 123.149], ['B', ' OE1', 158.4, 103.655, 123.835], ['B', ' OE2', 156.813, 105.032, 123.472], ['B', ' H ', 159.983, 102.431, 118.947], ['B', ' HA ', 157.429, 101.315, 120.018], ['B', ' HB ', 158.942, 102.278, 121.749], ['B', ' HB ', 159.002, 103.789, 120.858], ['B', ' HG ', 156.624, 104.136, 121.206], ['B', ' HG ', 156.493, 102.576, 122.013]]
[['B', ' N ', 156.114, 102.784, 118.497], ['B', ' CA ', 155.451, 103.527, 117.444], ['B', ' C ', 154.524, 104.638, 117.872], ['B', ' O ', 153.486, 104.414, 118.507], ['B', ' CB ', 154.617, 102.551, 116.601], ['B', ' CG ', 153.824, 103.159, 115.43], ['B', ' CD1', 154.798, 103.673, 114.374], ['B', ' CD2', 152.86, 102.133, 114.879], ['B', ' H ', 155.613, 102.081, 119.023], ['B', ' HA ', 156.217, 103.99, 116.836], ['B', ' HB ', 155.28, 101.793, 116.196], ['B', ' HB ', 153.901, 102.058, 117.259], ['B', ' HG ', 153.261, 103.995, 115.775], ['B', ' HD1', 154.265, 104.114, 113.563], ['B', ' HD1', 155.456, 104.419, 114.794], ['B', ' HD1', 155.385, 102.858, 113.998], ['B', ' HD2', 152.289, 102.56, 114.058], ['B', ' HD2', 153.391, 101.283, 114.534], ['B', ' HD2', 152.175, 101.824, 115.667]]
[['B', ' N ', 154.804, 105.833, 117.391], ['B', ' CA ', 153.924, 106.938, 117.631], ['B', ' C ', 152.894, 106.804, 116.548], ['B', ' O ', 153.055, 107.356, 115.462], ['B', ' CB ', 154.659, 108.256, 117.518], ['B', ' CG ', 153.821, 109.424, 117.865], ['B', ' OD1', 152.598, 109.306, 117.939], ['B', ' ND2', 154.44, 110.556, 118.082], ['B', ' H ', 155.68, 105.998, 116.891], ['B', ' HA ', 153.44, 106.838, 118.603], ['B', ' HB ', 155.537, 108.24, 118.165], ['B', ' HB ', 155.016, 108.38, 116.499], ['B', ' HD2', 153.919, 111.379, 118.327], ['B', ' HD2', 155.439, 110.6, 118.011]]
[['B', ' N ', 151.825, 106.089, 116.854], ['B', ' CA ', 150.843, 105.704, 115.855], ['B', ' C ', 150.166, 106.875, 115.186], ['B', ' O ', 149.799, 106.774, 114.018], ['B', ' CB ', 149.812, 104.806, 116.483], ['B', ' OG ', 149.049, 105.507, 117.415], ['B', ' H ', 151.787, 105.685, 117.792], ['B', ' HA ', 151.356, 105.135, 115.081], ['B', ' HB ', 149.166, 104.393, 115.711], ['B', ' HB ', 150.317, 103.971, 116.973], ['B', ' HG ', 148.438, 104.868, 117.795]]
[['B', ' N ', 150.152, 108.031, 115.836], ['B', ' CA ', 149.566, 109.245, 115.278], ['B', ' C ', 150.322, 109.686, 114.025], ['B', ' O ', 149.819, 110.473, 113.225], ['B', ' CB ', 149.606, 110.37, 116.309], ['B', ' CG ', 148.625, 110.182, 117.473], ['B', ' OD1', 147.708, 109.402, 117.366], ['B', ' OD2', 148.831, 110.809, 118.481], ['B', ' H ', 150.463, 108.044, 116.801], ['B', ' HA ', 148.53, 109.042, 115.005], ['B', ' HB ', 150.612, 110.45, 116.711], ['B', ' HB ', 149.385, 111.315, 115.817]]
[['B', ' N ', 151.56, 109.231, 113.882], ['B', ' CA ', 152.381, 109.564, 112.733], ['B', ' C ', 152.657, 108.385, 111.767], ['B', ' O ', 153.539, 108.524, 110.905], ['B', ' CB ', 153.704, 110.135, 113.191], ['B', ' CG ', 153.602, 111.418, 113.938], ['B', ' CD ', 154.934, 111.961, 114.267], ['B', ' NE ', 155.636, 112.348, 113.065], ['B', ' CZ ', 155.461, 113.495, 112.398], ['B', ' NH1', 154.606, 114.413, 112.803], ['B', ' NH2', 156.172, 113.682, 111.317], ['B', ' H ', 151.935, 108.568, 114.564], ['B', ' HA ', 151.862, 110.337, 112.166], ['B', ' HB ', 154.167, 109.429, 113.869], ['B', ' HB ', 154.372, 110.272, 112.341], ['B', ' HG ', 153.055, 112.137, 113.335], ['B', ' HG ', 153.063, 111.251, 114.873], ['B', ' HD ', 154.841, 112.828, 114.918], ['B', ' HD ', 155.524, 111.191, 114.77], ['B', ' HE ', 156.342, 111.7, 112.675], ['B', ' HH1', 154.072, 114.299, 113.673], ['B', ' HH1', 154.504, 115.267, 112.28], ['B', ' HH2', 156.828, 112.94, 111.054], ['B', ' HH2', 156.093, 114.536, 110.776]]
[['B', ' N ', 151.954, 107.216, 111.913], ['B', ' CA ', 152.128, 106.065, 111.03], ['B', ' C ', 151.169, 106.306, 109.893], ['B', ' O ', 150.036, 106.754, 110.063], ['B', ' CB ', 151.854, 104.676, 111.652], ['B', ' SG ', 152.309, 103.214, 110.482], ['B', ' H ', 151.231, 107.161, 112.643], ['B', ' HA ', 153.151, 106.05, 110.646], ['B', ' HB ', 152.412, 104.574, 112.562], ['B', ' HB ', 150.791, 104.577, 111.937]]
[['B', ' N ', 151.653, 106.042, 108.728], ['B', ' CA ', 150.912, 106.226, 107.52], ['B', ' C ', 150.729, 104.942, 106.777], ['B', ' O ', 150.398, 104.948, 105.6], ['B', ' CB ', 151.639, 107.25, 106.689], ['B', ' CG1', 153.031, 106.739, 106.501], ['B', ' CG2', 151.605, 108.575, 107.381], ['B', ' CD1', 153.81, 107.413, 105.533], ['B', ' H ', 152.587, 105.664, 108.678], ['B', ' HA ', 149.931, 106.621, 107.773], ['B', ' HB ', 151.174, 107.336, 105.708], ['B', ' HG1', 153.554, 106.851, 107.442], ['B', ' HG1', 153.003, 105.703, 106.244], ['B', ' HG2', 152.125, 109.305, 106.801], ['B', ' HG2', 150.577, 108.888, 107.499], ['B', ' HG2', 152.071, 108.506, 108.359], ['B', ' HD1', 154.767, 106.979, 105.541], ['B', ' HD1', 153.355, 107.274, 104.579], ['B', ' HD1', 153.905, 108.461, 105.76]]
[['B', ' N ', 150.922, 103.83, 107.454], ['B', ' CA ', 150.805, 102.537, 106.794], ['B', ' C ', 151.703, 102.423, 105.549], ['B', ' O ', 151.256, 102.054, 104.474], ['B', ' CB ', 149.339, 102.223, 106.487], ['B', ' CG ', 148.466, 102.094, 107.751], ['B', ' CD ', 147.024, 101.75, 107.41], ['B', ' CE ', 146.124, 101.609, 108.64], ['B', ' NZ ', 146.541, 100.496, 109.52], ['B', ' H ', 151.157, 103.88, 108.438], ['B', ' HA ', 151.142, 101.78, 107.499], ['B', ' HB ', 148.906, 102.985, 105.839], ['B', ' HB ', 149.287, 101.277, 105.944], ['B', ' HG ', 148.862, 101.297, 108.34], ['B', ' HG ', 148.523, 102.993, 108.335], ['B', ' HD ', 146.626, 102.568, 106.825], ['B', ' HD ', 146.985, 100.84, 106.811], ['B', ' HE ', 146.149, 102.527, 109.206], ['B', ' HE ', 145.102, 101.43, 108.306], ['B', ' HZ ', 145.921, 100.439, 110.318], ['B', ' HZ ', 146.516, 99.622, 109.011], ['B', ' HZ ', 147.477, 100.689, 109.829]]
[['B', ' N ', 152.974, 102.82, 105.702], ['B', ' CA ', 154.047, 102.759, 104.737], ['B', ' C ', 154.888, 101.624, 105.296], ['B', ' O ', 155.335, 101.67, 106.447], ['B', ' CB ', 154.765, 104.124, 104.675], ['B', ' SG ', 156.138, 104.308, 103.587], ['B', ' H ', 153.234, 103.156, 106.622], ['B', ' HA ', 153.664, 102.496, 103.748], ['B', ' HB ', 154.037, 104.864, 104.346], ['B', ' HB ', 155.102, 104.427, 105.676]]
[['B', ' N ', 155.134, 100.611, 104.486], ['B', ' CA ', 155.808, 99.409, 104.96], ['B', ' C ', 157.322, 99.49, 105.026], ['B', ' O ', 157.977, 98.501, 105.365], ['B', ' H ', 154.762, 100.632, 103.543], ['B', ' HA ', 155.424, 99.169, 105.953], ['B', ' HA ', 155.525, 98.577, 104.317]]
[['B', ' N ', 157.895, 100.646, 104.75], ['B', ' CA ', 159.338, 100.748, 104.77], ['B', ' C ', 159.928, 100.422, 106.098], ['B', ' O ', 160.954, 99.745, 106.19], ['B', ' CB ', 159.844, 102.104, 104.35], ['B', ' CG1', 159.558, 102.346, 102.898], ['B', ' CG2', 161.356, 102.229, 104.666], ['B', ' CD1', 160.216, 101.393, 101.943], ['B', ' H ', 157.319, 101.44, 104.497], ['B', ' HA ', 159.701, 100.02, 104.089], ['B', ' HB ', 159.297, 102.868, 104.902], ['B', ' HG1', 158.483, 102.331, 102.726], ['B', ' HG1', 159.925, 103.305, 102.668], ['B', ' HG2', 161.728, 103.203, 104.374], ['B', ' HG2', 161.536, 102.116, 105.725], ['B', ' HG2', 161.918, 101.481, 104.14], ['B', ' HD1', 160.005, 101.677, 100.968], ['B', ' HD1', 161.27, 101.425, 102.075], ['B', ' HD1', 159.879, 100.386, 102.066]]
[['B', ' N ', 159.281, 100.844, 107.146], ['B', ' CA ', 159.806, 100.571, 108.451], ['B', ' C ', 159.975, 99.071, 108.716], ['B', ' O ', 160.665, 98.694, 109.657], ['B', ' CB ', 158.913, 101.23, 109.479], ['B', ' SG ', 157.203, 100.699, 109.462], ['B', ' H ', 158.427, 101.379, 107.025], ['B', ' HA ', 160.789, 101.04, 108.519], ['B', ' HB ', 159.317, 100.988, 110.432], ['B', ' HB ', 158.939, 102.31, 109.363], ['B', ' HG ', 157.457, 99.391, 109.456]]
[['B', ' N ', 159.329, 98.219, 107.917], ['B', ' CA ', 159.456, 96.788, 108.041], ['B', ' C ', 160.51, 96.258, 107.07], ['B', ' O ', 161.361, 95.444, 107.452], ['B', ' CB ', 158.135, 96.1, 107.767], ['B', ' CG ', 158.244, 94.658, 107.923], ['B', ' CD1', 158.264, 94.132, 109.176], ['B', ' CD2', 158.354, 93.847, 106.82], ['B', ' CE1', 158.386, 92.805, 109.339], ['B', ' CE2', 158.481, 92.508, 106.989], ['B', ' CZ ', 158.494, 91.982, 108.238], ['B', ' OH ', 158.626, 90.629, 108.404], ['B', ' H ', 158.772, 98.577, 107.142], ['B', ' HA ', 159.779, 96.551, 109.05], ['B', ' HB ', 157.372, 96.47, 108.454], ['B', ' HB ', 157.802, 96.316, 106.753], ['B', ' HD1', 158.182, 94.783, 110.048], ['B', ' HD2', 158.346, 94.274, 105.817], ['B', ' HE1', 158.403, 92.404, 110.335], ['B', ' HE2', 158.574, 91.86, 106.129], ['B', ' HH ', 158.865, 90.221, 107.564]]
[['B', ' N ', 160.487, 96.748, 105.811], ['B', ' CA ', 161.388, 96.226, 104.77], ['B', ' C ', 162.805, 96.607, 105.108], ['B', ' O ', 163.724, 96.082, 104.512], ['B', ' CB ', 161.094, 96.734, 103.334], ['B', ' CG1', 161.661, 98.118, 103.097], ['B', ' CG2', 161.651, 95.745, 102.284], ['B', ' H ', 159.763, 97.434, 105.572], ['B', ' HA ', 161.317, 95.138, 104.764], ['B', ' HB ', 160.009, 96.817, 103.232], ['B', ' HG1', 161.383, 98.455, 102.1], ['B', ' HG1', 161.296, 98.776, 103.813], ['B', ' HG1', 162.748, 98.105, 103.162], ['B', ' HG2', 161.401, 96.097, 101.286], ['B', ' HG2', 162.731, 95.656, 102.363], ['B', ' HG2', 161.206, 94.762, 102.439]]
[['B', ' N ', 162.982, 97.594, 105.983], ['B', ' CA ', 164.299, 97.994, 106.449], ['B', ' C ', 164.781, 97.469, 107.831], ['B', ' O ', 165.821, 97.95, 108.27], ['B', ' CB ', 164.458, 99.517, 106.448], ['B', ' CG ', 164.423, 100.179, 105.093], ['B', ' CD ', 165.521, 99.753, 104.197], ['B', ' OE1', 166.472, 99.074, 104.583], ['B', ' NE2', 165.44, 100.181, 102.969], ['B', ' H ', 162.153, 98.083, 106.325], ['B', ' HA ', 164.994, 97.614, 105.724], ['B', ' HB ', 163.654, 99.952, 107.042], ['B', ' HB ', 165.4, 99.792, 106.923], ['B', ' HG ', 163.491, 99.911, 104.622], ['B', ' HG ', 164.485, 101.247, 105.19], ['B', ' HE2', 166.17, 99.934, 102.309], ['B', ' HE2', 164.668, 100.797, 102.688]]
[['B', ' N ', 164.084, 96.515, 108.542], ['B', ' CA ', 164.568, 96.001, 109.859], ['B', ' C ', 165.272, 94.659, 109.475], ['B', ' O ', 164.567, 93.691, 109.161], ['B', ' CB ', 163.424, 95.787, 110.909], ['B', ' SG ', 164.0, 95.71, 112.779], ['B', ' H ', 163.2, 96.144, 108.155], ['B', ' HA ', 165.244, 96.707, 110.306], ['B', ' HB ', 162.643, 96.488, 110.779], ['B', ' HB ', 162.924, 94.828, 110.716]]
[['B', ' N ', 166.627, 94.511, 109.567], ['B', ' CA ', 167.487, 93.428, 109.059], ['B', ' C ', 167.361, 92.086, 109.744], ['B', ' O ', 168.352, 91.479, 110.152], ['B', ' CB ', 168.868, 94.009, 109.312], ['B', ' CG ', 168.687, 94.81, 110.509], ['B', ' CD ', 167.362, 95.461, 110.293], ['B', ' HA ', 167.397, 93.315, 108.005], ['B', ' HB ', 169.62, 93.221, 109.431], ['B', ' HB ', 169.163, 94.62, 108.446], ['B', ' HG ', 168.713, 94.171, 111.406], ['B', ' HG ', 169.499, 95.536, 110.619], ['B', ' HD ', 166.888, 95.678, 111.233], ['B', ' HD ', 167.511, 96.319, 109.651]]
[['B', ' N ', 166.12, 91.654, 109.865], ['B', ' CA ', 165.656, 90.403, 110.364], ['B', ' C ', 164.735, 89.847, 109.321], ['B', ' O ', 164.6, 88.65, 109.143], ['B', ' CB ', 164.88, 90.624, 111.639], ['B', ' CG ', 165.595, 90.446, 112.93], ['B', ' CD ', 166.749, 91.268, 113.126], ['B', ' NE ', 167.962, 90.574, 112.751], ['B', ' CZ ', 168.606, 89.62, 113.499], ['B', ' NH1', 168.14, 89.226, 114.687], ['B', ' NH2', 169.719, 89.087, 113.033], ['B', ' H ', 165.387, 92.243, 109.502], ['B', ' HA ', 166.491, 89.724, 110.52], ['B', ' HB ', 164.472, 91.637, 111.633], ['B', ' HB ', 164.029, 89.942, 111.654], ['B', ' HG ', 164.904, 90.738, 113.698], ['B', ' HG ', 165.879, 89.403, 113.048], ['B', ' HD ', 166.672, 92.18, 112.538], ['B', ' HD ', 166.82, 91.537, 114.176], ['B', ' HE ', 168.352, 90.821, 111.832], ['B', ' HH1', 167.265, 89.6, 115.075], ['B', ' HH1', 168.65, 88.535, 115.261], ['B', ' HH2', 170.084, 89.38, 112.137], ['B', ' HH2', 170.207, 88.386, 113.57]]
[['B', ' N ', 164.07, 90.755, 108.639], ['B', ' CA ', 162.958, 90.387, 107.763], ['B', ' C ', 163.153, 89.99, 106.302], ['B', ' O ', 162.21, 89.47, 105.705], ['B', ' CB ', 162.007, 91.552, 107.728], ['B', ' OG ', 162.628, 92.648, 107.132], ['B', ' H ', 164.27, 91.753, 108.809], ['B', ' HA ', 162.455, 89.55, 108.249], ['B', ' HB ', 161.129, 91.28, 107.159], ['B', ' HB ', 161.687, 91.809, 108.734], ['B', ' HG ', 162.013, 93.404, 107.205]]
[['B', ' N ', 164.289, 90.265, 105.68], ['B', ' CA ', 164.29, 90.115, 104.224], ['B', ' C ', 165.56, 89.819, 103.386], ['B', ' O ', 165.456, 89.29, 102.282], ['B', ' CB ', 163.542, 91.353, 103.709], ['B', ' CG ', 163.545, 91.589, 102.284], ['B', ' CD1', 162.818, 90.982, 101.33], ['B', ' CD2', 164.269, 92.61, 101.633], ['B', ' NE1', 163.086, 91.551, 100.126], ['B', ' CE2', 163.967, 92.546, 100.309], ['B', ' CE3', 165.104, 93.549, 102.058], ['B', ' CZ2', 164.513, 93.409, 99.412], ['B', ' CZ3', 165.661, 94.408, 101.165], ['B', ' CH2', 165.376, 94.327, 99.88], ['B', ' H ', 165.073, 90.637, 106.182], ['B', ' HA ', 163.631, 89.274, 104.021], ['B', ' HB ', 162.496, 91.284, 104.001], ['B', ' HB ', 163.933, 92.234, 104.203], ['B', ' HD1', 162.127, 90.163, 101.499], ['B', ' HE1', 162.69, 91.319, 99.19], ['B', ' HE3', 165.314, 93.618, 103.084], ['B', ' HZ2', 164.275, 93.383, 98.365], ['B', ' HZ3', 166.337, 95.168, 101.53], ['B', ' HH2', 165.829, 95.016, 99.203]]
[['B', ' N ', 166.715, 90.285, 103.817], ['B', ' CA ', 167.84, 90.517, 102.923], ['B', ' C ', 168.731, 89.446, 102.316], ['B', ' O ', 169.179, 88.506, 102.979], ['B', ' CB ', 168.832, 91.418, 103.605], ['B', ' CG ', 168.424, 92.761, 103.669], ['B', ' CD1', 168.863, 93.769, 102.881], ['B', ' CD2', 167.472, 93.322, 104.528], ['B', ' NE1', 168.287, 94.904, 103.241], ['B', ' CE2', 167.42, 94.648, 104.239], ['B', ' CE3', 166.661, 92.817, 105.517], ['B', ' CZ2', 166.626, 95.447, 104.892], ['B', ' CZ3', 165.845, 93.616, 106.116], ['B', ' CH2', 165.828, 94.864, 105.842], ['B', ' H ', 166.783, 90.582, 104.764], ['B', ' HA ', 167.359, 91.094, 102.155], ['B', ' HB ', 168.986, 91.064, 104.616], ['B', ' HB ', 169.797, 91.377, 103.095], ['B', ' HD1', 169.596, 93.678, 102.101], ['B', ' HE1', 168.48, 95.854, 102.855], ['B', ' HE3', 166.67, 91.806, 105.813], ['B', ' HZ2', 166.579, 96.51, 104.672], ['B', ' HZ3', 165.188, 93.212, 106.875], ['B', ' HH2', 165.152, 95.428, 106.375]]
[['B', ' N ', 169.141, 89.698, 101.052], ['B', ' CA ', 170.077, 88.968, 100.248], ['B', ' C ', 171.473, 89.331, 100.668], ['B', ' O ', 172.117, 90.168, 100.025], ['B', ' CB ', 169.797, 89.462, 98.842], ['B', ' CG ', 169.374, 90.867, 99.042], ['B', ' CD ', 168.589, 90.874, 100.297], ['B', ' HA ', 169.902, 87.886, 100.345], ['B', ' HB ', 170.686, 89.344, 98.218], ['B', ' HB ', 169.014, 88.84, 98.383], ['B', ' HG ', 170.257, 91.498, 99.132], ['B', ' HG ', 168.827, 91.24, 98.196], ['B', ' HD ', 168.805, 91.83, 100.776], ['B', ' HD ', 167.515, 90.738, 100.047]]
[['B', ' N ', 171.95, 88.734, 101.732], ['B', ' CA ', 173.272, 89.097, 102.218], ['B', ' C ', 174.319, 88.894, 101.134], ['B', ' O ', 175.315, 89.623, 101.092], ['B', ' CB ', 173.619, 88.31, 103.463], ['B', ' CG ', 172.823, 88.745, 104.652], ['B', ' CD ', 173.09, 87.948, 105.864], ['B', ' OE1', 173.797, 86.953, 105.775], ['B', ' OE2', 172.593, 88.335, 106.904], ['B', ' H ', 171.365, 88.053, 102.231], ['B', ' HA ', 173.263, 90.15, 102.481], ['B', ' HB ', 173.429, 87.251, 103.289], ['B', ' HB ', 174.679, 88.427, 103.69], ['B', ' HG ', 173.084, 89.778, 104.853], ['B', ' HG ', 171.759, 88.705, 104.41]]
[['B', ' N ', 174.112, 87.913, 100.262], ['B', ' CA ', 175.042, 87.681, 99.186], ['B', ' C ', 175.085, 88.837, 98.173], ['B', ' O ', 176.132, 89.048, 97.561], ['B', ' CB ', 174.675, 86.373, 98.468], ['B', ' CG ', 173.283, 86.345, 97.755], ['B', ' CD ', 172.123, 86.002, 98.669], ['B', ' OE1', 172.292, 86.074, 99.866], ['B', ' OE2', 171.07, 85.689, 98.173], ['B', ' H ', 173.302, 87.296, 100.362], ['B', ' HA ', 176.036, 87.571, 99.617], ['B', ' HB ', 175.429, 86.157, 97.713], ['B', ' HB ', 174.694, 85.555, 99.187], ['B', ' HG ', 173.074, 87.28, 97.261], ['B', ' HG ', 173.335, 85.585, 96.978]]
[['B', ' N ', 173.987, 89.604, 98.002], ['B', ' CA ', 173.987, 90.723, 97.064], ['B', ' C ', 174.792, 91.832, 97.669], ['B', ' O ', 175.533, 92.541, 96.99], ['B', ' CB ', 172.577, 91.239, 96.789], ['B', ' CG ', 172.472, 92.33, 95.72], ['B', ' CD ', 172.875, 91.851, 94.35], ['B', ' OE1', 172.6, 90.7, 93.991], ['B', ' NE2', 173.497, 92.717, 93.559], ['B', ' H ', 173.143, 89.434, 98.547], ['B', ' HA ', 174.454, 90.41, 96.131], ['B', ' HB ', 171.945, 90.412, 96.478], ['B', ' HB ', 172.161, 91.64, 97.71], ['B', ' HG ', 171.45, 92.663, 95.668], ['B', ' HG ', 173.116, 93.174, 95.988], ['B', ' HE2', 173.765, 92.461, 92.632], ['B', ' HE2', 173.694, 93.678, 93.863]]
[['B', ' N ', 174.647, 91.954, 98.975], ['B', ' CA ', 175.333, 92.995, 99.701], ['B', ' C ', 176.81, 92.755, 99.643], ['B', ' O ', 177.582, 93.689, 99.44], ['B', ' CB ', 174.852, 93.037, 101.142], ['B', ' CG1', 173.424, 93.522, 101.109], ['B', ' CG2', 175.759, 93.925, 101.989], ['B', ' CD1', 172.698, 93.373, 102.347], ['B', ' H ', 173.983, 91.325, 99.439], ['B', ' HA ', 175.118, 93.951, 99.236], ['B', ' HB ', 174.85, 92.037, 101.556], ['B', ' HG1', 173.424, 94.575, 100.845], ['B', ' HG1', 172.881, 92.97, 100.342], ['B', ' HG2', 175.404, 93.946, 103.007], ['B', ' HG2', 176.778, 93.544, 101.992], ['B', ' HG2', 175.755, 94.936, 101.573], ['B', ' HD1', 171.717, 93.753, 102.189], ['B', ' HD1', 172.643, 92.333, 102.632], ['B', ' HD1', 173.177, 93.939, 103.131]]
[['B', ' N ', 177.225, 91.519, 99.848], ['B', ' CA ', 178.632, 91.23, 99.757], ['B', ' C ', 179.119, 91.405, 98.318], ['B', ' O ', 180.159, 92.014, 98.092], ['B', ' CB ', 178.908, 89.838, 100.3], ['B', ' CG ', 178.731, 89.77, 101.813], ['B', ' CD ', 178.961, 88.382, 102.377], ['B', ' CE ', 178.745, 88.371, 103.902], ['B', ' NZ ', 178.924, 87.015, 104.493], ['B', ' H ', 176.548, 90.785, 100.082], ['B', ' HA ', 179.169, 91.945, 100.379], ['B', ' HB ', 178.218, 89.126, 99.84], ['B', ' HB ', 179.922, 89.534, 100.048], ['B', ' HG ', 179.427, 90.466, 102.281], ['B', ' HG ', 177.717, 90.086, 102.063], ['B', ' HD ', 178.262, 87.683, 101.913], ['B', ' HD ', 179.978, 88.059, 102.158], ['B', ' HE ', 179.459, 89.052, 104.369], ['B', ' HE ', 177.733, 88.716, 104.12], ['B', ' HZ ', 178.772, 87.066, 105.522], ['B', ' HZ ', 178.261, 86.375, 104.09], ['B', ' HZ ', 179.861, 86.685, 104.323]]
[['B', ' N ', 178.327, 90.985, 97.323], ['B', ' CA ', 178.727, 91.118, 95.924], ['B', ' C ', 179.062, 92.564, 95.575], ['B', ' O ', 180.041, 92.833, 94.875], ['B', ' CB ', 177.608, 90.611, 95.008], ['B', ' CG ', 177.919, 90.603, 93.516], ['B', ' CD ', 176.74, 90.01, 92.723], ['B', ' CE ', 177.028, 89.949, 91.225], ['B', ' NZ ', 175.868, 89.387, 90.452], ['B', ' H ', 177.463, 90.478, 97.527], ['B', ' HA ', 179.619, 90.515, 95.762], ['B', ' HB ', 177.335, 89.599, 95.302], ['B', ' HB ', 176.727, 91.233, 95.145], ['B', ' HG ', 178.101, 91.626, 93.177], ['B', ' HG ', 178.816, 90.012, 93.335], ['B', ' HD ', 176.53, 89.002, 93.084], ['B', ' HD ', 175.852, 90.624, 92.891], ['B', ' HE ', 177.247, 90.95, 90.857], ['B', ' HE ', 177.899, 89.314, 91.062], ['B', ' HZ ', 176.092, 89.353, 89.467], ['B', ' HZ ', 175.65, 88.446, 90.778], ['B', ' HZ ', 175.067, 89.987, 90.587]]
[['B', ' N ', 178.27, 93.497, 96.086], ['B', ' CA ', 178.472, 94.923, 95.825], ['B', ' C ', 179.411, 95.698, 96.791], ['B', ' O ', 179.543, 96.917, 96.621], ['B', ' CB ', 177.118, 95.647, 95.816], ['B', ' CG ', 176.172, 95.195, 94.721], ['B', ' CD ', 174.897, 96.013, 94.621], ['B', ' OE1', 174.813, 97.083, 95.185], ['B', ' OE2', 173.976, 95.532, 94.008], ['B', ' H ', 177.442, 93.196, 96.612], ['B', ' HA ', 178.902, 95.006, 94.829], ['B', ' HB ', 176.618, 95.477, 96.775], ['B', ' HB ', 177.273, 96.719, 95.712], ['B', ' HG ', 176.697, 95.243, 93.769], ['B', ' HG ', 175.912, 94.151, 94.903]]
[['B', ' N ', 180.005, 95.034, 97.818], ['B', ' CA ', 180.842, 95.643, 98.876], ['B', ' C ', 182.32, 95.187, 98.771], ['B', ' O ', 182.718, 94.15, 99.315], ['B', ' OXT', 183.156, 95.998, 98.358], ['B', ' CB ', 180.194, 95.308, 100.274], ['B', ' CG ', 180.899, 95.829, 101.648], ['B', ' CD1', 180.867, 97.411, 101.727], ['B', ' CD2', 180.135, 95.185, 102.889], ['B', ' H ', 179.889, 94.016, 97.865], ['B', ' HA ', 180.831, 96.723, 98.756], ['B', ' HB ', 179.159, 95.68, 100.265], ['B', ' HB ', 180.134, 94.212, 100.341], ['B', ' HG ', 181.96, 95.508, 101.664], ['B', ' HD1', 181.352, 97.747, 102.65], ['B', ' HD1', 181.406, 97.838, 100.878], ['B', ' HD1', 179.835, 97.773, 101.715], ['B', ' HD2', 180.602, 95.509, 103.824], ['B', ' HD2', 179.087, 95.492, 102.891], ['B', ' HD2', 180.185, 94.096, 102.832]]
[['B', ' N ', 145.2, 100.621, 69.368], ['B', ' CA ', 145.368, 100.212, 70.775], ['B', ' C ', 145.026, 101.428, 71.689], ['B', ' O ', 145.19, 102.544, 71.198], ['B', ' CB ', 146.822, 99.703, 71.016], ['B', ' CG ', 147.23, 98.353, 70.244], ['B', ' CD ', 148.751, 97.944, 70.501], ['B', ' CE ', 149.204, 96.622, 69.728], ['B', ' NZ ', 148.617, 95.362, 70.319], ['B', ' H ', 145.976, 100.286, 68.816], ['B', ' H ', 144.338, 100.245, 68.998], ['B', ' H ', 145.172, 101.636, 69.325], ['B', ' HA ', 144.669, 99.39, 70.96], ['B', ' HB ', 147.551, 100.491, 70.737], ['B', ' HB ', 146.985, 99.513, 72.085], ['B', ' HG ', 146.577, 97.54, 70.587], ['B', ' HG ', 147.077, 98.475, 69.163], ['B', ' HD ', 149.399, 98.758, 70.162], ['B', ' HD ', 148.932, 97.807, 71.58], ['B', ' HE ', 148.899, 96.696, 68.682], ['B', ' HE ', 150.294, 96.545, 69.771], ['B', ' HZ ', 148.94, 94.561, 69.804], ['B', ' HZ ', 148.938, 95.285, 71.303], ['B', ' HZ ', 147.615, 95.398, 70.292]] AA_SCO= -0.9559999999999998 CA_SCO= -1.2446000000000004
[['B', ' N ', 144.516, 101.247, 72.971], ['B', ' CA ', 144.144, 102.294, 73.944], ['B', ' C ', 145.322, 102.999, 74.613], ['B', ' O ', 146.466, 102.525, 74.549], ['B', ' CB ', 143.316, 101.52, 74.981], ['B', ' CG ', 143.848, 100.118, 74.968], ['B', ' CD ', 144.203, 99.842, 73.525], ['B', ' HA ', 143.506, 103.043, 73.442], ['B', ' HB ', 143.44, 101.989, 75.98], ['B', ' HB ', 142.248, 101.578, 74.739], ['B', ' HG ', 144.693, 100.046, 75.665], ['B', ' HG ', 143.072, 99.438, 75.36], ['B', ' HD ', 145.078, 99.173, 73.485], ['B', ' HD ', 143.328, 99.402, 73.015]] AA_SCO= -0.7081818181818181 CA_SCO= -1.1869090909090911
[['B', ' N ', 145.024, 104.12, 75.264], ['B', ' CA ', 146.0, 104.831, 76.069], ['B', ' C ', 146.231, 104.119, 77.366], ['B', ' O ', 145.743, 102.995, 77.414], ['B', ' CB ', 145.519, 106.242, 76.332], ['B', ' CG ', 144.314, 106.332, 77.189], ['B', ' CD ', 143.828, 107.717, 77.334], ['B', ' NE ', 142.627, 107.717, 78.132], ['B', ' CZ ', 142.602, 107.734, 79.476], ['B', ' NH1', 143.707, 107.797, 80.175], ['B', ' NH2', 141.462, 107.67, 80.127], ['B', ' H ', 144.075, 104.473, 75.204], ['B', ' HA ', 146.952, 104.85, 75.566], ['B', ' HB ', 146.312, 106.811, 76.813], ['B', ' HB ', 145.261, 106.727, 75.396], ['B', ' HG ', 143.512, 105.748, 76.741], ['B', ' HG ', 144.533, 105.935, 78.177], ['B', ' HD ', 144.576, 108.349, 77.804], ['B', ' HD ', 143.582, 108.117, 76.343], ['B', ' HE ', 141.74, 107.662, 77.643], ['B', ' HH1', 144.603, 107.842, 79.732], ['B', ' HH1', 143.629, 107.796, 81.2], ['B', ' HH2', 140.587, 107.609, 79.632], ['B', ' HH2', 141.504, 107.648, 81.155]] AA_SCO= -0.39583333333333326 CA_SCO= -1.2388333333333337
[['B', ' N ', 147.476, 104.304, 77.75], ['B', ' CA ', 147.815, 104.266, 79.147], ['B', ' C ', 149.149, 104.949, 79.363], ['B', ' O ', 149.987, 104.956, 78.47], ['B', ' CB ', 147.838, 102.779, 79.605], ['B', ' CG1', 148.031, 102.615, 81.072], ['B', ' CG2', 148.87, 101.994, 78.854], ['B', ' CD1', 146.883, 103.025, 81.909], ['B', ' H ', 148.132, 103.746, 77.236], ['B', ' HA ', 147.053, 104.807, 79.701], ['B', ' HB ', 146.87, 102.334, 79.395], ['B', ' HG1', 148.209, 101.578, 81.234], ['B', ' HG1', 148.903, 103.145, 81.394], ['B', ' HG2', 148.824, 100.955, 79.162], ['B', ' HG2', 148.67, 102.046, 77.807], ['B', ' HG2', 149.861, 102.394, 79.059], ['B', ' HD1', 147.112, 102.814, 82.949], ['B', ' HD1', 146.671, 104.081, 81.805], ['B', ' HD1', 146.012, 102.452, 81.609]] AA_SCO= -0.20769230769230765 CA_SCO= -1.0936153846153849
[['B', ' N ', 149.346, 105.566, 80.51], ['B', ' CA ', 150.663, 106.091, 80.808], ['B', ' C ', 151.408, 105.062, 81.643], ['B', ' O ', 150.775, 104.381, 82.441], ['B', ' H ', 148.615, 105.596, 81.207], ['B', ' HA ', 151.203, 106.309, 79.906], ['B', ' HA ', 150.545, 107.006, 81.372]] AA_SCO= 0.02214285714285718 CA_SCO= -0.8869285714285715
[['B', ' N ', 152.73, 104.924, 81.491], ['B', ' CA ', 153.479, 104.015, 82.345], ['B', ' C ', 154.176, 104.719, 83.469], ['B', ' O ', 155.276, 104.242, 83.759], ['B', ' CB ', 154.372, 103.094, 81.568], ['B', ' CG ', 153.649, 101.871, 80.975], ['B', ' CD1', 152.248, 101.716, 80.901], ['B', ' CD2', 154.42, 100.852, 80.584], ['B', ' CE1', 151.734, 100.568, 80.382], ['B', ' CE2', 153.899, 99.737, 80.095], ['B', ' CZ ', 152.576, 99.595, 79.965], ['B', ' OH ', 152.091, 98.481, 79.415], ['B', ' H ', 153.255, 105.494, 80.835], ['B', ' HA ', 152.764, 103.364, 82.843], ['B', ' HB ', 154.77, 103.667, 80.737], ['B', ' HB ', 155.218, 102.77, 82.143], ['B', ' HD1', 151.562, 102.466, 81.221], ['B', ' HD2', 155.487, 100.939, 80.667], ['B', ' HE1', 150.669, 100.435, 80.299], ['B', ' HE2', 154.553, 98.955, 79.801], ['B', ' HH ', 152.837, 97.899, 79.205]] AA_SCO= 0.1206666666666667 CA_SCO= -0.7406000000000001
[['B', ' N ', 154.031, 106.027, 83.358], ['B', ' CA ', 154.001, 106.648, 84.657], ['B', ' C ', 152.509, 106.716, 84.83], ['B', ' O ', 151.857, 107.595, 84.261], ['B', ' CB ', 154.599, 108.07, 84.698], ['B', ' CG1', 156.037, 108.093, 84.116], ['B', ' CG2', 154.544, 108.634, 86.117], ['B', ' CD1', 157.06, 107.18, 84.782], ['B', ' H ', 154.63, 106.464, 82.663], ['B', ' HA ', 154.427, 106.003, 85.426], ['B', ' HB ', 154.004, 108.723, 84.078], ['B', ' HG1', 155.984, 107.827, 83.068], ['B', ' HG1', 156.4, 109.11, 84.19], ['B', ' HG2', 154.936, 109.65, 86.122], ['B', ' HG2', 153.51, 108.65, 86.472], ['B', ' HG2', 155.132, 108.018, 86.794], ['B', ' HD1', 158.021, 107.3, 84.283], ['B', ' HD1', 157.173, 107.436, 85.833], ['B', ' HD1', 156.745, 106.141, 84.697]] AA_SCO= 0.28375000000000006 CA_SCO= -0.6499375000000001
[['B', ' N ', 151.952, 105.783, 85.574], ['B', ' CA ', 150.515, 105.72, 85.611], ['B', ' C ', 150.014, 106.256, 86.91], ['B', ' O ', 150.231, 105.674, 87.978], ['B', ' CB ', 149.968, 104.315, 85.504], ['B', ' CG ', 148.486, 104.325, 85.404], ['B', ' ND1', 147.696, 103.326, 85.916], ['B', ' CD2', 147.639, 105.215, 84.831], ['B', ' CE1', 146.427, 103.613, 85.671], ['B', ' NE2', 146.376, 104.747, 85.016], ['B', ' H ', 152.527, 105.09, 86.059], ['B', ' HA ', 150.101, 106.317, 84.805], ['B', ' HB ', 150.401, 103.79, 84.677], ['B', ' HB ', 150.22, 103.78, 86.398], ['B', ' HD2', 147.893, 106.136, 84.312], ['B', ' HE1', 145.567, 103.029, 85.94], ['B', ' HE2', 145.509, 105.215, 84.679]] AA_SCO= 0.3652941176470589 CA_SCO= -0.4962941176470589
[['B', ' N ', 149.337, 107.366, 86.845], ['B', ' CA ', 148.885, 107.982, 88.052], ['B', ' C ', 147.462, 107.599, 88.39], ['B', ' O ', 146.542, 107.843, 87.61], ['B', ' CB ', 149.055, 109.485, 87.885], ['B', ' CG ', 148.592, 110.389, 88.995], ['B', ' CD1', 149.351, 110.145, 90.25], ['B', ' CD2', 148.815, 111.793, 88.546], ['B', ' H ', 149.168, 107.801, 85.948], ['B', ' HA ', 149.517, 107.652, 88.851], ['B', ' HB ', 150.117, 109.685, 87.725], ['B', ' HB ', 148.523, 109.784, 86.983], ['B', ' HG ', 147.551, 110.223, 89.204], ['B', ' HD1', 148.989, 110.833, 91.01], ['B', ' HD1', 149.216, 109.135, 90.608], ['B', ' HD1', 150.412, 110.321, 90.09], ['B', ' HD2', 148.509, 112.439, 89.311], ['B', ' HD2', 149.877, 111.958, 88.341], ['B', ' HD2', 148.242, 111.982, 87.647]] AA_SCO= 0.4833333333333334 CA_SCO= -0.7045555555555557
[['B', ' N ', 147.283, 106.975, 89.558], ['B', ' CA ', 145.96, 106.577, 90.02], ['B', ' C ', 145.596, 107.422, 91.239], ['B', ' O ', 144.438, 107.512, 91.638], ['B', ' CB ', 145.892, 105.093, 90.332], ['B', ' OG ', 146.114, 104.331, 89.193], ['B', ' H ', 148.076, 106.752, 90.139], ['B', ' HA ', 145.234, 106.785, 89.234], ['B', ' HB ', 146.623, 104.835, 91.06], ['B', ' HB ', 144.918, 104.858, 90.751], ['B', ' HG ', 145.857, 103.441, 89.424]] AA_SCO= 0.5731578947368421 CA_SCO= -0.5655789473684212
[['B', ' N ', 146.596, 108.113, 91.766], ['B', ' CA ', 146.502, 108.982, 92.92], ['B', ' C ', 147.909, 109.201, 93.493], ['B', ' O ', 148.78, 108.356, 93.32], ['B', ' H ', 147.515, 107.977, 91.392], ['B', ' HA ', 146.057, 109.934, 92.634], ['B', ' HA ', 145.86, 108.524, 93.671]] AA_SCO= 0.6863157894736842 CA_SCO= -0.16715789473684212
[['B', ' N ', 148.093, 110.335, 94.191], ['B', ' CA ', 149.336, 110.792, 94.85], ['B', ' C ', 150.447, 111.174, 93.876], ['B', ' O ', 150.61, 110.573, 92.827], ['B', ' CB ', 149.894, 109.717, 95.769], ['B', ' SG ', 148.83, 109.262, 97.152], ['B', ' H ', 147.299, 110.952, 94.243], ['B', ' HA ', 149.092, 111.668, 95.454], ['B', ' HB ', 150.141, 108.812, 95.214], ['B', ' HB ', 150.811, 110.093, 96.173], ['B', ' HG ', 149.567, 108.215, 97.572]] AA_SCO= 0.9715789473684209 CA_SCO= 0.2763157894736843
[['B', ' N ', 151.258, 112.16, 94.243], ['B', ' CA ', 152.362, 112.561, 93.367], ['B', ' C ', 153.778, 112.519, 93.945], ['B', ' O ', 154.714, 112.824, 93.235], ['B', ' CB ', 152.089, 113.928, 92.769], ['B', ' OG1', 151.9, 114.878, 93.825], ['B', ' CG2', 150.846, 113.855, 91.876], ['B', ' H ', 151.079, 112.651, 95.105], ['B', ' HA ', 152.371, 111.868, 92.524], ['B', ' HB ', 152.942, 114.236, 92.159], ['B', ' HG1', 151.753, 115.751, 93.413], ['B', ' HG2', 150.666, 114.827, 91.428], ['B', ' HG2', 151.013, 113.125, 91.082], ['B', ' HG2', 149.978, 113.562, 92.449]] AA_SCO= 1.093157894736842 CA_SCO= 0.3600526315789474
[['B', ' N ', 153.977, 112.099, 95.198], ['B', ' CA ', 155.346, 112.095, 95.79], ['B', ' C ', 156.211, 110.968, 95.236], ['B', ' O ', 157.442, 110.942, 95.357], ['B', ' H ', 153.182, 111.83, 95.755], ['B', ' HA ', 155.84, 113.046, 95.592], ['B', ' HA ', 155.271, 111.992, 96.872]] AA_SCO= 1.2810526315789474 CA_SCO= 0.5744736842105262
[['B', ' N ', 155.549, 110.065, 94.568], ['B', ' CA ', 156.147, 108.909, 93.971], ['B', ' C ', 156.63, 109.28, 92.581], ['B', ' O ', 157.329, 108.527, 91.915], ['B', ' CB ', 155.087, 107.84, 93.965], ['B', ' CG ', 154.702, 107.414, 95.38], ['B', ' OD1', 155.55, 107.167, 96.188], ['B', ' OD2', 153.536, 107.411, 95.649], ['B', ' H ', 154.549, 110.174, 94.506], ['B', ' HA ', 156.996, 108.587, 94.557], ['B', ' HB ', 154.194, 108.23, 93.488], ['B', ' HB ', 155.418, 107.0, 93.382]] AA_SCO= 1.4184210526315788 CA_SCO= 0.9031578947368422
[['B', ' N ', 156.279, 110.486, 92.169], ['B', ' CA ', 156.65, 111.073, 90.913], ['B', ' C ', 157.487, 112.264, 91.297], ['B', ' O ', 157.397, 112.75, 92.415], ['B', ' CB ', 155.436, 111.472, 90.096], ['B', ' H ', 155.718, 111.08, 92.774], ['B', ' HA ', 157.261, 110.37, 90.349], ['B', ' HB ', 155.754, 111.943, 89.169], ['B', ' HB ', 154.846, 110.583, 89.869], ['B', ' HB ', 154.828, 112.175, 90.67]] AA_SCO= 1.4663157894736842 CA_SCO= 1.0994210526315789
[['B', ' N ', 158.355, 112.721, 90.424], ['B', ' CA ', 159.175, 113.883, 90.766], ['B', ' C ', 159.929, 113.649, 92.069], ['B', ' O ', 160.067, 114.541, 92.903], ['B', ' CB ', 158.324, 115.144, 90.85], ['B', ' CG ', 157.63, 115.455, 89.558], ['B', ' SD ', 158.795, 115.669, 88.212], ['B', ' CE ', 157.723, 115.973, 86.883], ['B', ' H ', 158.424, 112.299, 89.509], ['B', ' HA ', 159.911, 114.015, 89.983], ['B', ' HB ', 157.576, 115.054, 91.635], ['B', ' HB ', 158.96, 115.995, 91.103], ['B', ' HG ', 156.941, 114.65, 89.308], ['B', ' HG ', 157.051, 116.374, 89.67], ['B', ' HE ', 158.296, 116.135, 85.976], ['B', ' HE ', 157.06, 115.122, 86.747], ['B', ' HE ', 157.131, 116.859, 87.102]] AA_SCO= 1.6342105263157896 CA_SCO= 1.0950526315789475
[['B', ' N ', 160.424, 112.426, 92.184], ['B', ' CA ', 161.224, 111.877, 93.252], ['B', ' C ', 162.192, 111.024, 92.476], ['B', ' O ', 163.363, 110.886, 92.796], ['B', ' CB ', 160.324, 111.206, 94.256], ['B', ' OG ', 159.559, 110.193, 93.711], ['B', ' H ', 160.238, 111.786, 91.434], ['B', ' HA ', 161.772, 112.672, 93.759], ['B', ' HB ', 160.912, 110.813, 95.088], ['B', ' HB ', 159.656, 111.964, 94.652], ['B', ' HG ', 158.741, 110.205, 94.303]] AA_SCO= 1.8163157894736845 CA_SCO= 1.0946315789473684
[['B', ' N ', 161.723, 110.613, 91.302], ['B', ' CA ', 162.534, 109.926, 90.298], ['B', ' C ', 163.579, 110.922, 89.807], ['B', ' O ', 164.754, 110.612, 89.621], ['B', ' CB ', 161.65, 109.446, 89.132], ['B', ' CG ', 162.341, 108.657, 87.978], ['B', ' CD1', 161.332, 107.65, 87.383], ['B', ' CD2', 162.808, 109.623, 86.863], ['B', ' H ', 160.734, 110.732, 91.138], ['B', ' HA ', 163.04, 109.078, 90.758], ['B', ' HB ', 160.871, 108.805, 89.544], ['B', ' HB ', 161.172, 110.315, 88.685], ['B', ' HG ', 163.201, 108.118, 88.362], ['B', ' HD1', 161.808, 107.089, 86.577], ['B', ' HD1', 161.003, 106.956, 88.151], ['B', ' HD1', 160.468, 108.183, 86.987], ['B', ' HD2', 163.277, 109.042, 86.069], ['B', ' HD2', 161.949, 110.159, 86.46], ['B', ' HD2', 163.525, 110.337, 87.224]] AA_SCO= 1.9326315789473683 CA_SCO= 1.0808947368421051
[['B', ' N ', 163.134, 112.156, 89.627], ['B', ' CA ', 163.903, 113.255, 89.09], ['B', ' C ', 164.907, 113.788, 90.104], ['B', ' O ', 165.722, 114.658, 89.803], ['B', ' CB ', 162.972, 114.375, 88.606], ['B', ' OG1', 162.179, 114.825, 89.692], ['B', ' CG2', 162.08, 113.852, 87.489], ['B', ' H ', 162.174, 112.356, 89.846], ['B', ' HA ', 164.461, 112.886, 88.229], ['B', ' HB ', 163.551, 115.207, 88.237], ['B', ' HG1', 161.69, 115.617, 89.424], ['B', ' HG2', 161.427, 114.648, 87.144], ['B', ' HG2', 162.704, 113.514, 86.663], ['B', ' HG2', 161.479, 113.021, 87.848]] AA_SCO= 2.0026315789473688 CA_SCO= 1.0684210526315787
[['B', ' N ', 164.93, 113.237, 91.311], ['B', ' CA ', 165.901, 113.694, 92.275], ['B', ' C ', 167.201, 112.926, 92.087], ['B', ' O ', 168.156, 113.079, 92.841], ['B', ' CB ', 165.381, 113.663, 93.69], ['B', ' CG ', 164.295, 114.694, 93.945], ['B', ' CD ', 163.894, 114.677, 95.34], ['B', ' OE1', 164.351, 113.782, 96.0], ['B', ' OE2', 163.145, 115.51, 95.772], ['B', ' H ', 164.297, 112.483, 91.589], ['B', ' HA ', 166.116, 114.74, 92.067], ['B', ' HB ', 164.957, 112.687, 93.905], ['B', ' HB ', 166.198, 113.838, 94.389], ['B', ' HG ', 164.668, 115.685, 93.693], ['B', ' HG ', 163.435, 114.484, 93.308]] AA_SCO= 2.0173684210526317 CA_SCO= 1.203894736842105
[['B', ' N ', 167.263, 112.135, 91.014], ['B', ' CA ', 168.5, 111.499, 90.617], ['B', ' C ', 169.443, 112.609, 90.169], ['B', ' O ', 170.66, 112.429, 90.079], ['B', ' CB ', 168.258, 110.527, 89.502], ['B', ' CG ', 167.642, 109.33, 89.976], ['B', ' OD1', 167.939, 108.911, 91.085], ['B', ' ND2', 166.779, 108.758, 89.201], ['B', ' H ', 166.417, 111.951, 90.47], ['B', ' HA ', 168.948, 110.997, 91.475], ['B', ' HB ', 167.621, 110.984, 88.74], ['B', ' HB ', 169.188, 110.28, 89.049], ['B', ' HD2', 166.302, 107.935, 89.503], ['B', ' HD2', 166.565, 109.156, 88.312]] AA_SCO= 1.9031578947368415 CA_SCO= 1.091578947368421
[['B', ' N ', 168.855, 113.734, 89.769], ['B', ' CA ', 169.526, 114.955, 89.386], ['B', ' C ', 170.565, 114.836, 88.308], ['B', ' O ', 170.315, 115.136, 87.139], ['B', ' CB ', 170.17, 115.612, 90.624], ['B', ' CG ', 169.172, 116.173, 91.618], ['B', ' CD1', 169.109, 115.759, 92.953], ['B', ' CD2', 168.309, 117.099, 91.186], ['B', ' CE1', 168.143, 116.315, 93.804], ['B', ' CE2', 167.405, 117.621, 91.994], ['B', ' CZ ', 167.287, 117.263, 93.273], ['B', ' OH ', 166.298, 117.898, 93.985], ['B', ' H ', 167.837, 113.792, 89.835], ['B', ' HA ', 168.768, 115.63, 89.013], ['B', ' HB ', 170.791, 114.889, 91.15], ['B', ' HB ', 170.824, 116.426, 90.302], ['B', ' HD1', 169.801, 115.002, 93.328], ['B', ' HD2', 168.339, 117.435, 90.172], ['B', ' HE1', 168.068, 116.007, 94.846], ['B', ' HE2', 166.749, 118.352, 91.609], ['B', ' HH ', 166.166, 117.548, 94.878]] AA_SCO= 1.9315789473684213 CA_SCO= 1.139052631578947
[['B', ' N ', 171.709, 114.295, 88.694], ['B', ' CA ', 172.908, 114.244, 87.879], ['B', ' C ', 172.719, 113.389, 86.665], ['B', ' O ', 173.318, 113.625, 85.616], ['B', ' CB ', 174.066, 113.707, 88.707], ['B', ' CG ', 174.555, 114.693, 89.803], ['B', ' OD1', 174.194, 115.869, 89.791], ['B', ' OD2', 175.292, 114.254, 90.65], ['B', ' H ', 171.737, 113.924, 89.639], ['B', ' HA ', 173.146, 115.256, 87.551], ['B', ' HB ', 173.753, 112.78, 89.192], ['B', ' HB ', 174.9, 113.464, 88.049]] AA_SCO= 1.807894736842105 CA_SCO= 1.147421052631579
[['B', ' N ', 171.882, 112.385, 86.802], ['B', ' CA ', 171.638, 111.514, 85.676], ['B', ' C ', 170.206, 111.56, 85.208], ['B', ' O ', 169.799, 110.65, 84.492], ['B', ' CB ', 171.951, 110.04, 85.991], ['B', ' CG1', 171.025, 109.535, 87.138], ['B', ' CG2', 173.42, 109.932, 86.372], ['B', ' CD1', 171.003, 108.033, 87.346], ['B', ' H ', 171.443, 112.242, 87.719], ['B', ' HA ', 172.27, 111.826, 84.846], ['B', ' HB ', 171.761, 109.426, 85.11], ['B', ' HG1', 171.345, 110.002, 88.069], ['B', ' HG1', 170.004, 109.83, 86.929], ['B', ' HG2', 173.681, 108.902, 86.584], ['B', ' HG2', 174.028, 110.292, 85.543], ['B', ' HG2', 173.616, 110.54, 87.252], ['B', ' HD1', 170.322, 107.799, 88.164], ['B', ' HD1', 170.654, 107.548, 86.43], ['B', ' HD1', 171.995, 107.669, 87.593]] AA_SCO= 1.8605263157894734 CA_SCO= 1.1808947368421052
[['B', ' N ', 169.377, 112.525, 85.621], ['B', ' CA ', 168.004, 112.305, 85.186], ['B', ' C ', 167.87, 112.641, 83.715], ['B', ' O ', 167.071, 112.029, 83.008], ['B', ' CB ', 166.973, 113.092, 85.999], ['B', ' CG ', 166.753, 114.568, 85.703], ['B', ' CD1', 165.604, 114.702, 84.692], ['B', ' CD2', 166.392, 115.262, 86.909], ['B', ' H ', 169.68, 113.337, 86.174], ['B', ' HA ', 167.767, 111.254, 85.324], ['B', ' HB ', 166.013, 112.591, 85.896], ['B', ' HB ', 167.268, 113.026, 87.049], ['B', ' HG ', 167.654, 115.018, 85.298], ['B', ' HD1', 165.432, 115.73, 84.525], ['B', ' HD1', 165.8, 114.223, 83.75], ['B', ' HD1', 164.709, 114.263, 85.125], ['B', ' HD2', 166.217, 116.308, 86.684], ['B', ' HD2', 165.513, 114.83, 87.289], ['B', ' HD2', 167.173, 115.174, 87.623]] AA_SCO= 1.8047368421052634 CA_SCO= 1.2385263157894735
[['B', ' N ', 168.659, 113.604, 83.217], ['B', ' CA ', 168.513, 113.981, 81.822], ['B', ' C ', 168.82, 112.783, 80.952], ['B', ' O ', 168.129, 112.522, 79.969], ['B', ' CB ', 169.445, 115.135, 81.47], ['B', ' H ', 169.333, 114.072, 83.81], ['B', ' HA ', 167.48, 114.276, 81.649], ['B', ' HB ', 169.312, 115.403, 80.421], ['B', ' HB ', 169.231, 115.994, 82.088], ['B', ' HB ', 170.478, 114.834, 81.635]] AA_SCO= 1.8542105263157898 CA_SCO= 1.2389473684210526
[['B', ' N ', 169.823, 112.008, 81.353], ['B', ' CA ', 170.19, 110.825, 80.605], ['B', ' C ', 169.215, 109.694, 80.852], ['B', ' O ', 168.776, 108.999, 79.921], ['B', ' CB ', 171.586, 110.377, 81.014], ['B', ' CG ', 172.668, 111.322, 80.602], ['B', ' CD ', 172.771, 111.42, 79.12], ['B', ' OE1', 172.886, 110.394, 78.487], ['B', ' OE2', 172.709, 112.508, 78.606], ['B', ' H ', 170.36, 112.28, 82.163], ['B', ' HA ', 170.184, 111.069, 79.542], ['B', ' HB ', 171.626, 110.267, 82.103], ['B', ' HB ', 171.796, 109.398, 80.578], ['B', ' HG ', 172.456, 112.31, 81.009], ['B', ' HG ', 173.617, 110.981, 81.013]] AA_SCO= 1.8526315789473686 CA_SCO= 1.544473684210526
[['B', ' N ', 168.753, 109.564, 82.095], ['B', ' CA ', 167.894, 108.455, 82.432], ['B', ' C ', 166.604, 108.536, 81.654], ['B', ' O ', 166.127, 107.536, 81.122], ['B', ' CB ', 167.601, 108.428, 83.937], ['B', ' CG ', 166.762, 107.234, 84.489], ['B', ' CD1', 167.493, 105.899, 84.21], ['B', ' CD2', 166.544, 107.441, 86.006], ['B', ' H ', 169.078, 110.171, 82.848], ['B', ' HA ', 168.42, 107.562, 82.177], ['B', ' HB ', 168.551, 108.44, 84.469], ['B', ' HB ', 167.063, 109.34, 84.185], ['B', ' HG ', 165.791, 107.199, 83.981], ['B', ' HD1', 166.906, 105.084, 84.592], ['B', ' HD1', 167.627, 105.756, 83.149], ['B', ' HD1', 168.468, 105.906, 84.702], ['B', ' HD2', 165.949, 106.621, 86.412], ['B', ' HD2', 167.51, 107.472, 86.515], ['B', ' HD2', 166.017, 108.384, 86.167]] AA_SCO= 1.9194736842105262 CA_SCO= 1.3731052631578944
[['B', ' N ', 166.074, 109.747, 81.505], ['B', ' CA ', 164.824, 109.966, 80.797], ['B', ' C ', 164.994, 110.275, 79.309], ['B', ' O ', 164.013, 110.621, 78.646], ['B', ' CB ', 164.038, 111.106, 81.467], ['B', ' CG ', 163.552, 110.868, 82.943], ['B', ' CD1', 162.9, 112.148, 83.465], ['B', ' CD2', 162.535, 109.71, 82.989], ['B', ' H ', 166.522, 110.548, 81.965], ['B', ' HA ', 164.243, 109.048, 80.853], ['B', ' HB ', 164.685, 111.988, 81.478], ['B', ' HB ', 163.166, 111.331, 80.858], ['B', ' HG ', 164.411, 110.636, 83.579], ['B', ' HD1', 162.572, 112.0, 84.494], ['B', ' HD1', 163.628, 112.947, 83.428], ['B', ' HD1', 162.043, 112.404, 82.844], ['B', ' HD2', 162.19, 109.562, 84.003], ['B', ' HD2', 161.688, 109.959, 82.355], ['B', ' HD2', 162.988, 108.788, 82.639]] AA_SCO= 2.0126315789473685 CA_SCO= 1.3535263157894735
[['B', ' N ', 166.22, 110.201, 78.786], ['B', ' CA ', 166.445, 110.491, 77.372], ['B', ' C ', 167.061, 109.31, 76.637], ['B', ' O ', 166.548, 108.88, 75.604], ['B', ' CB ', 167.381, 111.705, 77.146], ['B', ' OG1', 166.832, 112.877, 77.75], ['B', ' CG2', 167.537, 111.965, 75.653], ['B', ' H ', 166.994, 109.883, 79.362], ['B', ' HA ', 165.488, 110.71, 76.906], ['B', ' HB ', 168.362, 111.503, 77.58], ['B', ' HG1', 167.01, 112.818, 78.712], ['B', ' HG2', 168.191, 112.821, 75.508], ['B', ' HG2', 167.966, 111.106, 75.153], ['B', ' HG2', 166.561, 112.177, 75.223]] AA_SCO= 2.0410526315789475 CA_SCO= 1.3533684210526318
[['B', ' N ', 168.204, 108.826, 77.13], ['B', ' CA ', 168.959, 107.798, 76.435], ['B', ' C ', 168.848, 106.4, 77.025], ['B', ' O ', 169.106, 105.415, 76.336], ['B', ' CB ', 170.41, 108.218, 76.377], ['B', ' CG ', 170.615, 109.444, 75.519], ['B', ' OD1', 169.953, 109.6, 74.486], ['B', ' ND2', 171.514, 110.314, 75.907], ['B', ' H ', 168.556, 109.177, 78.018], ['B', ' HA ', 168.579, 107.737, 75.415], ['B', ' HB ', 170.764, 108.438, 77.391], ['B', ' HB ', 171.014, 107.402, 75.986], ['B', ' HD2', 171.682, 111.137, 75.366], ['B', ' HD2', 172.056, 110.176, 76.762]] AA_SCO= 2.0573684210526313 CA_SCO= 1.3531578947368421
[['B', ' N ', 168.474, 106.307, 78.288], ['B', ' CA ', 168.434, 105.019, 78.963], ['B', ' C ', 167.053, 104.381, 78.993], ['B', ' O ', 166.815, 103.362, 78.343], ['B', ' CB ', 168.928, 105.223, 80.36], ['B', ' CG ', 170.39, 105.587, 80.439], ['B', ' SD ', 170.916, 106.037, 82.092], ['B', ' CE ', 170.844, 104.481, 82.932], ['B', ' H ', 168.301, 107.167, 78.81], ['B', ' HA ', 169.102, 104.336, 78.441], ['B', ' HB ', 168.359, 105.998, 80.785], ['B', ' HB ', 168.744, 104.339, 80.932], ['B', ' HG ', 170.99, 104.745, 80.098], ['B', ' HG ', 170.587, 106.432, 79.777], ['B', ' HE ', 171.154, 104.619, 83.968], ['B', ' HE ', 169.833, 104.1, 82.907], ['B', ' HE ', 171.513, 103.77, 82.447]] AA_SCO= 2.0036842105263153 CA_SCO= 1.3563684210526317
[['B', ' N ', 166.141, 104.959, 79.762], ['B', ' CA ', 164.81, 104.408, 79.891], ['B', ' C ', 163.852, 105.308, 79.139], ['B', ' O ', 163.657, 106.461, 79.503], ['B', ' CB ', 164.427, 104.325, 81.38], ['B', ' CG1', 163.013, 103.766, 81.535], ['B', ' CG2', 165.463, 103.442, 82.13], ['B', ' H ', 166.353, 105.828, 80.253], ['B', ' HA ', 164.786, 103.41, 79.454], ['B', ' HB ', 164.436, 105.335, 81.806], ['B', ' HG1', 162.752, 103.73, 82.592], ['B', ' HG1', 162.305, 104.409, 81.013], ['B', ' HG1', 162.968, 102.763, 81.115], ['B', ' HG2', 165.206, 103.396, 83.185], ['B', ' HG2', 165.456, 102.438, 81.712], ['B', ' HG2', 166.453, 103.867, 82.023]] AA_SCO= 2.0531578947368425 CA_SCO= 1.3586315789473684
[['B', ' N ', 163.224, 104.786, 78.104], ['B', ' CA ', 162.389, 105.643, 77.288], ['B', ' C ', 160.962, 105.733, 77.806], ['B', ' O ', 160.163, 104.798, 77.665], ['B', ' CB ', 162.376, 105.144, 75.843], ['B', ' CG ', 161.653, 106.085, 74.908], ['B', ' OD1', 161.253, 107.123, 75.364], ['B', ' OD2', 161.518, 105.772, 73.746], ['B', ' H ', 163.378, 103.82, 77.853], ['B', ' HA ', 162.813, 106.648, 77.299], ['B', ' HB ', 163.403, 105.025, 75.493], ['B', ' HB ', 161.894, 104.168, 75.796]] AA_SCO= 2.1552631578947374 CA_SCO= 1.360947368421053
[['B', ' N ', 160.615, 106.848, 78.427], ['B', ' CA ', 159.273, 106.926, 78.939], ['B', ' C ', 158.455, 107.398, 77.8], ['B', ' O ', 158.363, 108.59, 77.521], ['B', ' CB ', 159.115, 107.925, 80.094], ['B', ' CG1', 160.091, 107.601, 81.252], ['B', ' CG2', 157.637, 107.977, 80.545], ['B', ' CD1', 159.953, 106.217, 81.866], ['B', ' H ', 161.276, 107.609, 78.513], ['B', ' HA ', 158.918, 105.943, 79.232], ['B', ' HB ', 159.395, 108.917, 79.736], ['B', ' HG1', 161.115, 107.701, 80.882], ['B', ' HG1', 159.934, 108.331, 82.042], ['B', ' HG2', 157.524, 108.71, 81.328], ['B', ' HG2', 156.997, 108.265, 79.709], ['B', ' HG2', 157.312, 107.005, 80.912], ['B', ' HD1', 160.686, 106.107, 82.665], ['B', ' HD1', 158.955, 106.08, 82.279], ['B', ' HD1', 160.137, 105.46, 81.113]] AA_SCO= 2.022631578947369 CA_SCO= 1.2783157894736845
[['B', ' N ', 157.828, 106.445, 77.174], ['B', ' CA ', 157.031, 106.739, 76.021], ['B', ' C ', 155.693, 107.324, 76.403], ['B', ' O ', 155.175, 108.165, 75.684], ['B', ' CB ', 156.921, 105.516, 75.083], ['B', ' CG1', 158.25, 105.284, 74.417], ['B', ' CG2', 156.627, 104.241, 75.852], ['B', ' H ', 158.038, 105.499, 77.487], ['B', ' HA ', 157.562, 107.5, 75.447], ['B', ' HB ', 156.159, 105.713, 74.338], ['B', ' HG1', 158.19, 104.43, 73.747], ['B', ' HG1', 158.54, 106.169, 73.846], ['B', ' HG1', 159.006, 105.094, 75.177], ['B', ' HG2', 156.571, 103.405, 75.157], ['B', ' HG2', 157.437, 104.071, 76.531], ['B', ' HG2', 155.721, 104.286, 76.404]] AA_SCO= 1.9242105263157896 CA_SCO= 1.1746315789473685
[['B', ' N ', 155.102, 106.842, 77.486], ['B', ' CA ', 153.817, 107.356, 77.944], ['B', ' C ', 153.822, 107.555, 79.448], ['B', ' O ', 154.476, 106.818, 80.199], ['B', ' CB ', 152.671, 106.494, 77.476], ['B', ' CG ', 152.506, 106.468, 75.984], ['B', ' CD1', 153.305, 105.709, 75.214], ['B', ' CD2', 151.536, 107.204, 75.395], ['B', ' CE1', 153.201, 105.687, 73.89], ['B', ' CE2', 151.403, 107.161, 74.037], ['B', ' CZ ', 152.245, 106.412, 73.295], ['B', ' OH ', 152.078, 106.331, 71.944], ['B', ' H ', 155.588, 106.14, 78.025], ['B', ' HA ', 153.66, 108.335, 77.498], ['B', ' HB ', 152.817, 105.53, 77.829], ['B', ' HB ', 151.747, 106.872, 77.885], ['B', ' HD1', 154.032, 105.128, 75.669], ['B', ' HD2', 150.878, 107.807, 75.999], ['B', ' HE1', 153.873, 105.071, 73.304], ['B', ' HE2', 150.636, 107.726, 73.537], ['B', ' HH ', 151.11, 106.355, 71.762]] AA_SCO= 1.8968421052631583 CA_SCO= 1.1513684210526318
[['B', ' N ', 153.034, 108.516, 79.873], ['B', ' CA ', 152.865, 108.934, 81.252], ['B', ' C ', 152.733, 110.413, 81.102], ['B', ' O ', 153.749, 111.101, 80.973], ['B', ' H ', 152.538, 109.053, 79.17], ['B', ' HA ', 151.988, 108.514, 81.724], ['B', ' HA ', 153.742, 108.677, 81.837]] AA_SCO= 1.8852631578947372 CA_SCO= 1.025263157894737
[['B', ' N ', 151.503, 110.913, 81.181], ['B', ' CA ', 151.237, 112.317, 80.907], ['B', ' C ', 152.009, 113.257, 81.793], ['B', ' O ', 152.499, 114.277, 81.326], ['B', ' CB ', 149.746, 112.571, 80.947], ['B', ' CG ', 149.032, 111.858, 79.792], ['B', ' CD ', 148.689, 110.422, 80.096], ['B', ' OE1', 148.285, 110.127, 81.221], ['B', ' NE2', 148.867, 109.522, 79.133], ['B', ' H ', 150.726, 110.289, 81.371], ['B', ' HA ', 151.541, 112.514, 79.898], ['B', ' HB ', 149.336, 112.23, 81.895], ['B', ' HB ', 149.554, 113.642, 80.87], ['B', ' HG ', 148.139, 112.376, 79.573], ['B', ' HG ', 149.687, 111.864, 78.913], ['B', ' HE2', 148.651, 108.56, 79.296], ['B', ' HE2', 149.257, 109.798, 78.222]] AA_SCO= 1.868421052631579 CA_SCO= 0.7509473684210528
[['B', ' N ', 152.313, 112.827, 82.996], ['B', ' CA ', 153.09, 113.636, 83.888], ['B', ' C ', 154.383, 114.086, 83.192], ['B', ' O ', 154.846, 115.195, 83.428], ['B', ' CB ', 153.477, 112.823, 85.138], ['B', ' OG1', 152.294, 112.32, 85.782], ['B', ' CG2', 154.286, 113.664, 86.124], ['B', ' H ', 151.928, 111.958, 83.34], ['B', ' HA ', 152.506, 114.512, 84.172], ['B', ' HB ', 154.088, 111.973, 84.83], ['B', ' HG1', 151.639, 113.036, 85.945], ['B', ' HG2', 154.545, 113.054, 86.987], ['B', ' HG2', 155.195, 114.017, 85.652], ['B', ' HG2', 153.695, 114.517, 86.45]] AA_SCO= 1.8973684210526314 CA_SCO= 1.0523684210526316
[['B', ' N ', 155.044, 113.197, 82.435], ['B', ' CA ', 156.305, 113.551, 81.793], ['B', ' C ', 156.209, 113.825, 80.286], ['B', ' O ', 157.029, 114.578, 79.751], ['B', ' CB ', 157.329, 112.434, 82.027], ['B', ' CG ', 157.686, 112.107, 83.521], ['B', ' CD1', 158.669, 110.924, 83.549], ['B', ' CD2', 158.3, 113.336, 84.218], ['B', ' H ', 154.631, 112.289, 82.233], ['B', ' HA ', 156.665, 114.468, 82.245], ['B', ' HB ', 156.935, 111.522, 81.571], ['B', ' HB ', 158.249, 112.7, 81.51], ['B', ' HG ', 156.779, 111.811, 84.051], ['B', ' HD1', 158.911, 110.672, 84.581], ['B', ' HD1', 158.226, 110.065, 83.07], ['B', ' HD1', 159.58, 111.196, 83.022], ['B', ' HD2', 158.543, 113.085, 85.251], ['B', ' HD2', 159.209, 113.631, 83.695], ['B', ' HD2', 157.597, 114.165, 84.218]] AA_SCO= 1.9305263157894736 CA_SCO= 1.071
[['B', ' N ', 155.278, 113.172, 79.581], ['B', ' CA ', 155.157, 113.333, 78.125], ['B', ' C ', 153.727, 113.639, 77.68], ['B', ' O ', 152.786, 112.975, 78.092], ['B', ' CB ', 155.667, 112.069, 77.404], ['B', ' CG1', 157.146, 111.877, 77.65], ['B', ' CG2', 154.954, 110.84, 77.905], ['B', ' H ', 154.627, 112.564, 80.081], ['B', ' HA ', 155.788, 114.166, 77.823], ['B', ' HB ', 155.512, 112.187, 76.334], ['B', ' HG1', 157.488, 110.985, 77.118], ['B', ' HG1', 157.692, 112.747, 77.29], ['B', ' HG1', 157.333, 111.749, 78.711], ['B', ' HG2', 155.349, 109.992, 77.376], ['B', ' HG2', 155.139, 110.715, 78.962], ['B', ' HG2', 153.893, 110.901, 77.73]] AA_SCO= 1.9473684210526312 CA_SCO= 1.0715789473684212
[['B', ' N ', 153.534, 114.517, 76.702], ['B', ' CA ', 152.155, 114.828, 76.293], ['B', ' C ', 151.671, 113.814, 75.267], ['B', ' O ', 151.506, 114.119, 74.087], ['B', ' CB ', 152.117, 116.247, 75.72], ['B', ' CG ', 150.747, 116.859, 75.556], ['B', ' OD1', 149.809, 116.315, 76.06], ['B', ' OD2', 150.667, 117.95, 75.029], ['B', ' H ', 154.312, 115.006, 76.291], ['B', ' HA ', 151.506, 114.776, 77.168], ['B', ' HB ', 152.664, 116.888, 76.378], ['B', ' HB ', 152.618, 116.259, 74.751]] AA_SCO= 1.8552631578947365 CA_SCO= 0.7605789473684209
[['B', ' N ', 151.5, 112.591, 75.738], ['B', ' CA ', 151.145, 111.464, 74.902], ['B', ' C ', 150.135, 110.526, 75.512], ['B', ' O ', 150.212, 110.178, 76.695], ['B', ' CB ', 152.403, 110.656, 74.584], ['B', ' CG ', 153.479, 111.326, 73.732], ['B', ' CD1', 154.724, 110.484, 73.785], ['B', ' CD2', 152.987, 111.453, 72.297], ['B', ' H ', 151.674, 112.476, 76.733], ['B', ' HA ', 150.706, 111.852, 73.987], ['B', ' HB ', 152.863, 110.332, 75.517], ['B', ' HB ', 152.097, 109.783, 74.044], ['B', ' HG ', 153.719, 112.307, 74.128], ['B', ' HD1', 155.503, 110.947, 73.185], ['B', ' HD1', 155.063, 110.408, 74.809], ['B', ' HD1', 154.514, 109.484, 73.402], ['B', ' HD2', 153.763, 111.918, 71.692], ['B', ' HD2', 152.758, 110.462, 71.902], ['B', ' HD2', 152.096, 112.073, 72.26]] AA_SCO= 1.8905263157894738 CA_SCO= 0.7663684210526314
[['B', ' N ', 149.248, 110.046, 74.67], ['B', ' CA ', 148.27, 109.03, 74.991], ['B', ' C ', 148.039, 108.195, 73.747], ['B', ' O ', 148.329, 108.644, 72.64], ['B', ' CB ', 147.017, 109.638, 75.621], ['B', ' CG ', 146.464, 110.767, 74.921], ['B', ' CD1', 145.497, 110.792, 73.988], ['B', ' CD2', 146.841, 112.128, 75.15], ['B', ' NE1', 145.253, 112.086, 73.607], ['B', ' CE2', 146.07, 112.91, 74.316], ['B', ' CE3', 147.751, 112.737, 76.003], ['B', ' CZ2', 146.187, 114.278, 74.298], ['B', ' CZ3', 147.867, 114.078, 75.988], ['B', ' CH2', 147.115, 114.844, 75.16], ['B', ' H ', 149.25, 110.406, 73.722], ['B', ' HA ', 148.688, 108.369, 75.746], ['B', ' HB ', 146.242, 108.899, 75.653], ['B', ' HB ', 147.228, 109.934, 76.645], ['B', ' HD1', 144.983, 109.917, 73.596], ['B', ' HE1', 144.572, 112.374, 72.918], ['B', ' HE3', 148.357, 112.153, 76.681], ['B', ' HZ2', 145.584, 114.908, 73.644], ['B', ' HZ3', 148.586, 114.524, 76.663], ['B', ' HH2', 147.252, 115.928, 75.186]] AA_SCO= 1.8857894736842105 CA_SCO= 0.7658421052631578
[['B', ' N ', 147.557, 106.98, 73.972], ['B', ' CA ', 147.308, 105.883, 73.02], ['B', ' C ', 148.679, 105.19, 72.891], ['B', ' O ', 149.569, 105.662, 72.174], ['B', ' CB ', 146.711, 106.38, 71.708], ['B', ' CG ', 145.392, 107.195, 71.918], ['B', ' CD ', 144.276, 106.447, 72.614], ['B', ' OE1', 144.129, 105.289, 72.394], ['B', ' OE2', 143.585, 107.051, 73.404], ['B', ' H ', 147.364, 106.774, 74.935], ['B', ' HA ', 146.601, 105.173, 73.414], ['B', ' HB ', 147.427, 106.97, 71.143], ['B', ' HB ', 146.455, 105.515, 71.093], ['B', ' HG ', 145.608, 108.085, 72.473], ['B', ' HG ', 145.038, 107.507, 70.94]] AA_SCO= 1.8826315789473682 CA_SCO= 0.7873684210526315
[['B', ' N ', 148.824, 104.071, 73.636], ['B', ' CA ', 150.078, 103.323, 73.866], ['B', ' C ', 150.312, 101.974, 73.136], ['B', ' O ', 149.47, 101.082, 73.224], ['B', ' CB ', 150.081, 102.998, 75.379], ['B', ' CG ', 151.115, 101.949, 75.877], ['B', ' SD ', 152.783, 102.504, 76.036], ['B', ' CE ', 152.744, 102.892, 77.704], ['B', ' H ', 147.983, 103.716, 74.094], ['B', ' HA ', 150.87, 104.008, 73.642], ['B', ' HB ', 150.269, 103.922, 75.939], ['B', ' HB ', 149.098, 102.66, 75.651], ['B', ' HG ', 150.809, 101.633, 76.852], ['B', ' HG ', 151.092, 101.07, 75.277], ['B', ' HE ', 153.707, 103.286, 78.021], ['B', ' HE ', 151.957, 103.593, 77.907], ['B', ' HE ', 152.542, 101.997, 78.223]] AA_SCO= 1.7878947368421052 CA_SCO= 0.9587894736842106
[['B', ' N ', 151.46, 101.761, 72.441], ['B', ' CA ', 151.908, 100.492, 71.893], ['B', ' C ', 152.436, 99.806, 73.118], ['B', ' O ', 152.95, 100.506, 73.966], ['B', ' CB ', 153.006, 100.891, 70.916], ['B', ' CG ', 153.581, 102.143, 71.524], ['B', ' CD ', 152.402, 102.838, 72.219], ['B', ' HA ', 151.081, 99.942, 71.434], ['B', ' HB ', 153.744, 100.075, 70.835], ['B', ' HB ', 152.579, 101.046, 69.914], ['B', ' HG ', 154.383, 101.88, 72.238], ['B', ' HG ', 154.043, 102.768, 70.747], ['B', ' HD ', 152.78, 103.159, 73.171], ['B', ' HD ', 151.972, 103.65, 71.609]] AA_SCO= 1.7999999999999998 CA_SCO= 0.9441052631578947
[['B', ' N ', 152.493, 98.512, 73.218], ['B', ' CA ', 152.998, 98.05, 74.496], ['B', ' C ', 154.43, 98.48, 74.831], ['B', ' O ', 155.361, 98.34, 74.037], ['B', ' CB ', 152.905, 96.533, 74.544], ['B', ' CG ', 151.478, 96.007, 74.458], ['B', ' CD ', 150.981, 95.831, 73.062], ['B', ' OE1', 151.68, 96.225, 72.143], ['B', ' OE2', 149.887, 95.313, 72.899], ['B', ' H ', 152.161, 97.855, 72.508], ['B', ' HA ', 152.348, 98.455, 75.272], ['B', ' HB ', 153.489, 96.1, 73.733], ['B', ' HB ', 153.336, 96.177, 75.485], ['B', ' HG ', 151.414, 95.058, 74.99], ['B', ' HG ', 150.837, 96.712, 74.952]] AA_SCO= 1.7478947368421054 CA_SCO= 0.8886315789473684
[['B', ' N ', 154.576, 98.931, 76.07], ['B', ' CA ', 155.827, 99.297, 76.73], ['B', ' C ', 156.085, 98.154, 77.687], ['B', ' O ', 155.131, 97.531, 78.139], ['B', ' CB ', 155.766, 100.68, 77.378], ['B', ' CG ', 157.019, 101.098, 78.227], ['B', ' SD ', 156.884, 102.782, 78.938], ['B', ' CE ', 158.322, 102.919, 79.972], ['B', ' H ', 153.71, 99.017, 76.585], ['B', ' HA ', 156.635, 99.303, 75.997], ['B', ' HB ', 155.712, 101.405, 76.575], ['B', ' HB ', 154.872, 100.798, 77.915], ['B', ' HG ', 157.145, 100.405, 79.056], ['B', ' HG ', 157.914, 101.058, 77.607], ['B', ' HE ', 158.324, 103.891, 80.455], ['B', ' HE ', 158.295, 102.137, 80.737], ['B', ' HE ', 159.225, 102.812, 79.366]] AA_SCO= 1.7426315789473683 CA_SCO= 0.833421052631579
[['B', ' N ', 157.336, 97.856, 78.006], ['B', ' CA ', 157.567, 96.678, 78.824], ['B', ' C ', 157.357, 96.882, 80.325], ['B', ' O ', 156.726, 96.044, 80.982], ['B', ' CB ', 159.04, 96.333, 78.646], ['B', ' CG ', 159.412, 96.031, 77.199], ['B', ' OD1', 159.114, 94.977, 76.669], ['B', ' OD2', 159.961, 96.931, 76.609], ['B', ' H ', 158.116, 98.373, 77.616], ['B', ' HA ', 156.923, 95.875, 78.47], ['B', ' HB ', 159.658, 97.157, 79.001], ['B', ' HB ', 159.28, 95.462, 79.26]] AA_SCO= 1.7599999999999998 CA_SCO= 0.8343684210526315
[['B', ' N ', 157.779, 98.023, 80.856], ['B', ' CA ', 157.671, 98.262, 82.297], ['B', ' C ', 156.794, 99.402, 82.69], ['B', ' O ', 157.095, 100.552, 82.377], ['B', ' CB ', 159.047, 98.578, 82.882], ['B', ' CG ', 159.098, 99.019, 84.391], ['B', ' CD1', 158.637, 97.869, 85.325], ['B', ' CD2', 160.521, 99.492, 84.675], ['B', ' H ', 158.235, 98.7, 80.263], ['B', ' HA ', 157.269, 97.365, 82.756], ['B', ' HB ', 159.668, 97.691, 82.783], ['B', ' HB ', 159.493, 99.374, 82.288], ['B', ' HG ', 158.421, 99.859, 84.568], ['B', ' HD1', 158.689, 98.209, 86.356], ['B', ' HD1', 157.61, 97.589, 85.104], ['B', ' HD1', 159.276, 97.01, 85.197], ['B', ' HD2', 160.606, 99.82, 85.706], ['B', ' HD2', 161.218, 98.698, 84.491], ['B', ' HD2', 160.759, 100.324, 84.013]] AA_SCO= 1.7700000000000002 CA_SCO= 0.8313157894736842
[['B', ' N ', 155.775, 99.096, 83.468], ['B', ' CA ', 154.886, 100.118, 83.945], ['B', ' C ', 155.195, 100.498, 85.364], ['B', ' O ', 155.291, 99.635, 86.241], ['B', ' CB ', 153.462, 99.642, 83.87], ['B', ' H ', 155.598, 98.114, 83.701], ['B', ' HA ', 155.021, 100.994, 83.34], ['B', ' HB ', 152.817, 100.431, 84.218], ['B', ' HB ', 153.204, 99.384, 82.86], ['B', ' HB ', 153.351, 98.769, 84.497]] AA_SCO= 1.673157894736842 CA_SCO= 0.8365263157894737
[['B', ' N ', 155.317, 101.787, 85.615], ['B', ' CA ', 155.498, 102.246, 86.975], ['B', ' C ', 154.17, 102.805, 87.392], ['B', ' O ', 153.659, 103.738, 86.76], ['B', ' CB ', 156.6, 103.298, 87.061], ['B', ' CG ', 157.994, 102.863, 86.558], ['B', ' CD1', 158.955, 104.036, 86.696], ['B', ' CD2', 158.488, 101.653, 87.347], ['B', ' H ', 155.282, 102.482, 84.859], ['B', ' HA ', 155.72, 101.408, 87.634], ['B', ' HB ', 156.293, 104.163, 86.473], ['B', ' HB ', 156.698, 103.611, 88.087], ['B', ' HG ', 157.936, 102.598, 85.498], ['B', ' HD1', 159.938, 103.747, 86.331], ['B', ' HD1', 158.587, 104.877, 86.113], ['B', ' HD1', 159.028, 104.325, 87.736], ['B', ' HD2', 159.466, 101.37, 86.986], ['B', ' HD2', 158.553, 101.895, 88.397], ['B', ' HD2', 157.812, 100.82, 87.21]] AA_SCO= 1.8173684210526317 CA_SCO= 0.9250000000000002
[['B', ' N ', 153.575, 102.207, 88.405], ['B', ' CA ', 152.243, 102.633, 88.793], ['B', ' C ', 152.273, 103.332, 90.152], ['B', ' O ', 152.714, 102.78, 91.162], ['B', ' CB ', 151.297, 101.43, 88.699], ['B', ' CG1', 151.279, 100.922, 87.283], ['B', ' CG2', 151.729, 100.286, 89.607], ['B', ' H ', 154.068, 101.442, 88.887], ['B', ' HA ', 151.885, 103.364, 88.07], ['B', ' HB ', 150.311, 101.772, 88.924], ['B', ' HG1', 150.579, 100.095, 87.203], ['B', ' HG1', 150.976, 101.711, 86.63], ['B', ' HG1', 152.272, 100.579, 86.993], ['B', ' HG2', 151.04, 99.457, 89.506], ['B', ' HG2', 152.718, 99.956, 89.329], ['B', ' HG2', 151.733, 100.616, 90.622]] AA_SCO= 1.795263157894737 CA_SCO= 1.029157894736842
[['B', ' N ', 151.792, 104.569, 90.163], ['B', ' CA ', 151.91, 105.477, 91.309], ['B', ' C ', 151.143, 105.039, 92.554], ['B', ' O ', 151.612, 105.233, 93.667], ['B', ' CB ', 151.405, 106.848, 90.89], ['B', ' CG ', 152.228, 107.575, 89.748], ['B', ' CD ', 153.555, 107.981, 90.105], ['B', ' OE1', 153.744, 108.303, 91.225], ['B', ' OE2', 154.399, 108.0, 89.248], ['B', ' H ', 151.364, 104.923, 89.302], ['B', ' HA ', 152.968, 105.553, 91.575], ['B', ' HB ', 150.381, 106.746, 90.587], ['B', ' HB ', 151.402, 107.511, 91.761], ['B', ' HG ', 152.306, 106.898, 88.899], ['B', ' HG ', 151.688, 108.447, 89.417]] AA_SCO= 1.888947368421053 CA_SCO= 1.0660526315789474
[['B', ' N ', 149.978, 104.431, 92.386], ['B', ' CA ', 149.23, 103.966, 93.554], ['B', ' C ', 147.928, 104.635, 93.901], ['B', ' O ', 147.416, 105.45, 93.146], ['B', ' H ', 149.635, 104.308, 91.447], ['B', ' HA ', 149.018, 102.917, 93.411], ['B', ' HA ', 149.878, 104.038, 94.418]] AA_SCO= 2.0310526315789477 CA_SCO= 1.2144736842105264
[['B', ' N ', 147.379, 104.224, 95.052], ['B', ' CA ', 146.099, 104.688, 95.572], ['B', ' C ', 144.939, 104.52, 94.619], ['B', ' O ', 144.385, 105.503, 94.128], ['B', ' CB ', 146.209, 106.127, 96.019], ['B', ' OG ', 147.153, 106.246, 97.039], ['B', ' H ', 147.9, 103.558, 95.62], ['B', ' HA ', 145.873, 104.089, 96.457], ['B', ' HB ', 146.497, 106.754, 95.181], ['B', ' HB ', 145.242, 106.477, 96.373], ['B', ' HG ', 147.105, 107.154, 97.339]] AA_SCO= 2.068421052631579 CA_SCO= 1.488842105263158
[['B', ' N ', 144.578, 103.28, 94.318], ['B', ' CA ', 143.52, 103.069, 93.355], ['B', ' C ', 142.212, 103.281, 94.018], ['B', ' O ', 141.914, 102.636, 95.013], ['B', ' CB ', 143.517, 101.636, 92.854], ['B', ' CG1', 142.361, 101.39, 91.857], ['B', ' CG2', 144.779, 101.365, 92.305], ['B', ' H ', 145.002, 102.489, 94.808], ['B', ' HA ', 143.632, 103.77, 92.529], ['B', ' HB ', 143.36, 100.975, 93.679], ['B', ' HG1', 142.392, 100.354, 91.533], ['B', ' HG1', 141.396, 101.58, 92.327], ['B', ' HG1', 142.473, 102.04, 90.991], ['B', ' HG2', 144.793, 100.338, 91.965], ['B', ' HG2', 144.953, 102.045, 91.491], ['B', ' HG2', 145.543, 101.509, 93.061]] AA_SCO= 2.08 CA_SCO= 1.497157894736842
[['B', ' N ', 141.403, 104.154, 93.481], ['B', ' CA ', 140.146, 104.373, 94.13], ['B', ' C ', 139.125, 103.461, 93.512], ['B', ' O ', 139.065, 103.31, 92.296], ['B', ' CB ', 139.671, 105.783, 93.992], ['B', ' SG ', 138.285, 106.092, 95.03], ['B', ' H ', 141.68, 104.687, 92.669], ['B', ' HA ', 140.227, 104.145, 95.188], ['B', ' HB ', 140.446, 106.466, 94.204], ['B', ' HB ', 139.363, 105.953, 92.968], ['B', ' HG ', 137.543, 105.047, 94.626]] AA_SCO= 2.0426315789473684 CA_SCO= 1.4982105263157894
[['B', ' N ', 138.32, 102.858, 94.344], ['B', ' CA ', 137.25, 102.013, 93.881], ['B', ' C ', 136.154, 102.984, 93.549], ['B', ' O ', 136.325, 104.172, 93.794], ['B', ' CB ', 136.822, 101.022, 94.945], ['B', ' CG ', 137.921, 100.094, 95.466], ['B', ' CD1', 137.316, 99.185, 96.489], ['B', ' CD2', 138.576, 99.324, 94.335], ['B', ' H ', 138.438, 103.015, 95.35], ['B', ' HA ', 137.539, 101.5, 92.968], ['B', ' HB ', 136.445, 101.59, 95.799], ['B', ' HB ', 136.016, 100.407, 94.553], ['B', ' HG ', 138.685, 100.69, 95.974], ['B', ' HD1', 138.085, 98.538, 96.904], ['B', ' HD1', 136.881, 99.777, 97.282], ['B', ' HD1', 136.542, 98.575, 96.029], ['B', ' HD2', 139.343, 98.679, 94.748], ['B', ' HD2', 137.835, 98.718, 93.815], ['B', ' HD2', 139.04, 100.014, 93.642]] AA_SCO= 2.123684210526316 CA_SCO= 1.4982105263157894
[['B', ' N ', 135.096, 102.553, 92.879], ['B', ' CA ', 133.994, 103.44, 92.448], ['B', ' C ', 134.384, 104.201, 91.174], ['B', ' O ', 133.627, 104.24, 90.209], ['B', ' CB ', 133.59, 104.48, 93.518], ['B', ' CG ', 133.147, 103.906, 94.856], ['B', ' CD ', 131.964, 103.021, 94.725], ['B', ' OE1', 130.997, 103.346, 94.032], ['B', ' NE2', 132.013, 101.873, 95.387], ['B', ' H ', 135.016, 101.565, 92.682], ['B', ' HA ', 133.124, 102.826, 92.213], ['B', ' HB ', 134.333, 105.251, 93.665], ['B', ' HB ', 132.717, 105.006, 93.141], ['B', ' HG ', 133.962, 103.339, 95.301], ['B', ' HG ', 132.883, 104.737, 95.517], ['B', ' HE2', 131.242, 101.233, 95.339], ['B', ' HE2', 132.81, 101.651, 95.946]] AA_SCO= 2.2126315789473683 CA_SCO= 1.7989473684210526
[['B', ' N ', 135.577, 104.774, 91.181], ['B', ' CA ', 136.14, 105.555, 90.094], ['B', ' C ', 136.586, 104.673, 88.945], ['B', ' O ', 137.596, 103.956, 89.028], ['B', ' CB ', 137.347, 106.321, 90.618], ['B', ' CG ', 138.02, 107.232, 89.612], ['B', ' OD1', 137.835, 107.047, 88.418], ['B', ' OD2', 138.751, 108.088, 90.032], ['B', ' H ', 136.091, 104.695, 92.051], ['B', ' HA ', 135.381, 106.251, 89.729], ['B', ' HB ', 137.041, 106.905, 91.452], ['B', ' HB ', 138.083, 105.6, 90.981]] AA_SCO= 2.227368421052631 CA_SCO= 1.7896842105263158
[['B', ' N ', 135.823, 104.747, 87.866], ['B', ' CA ', 136.02, 103.91, 86.713], ['B', ' C ', 137.244, 104.276, 85.913], ['B', ' O ', 137.665, 103.494, 85.062], ['B', ' CB ', 134.79, 103.97, 85.8], ['B', ' CG ', 134.566, 105.313, 85.042], ['B', ' CD ', 133.841, 106.374, 85.843], ['B', ' OE1', 133.852, 106.303, 87.05], ['B', ' OE2', 133.274, 107.253, 85.243], ['B', ' H ', 135.023, 105.39, 87.872], ['B', ' HA ', 136.136, 102.887, 87.062], ['B', ' HB ', 134.863, 103.18, 85.052], ['B', ' HB ', 133.897, 103.773, 86.393], ['B', ' HG ', 135.51, 105.724, 84.698], ['B', ' HG ', 133.974, 105.095, 84.155]] AA_SCO= 2.2210526315789476 CA_SCO= 1.7902105263157893
[['B', ' N ', 137.825, 105.457, 86.126], ['B', ' CA ', 138.949, 105.792, 85.28], ['B', ' C ', 140.146, 105.002, 85.722], ['B', ' O ', 140.787, 104.334, 84.913], ['B', ' CB ', 139.306, 107.279, 85.345], ['B', ' CG ', 138.315, 108.208, 84.721], ['B', ' ND1', 137.971, 108.143, 83.39], ['B', ' CD2', 137.618, 109.253, 85.244], ['B', ' CE1', 137.098, 109.098, 83.114], ['B', ' NE2', 136.867, 109.798, 84.219], ['B', ' H ', 137.512, 106.084, 86.884], ['B', ' HA ', 138.731, 105.531, 84.246], ['B', ' HB ', 139.418, 107.572, 86.394], ['B', ' HB ', 140.272, 107.436, 84.862], ['B', ' HD1', 138.32, 107.486, 82.72], ['B', ' HD2', 137.579, 109.685, 86.248], ['B', ' HE1', 136.701, 109.207, 82.105]] AA_SCO= 2.2184210526315793 CA_SCO= 1.7902631578947368
[['B', ' N ', 140.398, 104.984, 87.025], ['B', ' CA ', 141.554, 104.271, 87.514], ['B', ' C ', 141.367, 102.781, 87.371], ['B', ' O ', 142.305, 102.07, 87.002], ['B', ' CB ', 141.823, 104.62, 88.962], ['B', ' OG ', 142.208, 105.964, 89.091], ['B', ' H ', 139.83, 105.539, 87.661], ['B', ' HA ', 142.419, 104.569, 86.919], ['B', ' HB ', 140.92, 104.437, 89.554], ['B', ' HB ', 142.608, 103.975, 89.35], ['B', ' HG ', 142.438, 106.085, 90.016]] AA_SCO= 2.2536842105263157 CA_SCO= 1.7867368421052627
[['B', ' N ', 140.153, 102.292, 87.606], ['B', ' CA ', 139.955, 100.864, 87.51], ['B', ' C ', 140.129, 100.403, 86.071], ['B', ' O ', 140.771, 99.379, 85.806], ['B', ' CB ', 138.538, 100.552, 87.979], ['B', ' CG ', 138.244, 100.814, 89.479], ['B', ' CD1', 136.753, 100.73, 89.713], ['B', ' CD2', 138.966, 99.816, 90.336], ['B', ' H ', 139.384, 102.9, 87.915], ['B', ' HA ', 140.698, 100.362, 88.122], ['B', ' HB ', 137.849, 101.158, 87.398], ['B', ' HB ', 138.331, 99.505, 87.772], ['B', ' HG ', 138.576, 101.817, 89.753], ['B', ' HD1', 136.544, 100.932, 90.757], ['B', ' HD1', 136.251, 101.478, 89.099], ['B', ' HD1', 136.391, 99.739, 89.452], ['B', ' HD2', 138.743, 100.025, 91.368], ['B', ' HD2', 138.646, 98.806, 90.09], ['B', ' HD2', 140.023, 99.909, 90.184]] AA_SCO= 2.2268421052631577 CA_SCO= 1.8208421052631578
[['B', ' N ', 139.6, 101.179, 85.126], ['B', ' CA ', 139.689, 100.814, 83.734], ['B', ' C ', 141.112, 100.861, 83.239], ['B', ' O ', 141.596, 99.914, 82.602], ['B', ' CB ', 138.858, 101.755, 82.873], ['B', ' CG ', 138.884, 101.357, 81.485], ['B', ' ND1', 138.113, 100.324, 80.996], ['B', ' CD2', 139.636, 101.783, 80.461], ['B', ' CE1', 138.391, 100.147, 79.724], ['B', ' NE2', 139.311, 101.012, 79.383], ['B', ' H ', 139.065, 102.021, 85.349], ['B', ' HA ', 139.318, 99.801, 83.598], ['B', ' HB ', 137.825, 101.754, 83.215], ['B', ' HB ', 139.24, 102.775, 82.962], ['B', ' HD2', 140.391, 102.57, 80.488], ['B', ' HE1', 137.955, 99.395, 79.071], ['B', ' HE2', 139.762, 101.081, 78.461]] AA_SCO= 2.2578947368421054 CA_SCO= 1.8463684210526314
[['B', ' N ', 141.792, 101.97, 83.525], ['B', ' CA ', 143.127, 102.162, 83.026], ['B', ' C ', 144.065, 101.099, 83.559], ['B', ' O ', 144.847, 100.546, 82.786], ['B', ' CB ', 143.6, 103.56, 83.396], ['B', ' CG ', 142.905, 104.694, 82.641], ['B', ' CD ', 143.332, 106.092, 83.119], ['B', ' OE1', 144.247, 106.189, 83.905], ['B', ' OE2', 142.743, 107.072, 82.688], ['B', ' H ', 141.355, 102.72, 84.071], ['B', ' HA ', 143.101, 102.079, 81.937], ['B', ' HB ', 143.426, 103.721, 84.462], ['B', ' HB ', 144.637, 103.646, 83.227], ['B', ' HG ', 143.162, 104.599, 81.585], ['B', ' HG ', 141.829, 104.588, 82.72]] AA_SCO= 2.27 CA_SCO= 1.8920526315789472
[['B', ' N ', 143.938, 100.714, 84.832], ['B', ' CA ', 144.809, 99.667, 85.324], ['B', ' C ', 144.575, 98.345, 84.656], ['B', ' O ', 145.533, 97.6, 84.431], ['B', ' CB ', 144.669, 99.477, 86.815], ['B', ' CG ', 145.266, 100.52, 87.677], ['B', ' CD1', 144.836, 100.301, 89.034], ['B', ' CD2', 146.833, 100.431, 87.624], ['B', ' H ', 143.278, 101.178, 85.466], ['B', ' HA ', 145.824, 99.963, 85.1], ['B', ' HB ', 143.599, 99.428, 87.044], ['B', ' HB ', 145.105, 98.556, 87.072], ['B', ' HG ', 144.925, 101.493, 87.37], ['B', ' HD1', 145.285, 101.062, 89.616], ['B', ' HD1', 143.749, 100.373, 89.094], ['B', ' HD1', 145.16, 99.327, 89.38], ['B', ' HD2', 147.258, 101.192, 88.28], ['B', ' HD2', 147.158, 99.449, 87.955], ['B', ' HD2', 147.204, 100.603, 86.625]] AA_SCO= 2.2531578947368422 CA_SCO= 1.888157894736842
[['B', ' N ', 143.333, 98.002, 84.346], ['B', ' CA ', 143.158, 96.729, 83.687], ['B', ' C ', 143.862, 96.749, 82.33], ['B', ' O ', 144.568, 95.793, 81.985], ['B', ' CB ', 141.68, 96.408, 83.565], ['B', ' CG ', 141.04, 96.073, 84.908], ['B', ' CD ', 139.557, 95.799, 84.776], ['B', ' CE ', 138.927, 95.512, 86.132], ['B', ' NZ ', 137.457, 95.256, 86.018], ['B', ' H ', 142.531, 98.593, 84.601], ['B', ' HA ', 143.627, 95.956, 84.293], ['B', ' HB ', 141.156, 97.275, 83.148], ['B', ' HB ', 141.538, 95.57, 82.885], ['B', ' HG ', 141.531, 95.193, 85.328], ['B', ' HG ', 141.192, 96.901, 85.597], ['B', ' HD ', 139.071, 96.675, 84.337], ['B', ' HD ', 139.397, 94.945, 84.119], ['B', ' HE ', 139.407, 94.64, 86.574], ['B', ' HE ', 139.087, 96.373, 86.787], ['B', ' HZ ', 137.073, 95.072, 86.935], ['B', ' HZ ', 137.003, 96.067, 85.62], ['B', ' HZ ', 137.297, 94.456, 85.422]] AA_SCO= 2.2742105263157897 CA_SCO= 1.890736842105263
[['B', ' N ', 143.753, 97.865, 81.597], ['B', ' CA ', 144.43, 97.947, 80.303], ['B', ' C ', 145.944, 97.912, 80.476], ['B', ' O ', 146.649, 97.262, 79.698], ['B', ' CB ', 144.022, 99.207, 79.545], ['B', ' CG ', 142.589, 99.191, 79.016], ['B', ' CD ', 142.217, 100.472, 78.336], ['B', ' OE1', 142.912, 101.422, 78.536], ['B', ' OE2', 141.231, 100.505, 77.614], ['B', ' H ', 143.144, 98.628, 81.925], ['B', ' HA ', 144.137, 97.079, 79.709], ['B', ' HB ', 144.124, 100.073, 80.205], ['B', ' HB ', 144.694, 99.36, 78.698], ['B', ' HG ', 142.479, 98.368, 78.311], ['B', ' HG ', 141.908, 99.016, 79.853]] AA_SCO= 2.3710526315789475 CA_SCO= 1.890578947368421
[['B', ' N ', 146.438, 98.563, 81.523], ['B', ' CA ', 147.855, 98.597, 81.799], ['B', ' C ', 148.381, 97.206, 82.004], ['B', ' O ', 149.407, 96.852, 81.431], ['B', ' CB ', 148.123, 99.429, 83.057], ['B', ' CG ', 149.581, 99.667, 83.46], ['B', ' CD1', 149.692, 101.036, 84.089], ['B', ' CD2', 150.004, 98.615, 84.497], ['B', ' H ', 145.799, 99.106, 82.11], ['B', ' HA ', 148.364, 99.046, 80.948], ['B', ' HB ', 147.612, 100.373, 82.983], ['B', ' HB ', 147.67, 98.901, 83.886], ['B', ' HG ', 150.228, 99.62, 82.591], ['B', ' HD1', 150.708, 101.223, 84.384], ['B', ' HD1', 149.398, 101.797, 83.385], ['B', ' HD1', 149.047, 101.088, 84.96], ['B', ' HD2', 151.012, 98.802, 84.805], ['B', ' HD2', 149.352, 98.68, 85.367], ['B', ' HD2', 149.95, 97.62, 84.095]] AA_SCO= 2.3547368421052632 CA_SCO= 1.880947368421053
[['B', ' N ', 147.7, 96.405, 82.82], ['B', ' CA ', 148.182, 95.061, 83.081], ['B', ' C ', 148.223, 94.209, 81.845], ['B', ' O ', 149.135, 93.392, 81.7], ['B', ' CB ', 147.346, 94.372, 84.116], ['B', ' CG ', 147.723, 92.876, 84.406], ['B', ' CD ', 149.064, 92.667, 85.087], ['B', ' NE ', 150.17, 92.561, 84.13], ['B', ' CZ ', 151.474, 92.36, 84.451], ['B', ' NH1', 151.862, 92.207, 85.729], ['B', ' NH2', 152.363, 92.318, 83.476], ['B', ' H ', 146.864, 96.763, 83.299], ['B', ' HA ', 149.195, 95.147, 83.47], ['B', ' HB ', 147.411, 94.95, 85.006], ['B', ' HB ', 146.301, 94.397, 83.797], ['B', ' HG ', 146.968, 92.467, 85.071], ['B', ' HG ', 147.718, 92.296, 83.485], ['B', ' HD ', 149.276, 93.502, 85.746], ['B', ' HD ', 149.027, 91.748, 85.672], ['B', ' HE ', 149.945, 92.67, 83.122], ['B', ' HH1', 151.175, 92.216, 86.501], ['B', ' HH1', 152.86, 92.079, 85.979], ['B', ' HH2', 152.086, 92.462, 82.488], ['B', ' HH2', 153.353, 92.143, 83.67]] AA_SCO= 2.434736842105263 CA_SCO= 1.8752105263157894
[['B', ' N ', 147.241, 94.374, 80.967], ['B', ' CA ', 147.208, 93.611, 79.736], ['B', ' C ', 148.379, 93.953, 78.825], ['B', ' O ', 148.886, 93.091, 78.104], ['B', ' CB ', 145.908, 93.863, 78.978], ['B', ' CG ', 144.669, 93.288, 79.626], ['B', ' CD ', 143.417, 93.646, 78.876], ['B', ' OE1', 143.513, 94.412, 77.946], ['B', ' OE2', 142.37, 93.16, 79.228], ['B', ' H ', 146.47, 95.017, 81.19], ['B', ' HA ', 147.268, 92.553, 79.989], ['B', ' HB ', 145.759, 94.938, 78.876], ['B', ' HB ', 145.989, 93.45, 77.974], ['B', ' HG ', 144.763, 92.204, 79.659], ['B', ' HG ', 144.599, 93.648, 80.647]] AA_SCO= 2.441052631578947 CA_SCO= 1.8502105263157893
[['B', ' N ', 148.795, 95.215, 78.835], ['B', ' CA ', 149.847, 95.665, 77.944], ['B', ' C ', 151.269, 95.59, 78.516], ['B', ' O ', 152.221, 95.357, 77.77], ['B', ' CB ', 149.48, 97.073, 77.544], ['B', ' CG ', 148.195, 97.053, 76.732], ['B', ' CD ', 147.65, 98.389, 76.452], ['B', ' CE ', 148.372, 99.049, 75.36], ['B', ' NZ ', 147.71, 100.245, 74.997], ['B', ' H ', 148.309, 95.893, 79.432], ['B', ' HA ', 149.822, 95.035, 77.057], ['B', ' HB ', 149.309, 97.668, 78.448], ['B', ' HB ', 150.289, 97.533, 76.993], ['B', ' HG ', 148.386, 96.54, 75.787], ['B', ' HG ', 147.432, 96.492, 77.267], ['B', ' HD ', 146.597, 98.302, 76.186], ['B', ' HD ', 147.724, 99.009, 77.35], ['B', ' HE ', 149.388, 99.289, 75.662], ['B', ' HE ', 148.407, 98.392, 74.489], ['B', ' HZ ', 148.226, 100.658, 74.233], ['B', ' HZ ', 146.775, 100.05, 74.702], ['B', ' HZ ', 147.673, 100.878, 75.783]] AA_SCO= 2.3926315789473684 CA_SCO= 1.8274736842105264
[['B', ' N ', 151.416, 95.762, 79.825], ['B', ' CA ', 152.707, 95.734, 80.501], ['B', ' C ', 153.213, 94.314, 80.61], ['B', ' O ', 152.437, 93.36, 80.713], ['B', ' CB ', 152.588, 96.336, 81.888], ['B', ' H ', 150.59, 95.964, 80.385], ['B', ' HA ', 153.428, 96.299, 79.912], ['B', ' HB ', 153.557, 96.316, 82.373], ['B', ' HB ', 152.235, 97.357, 81.821], ['B', ' HB ', 151.875, 95.749, 82.458]] AA_SCO= 2.417368421052632 CA_SCO= 1.8215263157894739
[['B', ' N ', 154.524, 94.154, 80.656], ['B', ' CA ', 155.068, 92.841, 80.903], ['B', ' C ', 155.361, 92.817, 82.376], ['B', ' O ', 155.053, 91.86, 83.087], ['B', ' CB ', 156.315, 92.63, 80.079], ['B', ' CG ', 156.025, 92.567, 78.613], ['B', ' CD ', 157.278, 92.443, 77.824], ['B', ' CE ', 156.996, 92.46, 76.338], ['B', ' NZ ', 158.243, 92.555, 75.57], ['B', ' H ', 155.161, 94.947, 80.574], ['B', ' HA ', 154.33, 92.073, 80.671], ['B', ' HB ', 157.013, 93.452, 80.255], ['B', ' HB ', 156.806, 91.705, 80.382], ['B', ' HG ', 155.381, 91.712, 78.409], ['B', ' HG ', 155.497, 93.475, 78.309], ['B', ' HD ', 157.943, 93.272, 78.064], ['B', ' HD ', 157.781, 91.512, 78.079], ['B', ' HE ', 156.471, 91.55, 76.056], ['B', ' HE ', 156.371, 93.323, 76.101], ['B', ' HZ ', 158.05, 92.586, 74.585], ['B', ' HZ ', 158.695, 93.438, 75.867], ['B', ' HZ ', 158.845, 91.777, 75.773]] AA_SCO= 2.4647368421052636 CA_SCO= 1.8206315789473684
[['B', ' N ', 155.858, 93.937, 82.846], ['B', ' CA ', 156.178, 94.107, 84.233], ['B', ' C ', 155.378, 95.247, 84.777], ['B', ' O ', 155.295, 96.306, 84.145], ['B', ' CB ', 157.64, 94.487, 84.381], ['B', ' CG ', 158.666, 93.543, 83.854], ['B', ' CD1', 159.976, 94.237, 83.928], ['B', ' CD2', 158.692, 92.28, 84.692], ['B', ' H ', 156.073, 94.694, 82.199], ['B', ' HA ', 155.933, 93.206, 84.797], ['B', ' HB ', 157.788, 95.42, 83.87], ['B', ' HB ', 157.839, 94.639, 85.442], ['B', ' HG ', 158.454, 93.294, 82.815], ['B', ' HD1', 160.762, 93.582, 83.554], ['B', ' HD1', 159.948, 95.147, 83.328], ['B', ' HD1', 160.166, 94.49, 84.966], ['B', ' HD2', 159.46, 91.607, 84.317], ['B', ' HD2', 158.906, 92.529, 85.735], ['B', ' HD2', 157.725, 91.777, 84.644]] AA_SCO= 2.4763157894736842 CA_SCO= 1.822473684210527
[['B', ' N ', 154.795, 95.046, 85.931], ['B', ' CA ', 154.116, 96.134, 86.588], ['B', ' C ', 154.793, 96.279, 87.916], ['B', ' O ', 154.901, 95.312, 88.677], ['B', ' CB ', 152.612, 95.881, 86.737], ['B', ' CG1', 151.955, 97.035, 87.479], ['B', ' CG2', 152.008, 95.75, 85.364], ['B', ' H ', 154.859, 94.114, 86.38], ['B', ' HA ', 154.261, 97.057, 86.027], ['B', ' HB ', 152.45, 94.967, 87.307], ['B', ' HG1', 150.887, 96.847, 87.572], ['B', ' HG1', 152.384, 97.141, 88.474], ['B', ' HG1', 152.114, 97.958, 86.924], ['B', ' HG2', 150.941, 95.566, 85.448], ['B', ' HG2', 152.18, 96.664, 84.815], ['B', ' HG2', 152.473, 94.934, 84.837]] AA_SCO= 2.4242105263157896 CA_SCO= 1.805578947368421
[['B', ' N ', 155.275, 97.473, 88.186], ['B', ' CA ', 155.945, 97.69, 89.428], ['B', ' C ', 155.269, 98.729, 90.251], ['B', ' O ', 155.164, 99.895, 89.851], ['B', ' CB ', 157.387, 98.121, 89.207], ['B', ' SG ', 158.332, 98.358, 90.732], ['B', ' H ', 155.182, 98.236, 87.508], ['B', ' HA ', 155.929, 96.773, 89.988], ['B', ' HB ', 157.899, 97.389, 88.603], ['B', ' HB ', 157.39, 99.056, 88.662], ['B', ' HG ', 157.447, 99.185, 91.348]] AA_SCO= 2.383684210526315 CA_SCO= 1.806263157894737
[['B', ' N ', 154.829, 98.32, 91.421], ['B', ' CA ', 154.218, 99.283, 92.288], ['B', ' C ', 155.306, 100.304, 92.434], ['B', ' O ', 156.454, 99.926, 92.67], ['B', ' CB ', 153.799, 98.632, 93.579], ['B', ' H ', 154.948, 97.33, 91.669], ['B', ' HA ', 153.368, 99.743, 91.807], ['B', ' HB ', 153.4, 99.326, 94.258], ['B', ' HB ', 153.053, 97.869, 93.366], ['B', ' HB ', 154.633, 98.194, 94.025]] AA_SCO= 2.453157894736842 CA_SCO= 1.8131052631578946
[['B', ' N ', 155.008, 101.579, 92.311], ['B', ' CA ', 156.084, 102.541, 92.345], ['B', ' C ', 155.963, 103.524, 93.458], ['B', ' O ', 155.992, 104.728, 93.253], ['B', ' CB ', 156.143, 103.241, 91.013], ['B', ' CG ', 157.347, 103.996, 90.817], ['B', ' CD1', 158.566, 103.35, 90.788], ['B', ' CD2', 157.303, 105.344, 90.631], ['B', ' CE1', 159.703, 104.046, 90.584], ['B', ' CE2', 158.442, 106.037, 90.429], ['B', ' CZ ', 159.635, 105.396, 90.405], ['B', ' H ', 154.057, 101.902, 92.125], ['B', ' HA ', 157.016, 102.007, 92.495], ['B', ' HB ', 156.066, 102.5, 90.218], ['B', ' HB ', 155.289, 103.917, 90.919], ['B', ' HD1', 158.611, 102.268, 90.926], ['B', ' HD2', 156.335, 105.871, 90.655], ['B', ' HE1', 160.664, 103.533, 90.558], ['B', ' HE2', 158.398, 107.115, 90.287], ['B', ' HZ ', 160.524, 105.969, 90.239]] AA_SCO= 2.434736842105263 CA_SCO= 1.8128421052631585
[['B', ' N ', 155.819, 102.984, 94.631], ['B', ' CA ', 155.725, 103.728, 95.86], ['B', ' C ', 154.921, 102.901, 96.802], ['B', ' O ', 154.222, 101.975, 96.389], ['B', ' H ', 155.761, 101.973, 94.652], ['B', ' HA ', 156.719, 103.91, 96.272], ['B', ' HA ', 155.244, 104.689, 95.689]] AA_SCO= 2.325263157894737 CA_SCO= 1.8127368421052636
[['B', ' N ', 154.936, 103.244, 98.07], ['B', ' CA ', 154.163, 102.442, 99.009], ['B', ' C ', 152.673, 102.466, 98.73], ['B', ' O ', 152.025, 101.44, 98.858], ['B', ' CB ', 154.428, 102.876, 100.433], ['B', ' OG ', 155.743, 102.573, 100.819], ['B', ' H ', 155.494, 104.035, 98.406], ['B', ' HA ', 154.484, 101.404, 98.914], ['B', ' HB ', 154.268, 103.947, 100.522], ['B', ' HB ', 153.72, 102.383, 101.101], ['B', ' HG ', 155.845, 102.947, 101.704]] AA_SCO= 2.3389473684210524 CA_SCO= 1.8179473684210528
[['B', ' N ', 152.125, 103.579, 98.217], ['B', ' CA ', 150.709, 103.762, 97.958], ['B', ' C ', 150.184, 102.803, 96.886], ['B', ' O ', 148.978, 102.596, 96.752], ['B', ' CB ', 150.401, 105.228, 97.615], ['B', ' SG ', 150.412, 106.392, 99.069], ['B', ' H ', 152.75, 104.369, 98.066], ['B', ' HA ', 150.189, 103.543, 98.882], ['B', ' HB ', 151.127, 105.604, 96.879], ['B', ' HB ', 149.419, 105.308, 97.147]] AA_SCO= 2.3757894736842107 CA_SCO= 1.8183157894736843
[['B', ' N ', 151.093, 102.217, 96.116], ['B', ' CA ', 150.762, 101.266, 95.078], ['B', ' C ', 150.777, 99.809, 95.567], ['B', ' O ', 150.195, 98.936, 94.917], ['B', ' CB ', 151.738, 101.484, 93.945], ['B', ' H ', 152.087, 102.395, 96.281], ['B', ' HA ', 149.753, 101.449, 94.745], ['B', ' HB ', 151.527, 100.81, 93.134], ['B', ' HB ', 151.678, 102.494, 93.592], ['B', ' HB ', 152.735, 101.326, 94.308]] AA_SCO= 2.38578947368421 CA_SCO= 1.8478947368421057
[['B', ' N ', 151.414, 99.544, 96.703], ['B', ' CA ', 151.58, 98.218, 97.296], ['B', ' C ', 151.699, 98.446, 98.783], ['B', ' O ', 152.798, 98.68, 99.282], ['B', ' CB ', 152.778, 97.466, 96.751], ['B', ' H ', 151.79, 100.316, 97.262], ['B', ' HA ', 150.693, 97.623, 97.107], ['B', ' HB ', 152.849, 96.492, 97.259], ['B', ' HB ', 152.654, 97.307, 95.696], ['B', ' HB ', 153.679, 98.038, 96.94]] AA_SCO= 2.3847368421052635 CA_SCO= 1.8577368421052634
[['B', ' N ', 150.552, 98.371, 99.451], ['B', ' CA ', 150.314, 98.782, 100.826], ['B', ' C ', 149.978, 100.236, 100.818], ['B', ' O ', 150.817, 101.09, 101.082], ['B', ' CB ', 151.484, 98.536, 101.779], ['B', ' OG1', 151.802, 97.137, 101.816], ['B', ' CG2', 151.078, 98.976, 103.13], ['B', ' H ', 149.753, 98.079, 98.922], ['B', ' HA ', 149.45, 98.261, 101.209], ['B', ' HB ', 152.353, 99.113, 101.502], ['B', ' HG1', 152.048, 96.811, 100.91], ['B', ' HG2', 151.86, 98.816, 103.798], ['B', ' HG2', 150.833, 100.02, 103.161], ['B', ' HG2', 150.224, 98.424, 103.423]] AA_SCO= 2.41421052631579 CA_SCO= 1.8573157894736843
[['B', ' N ', 148.714, 100.519, 100.545], ['B', ' CA ', 148.323, 101.885, 100.38], ['B', ' C ', 148.773, 102.654, 101.605], ['B', ' O ', 148.398, 102.282, 102.714], ['B', ' H ', 148.046, 99.784, 100.418], ['B', ' HA ', 148.711, 102.263, 99.45], ['B', ' HA ', 147.241, 101.934, 100.295]] AA_SCO= 2.4473684210526314 CA_SCO= 1.857263157894737
[['B', ' N ', 149.52, 103.744, 101.402], ['B', ' CA ', 150.062, 104.59, 102.428], ['B', ' C ', 149.132, 105.758, 102.472], ['B', ' O ', 148.628, 106.184, 101.437], ['B', ' CB ', 151.542, 104.952, 102.092], ['B', ' SG ', 152.036, 106.001, 100.493], ['B', ' H ', 149.743, 104.001, 100.457], ['B', ' HA ', 150.052, 104.068, 103.387], ['B', ' HB ', 151.965, 105.479, 102.958], ['B', ' HB ', 152.1, 104.015, 102.031]] AA_SCO= 2.46578947368421 CA_SCO= 1.856
[['B', ' N ', 148.867, 106.289, 103.656], ['B', ' CA ', 147.98, 107.442, 103.863], ['B', ' C ', 146.516, 107.1, 103.522], ['B', ' O ', 145.647, 107.09, 104.38], ['B', ' CB ', 148.438, 108.641, 103.025], ['B', ' CG ', 149.784, 109.181, 103.418], ['B', ' CD1', 150.946, 108.645, 102.893], ['B', ' CD2', 149.9, 110.248, 104.251], ['B', ' CE1', 152.191, 109.163, 103.209], ['B', ' CE2', 151.145, 110.773, 104.575], ['B', ' CZ ', 152.289, 110.235, 104.059], ['B', ' H ', 149.343, 105.876, 104.457], ['B', ' HA ', 148.027, 107.724, 104.917], ['B', ' HB ', 148.458, 108.427, 101.969], ['B', ' HB ', 147.715, 109.446, 103.161], ['B', ' HD1', 150.871, 107.821, 102.214], ['B', ' HD2', 149.0, 110.692, 104.651], ['B', ' HE1', 153.086, 108.719, 102.774], ['B', ' HE2', 151.214, 111.617, 105.231], ['B', ' HZ ', 153.26, 110.658, 104.314]] AA_SCO= 2.4784210526315786 CA_SCO= 1.8484210526315792
[['B', ' N ', 146.274, 106.681, 102.294], ['B', ' CA ', 144.99, 106.38, 101.703], ['B', ' C ', 144.213, 105.305, 102.432], ['B', ' O ', 142.985, 105.325, 102.439], ['B', ' CB ', 145.21, 105.992, 100.232], ['B', ' OG1', 143.986, 106.007, 99.561], ['B', ' CG2', 145.818, 104.601, 100.104], ['B', ' H ', 147.06, 106.662, 101.672], ['B', ' HA ', 144.39, 107.292, 101.723], ['B', ' HB ', 145.889, 106.714, 99.773], ['B', ' HG1', 143.663, 106.912, 99.498], ['B', ' HG2', 145.97, 104.377, 99.049], ['B', ' HG2', 146.77, 104.582, 100.615], ['B', ' HG2', 145.16, 103.851, 100.527]] AA_SCO= 2.5089473684210524 CA_SCO= 1.8428421052631585
[['B', ' N ', 144.879, 104.402, 103.133], ['B', ' CA ', 144.158, 103.373, 103.858], ['B', ' C ', 143.398, 103.937, 105.059], ['B', ' O ', 142.601, 103.223, 105.674], ['B', ' CB ', 145.08, 102.251, 104.279], ['B', ' CG ', 145.603, 101.353, 103.155], ['B', ' CD ', 144.567, 100.416, 102.623], ['B', ' NE ', 144.034, 99.556, 103.681], ['B', ' CZ ', 144.574, 98.386, 104.119], ['B', ' NH1', 145.663, 97.892, 103.575], ['B', ' NH2', 143.987, 97.738, 105.12], ['B', ' H ', 145.892, 104.386, 103.13], ['B', ' HA ', 143.418, 102.954, 103.18], ['B', ' HB ', 145.968, 102.7, 104.704], ['B', ' HB ', 144.617, 101.639, 105.048], ['B', ' HG ', 145.904, 101.987, 102.333], ['B', ' HG ', 146.46, 100.776, 103.508], ['B', ' HD ', 143.741, 100.969, 102.18], ['B', ' HD ', 145.013, 99.789, 101.857], ['B', ' HE ', 143.19, 99.876, 104.142], ['B', ' HH1', 146.115, 98.362, 102.812], ['B', ' HH1', 146.043, 97.012, 103.915], ['B', ' HH2', 143.15, 98.113, 105.543], ['B', ' HH2', 144.392, 96.857, 105.49]] AA_SCO= 2.457894736842105 CA_SCO= 1.8512105263157896
[['B', ' N ', 143.621, 105.218, 105.374], ['B', ' CA ', 142.924, 105.902, 106.447], ['B', ' C ', 141.741, 106.701, 105.893], ['B', ' O ', 141.063, 107.398, 106.65], ['B', ' CB ', 143.852, 106.86, 107.192], ['B', ' CG ', 144.923, 106.244, 108.008], ['B', ' CD1', 146.129, 105.953, 107.448], ['B', ' CD2', 144.72, 106.024, 109.344], ['B', ' CE1', 147.123, 105.437, 108.204], ['B', ' CE2', 145.727, 105.51, 110.111], ['B', ' CZ ', 146.927, 105.214, 109.541], ['B', ' OH ', 147.951, 104.707, 110.307], ['B', ' H ', 144.316, 105.747, 104.843], ['B', ' HA ', 142.541, 105.165, 107.147], ['B', ' HB ', 144.334, 107.504, 106.49], ['B', ' HB ', 143.26, 107.497, 107.843], ['B', ' HD1', 146.305, 106.131, 106.405], ['B', ' HD2', 143.761, 106.267, 109.798], ['B', ' HE1', 148.074, 105.211, 107.75], ['B', ' HE2', 145.574, 105.34, 111.176], ['B', ' HH ', 147.739, 104.8, 111.238]] AA_SCO= 2.519473684210526 CA_SCO= 1.8652631578947372
[['B', ' N ', 141.479, 106.608, 104.583], ['B', ' CA ', 140.344, 107.292, 103.97], ['B', ' C ', 139.046, 106.7, 104.45], ['B', ' O ', 138.876, 105.477, 104.451], ['B', ' CB ', 140.402, 107.197, 102.47], ['B', ' OG ', 139.229, 107.71, 101.902], ['B', ' H ', 142.072, 106.038, 103.978], ['B', ' HA ', 140.354, 108.335, 104.246], ['B', ' HB ', 141.263, 107.769, 102.113], ['B', ' HB ', 140.543, 106.162, 102.157], ['B', ' HG ', 138.707, 106.923, 101.613]] AA_SCO= 2.4368421052631577 CA_SCO= 1.8652631578947363
[['B', ' N ', 138.101, 107.557, 104.842], ['B', ' CA ', 136.812, 107.075, 105.303], ['B', ' C ', 135.642, 107.693, 104.552], ['B', ' O ', 134.501, 107.609, 104.999], ['B', ' CB ', 136.683, 107.298, 106.802], ['B', ' CG ', 137.7, 106.477, 107.654], ['B', ' CD ', 137.457, 104.992, 107.605], ['B', ' NE ', 138.425, 104.24, 108.405], ['B', ' CZ ', 139.615, 103.742, 107.955], ['B', ' NH1', 140.019, 103.908, 106.708], ['B', ' NH2', 140.384, 103.068, 108.796], ['B', ' H ', 138.272, 108.553, 104.836], ['B', ' HA ', 136.76, 106.008, 105.108], ['B', ' HB ', 136.83, 108.354, 107.029], ['B', ' HB ', 135.68, 107.027, 107.128], ['B', ' HG ', 138.707, 106.665, 107.306], ['B', ' HG ', 137.622, 106.789, 108.693], ['B', ' HD ', 136.463, 104.787, 108.002], ['B', ' HD ', 137.512, 104.62, 106.594], ['B', ' HE ', 138.187, 104.071, 109.372], ['B', ' HH1', 139.463, 104.432, 106.013], ['B', ' HH1', 140.926, 103.517, 106.398], ['B', ' HH2', 140.089, 102.93, 109.751], ['B', ' HH2', 141.268, 102.684, 108.485]] AA_SCO= 2.382631578947368 CA_SCO= 1.8676842105263156
[['B', ' N ', 135.922, 108.328, 103.427], ['B', ' CA ', 134.869, 108.928, 102.619], ['B', ' C ', 134.492, 110.294, 103.098], ['B', ' O ', 135.165, 110.887, 103.944], ['B', ' H ', 136.883, 108.367, 103.115], ['B', ' HA ', 135.195, 109.026, 101.591], ['B', ' HA ', 133.991, 108.282, 102.619]] AA_SCO= 2.282631578947368 CA_SCO= 1.7661578947368421
[['B', ' N ', 133.435, 110.833, 102.515], ['B', ' CA ', 133.074, 112.187, 102.837], ['B', ' C ', 134.013, 112.987, 101.987], ['B', ' O ', 134.646, 112.403, 101.113], ['B', ' H ', 132.922, 110.332, 101.784], ['B', ' HA ', 132.037, 112.388, 102.573], ['B', ' HA ', 133.226, 112.389, 103.895]] AA_SCO= 2.3421052631578947 CA_SCO= 1.782052631578947
[['B', ' N ', 134.158, 114.277, 102.28], ['B', ' CA ', 134.954, 115.215, 101.485], ['B', ' C ', 134.137, 115.694, 100.328], ['B', ' O ', 133.819, 114.941, 99.419], ['B', ' CB ', 136.261, 114.596, 100.967], ['B', ' CG ', 137.15, 115.494, 100.156], ['B', ' CD ', 137.702, 116.522, 100.876], ['B', ' OE1', 138.556, 116.282, 101.758], ['B', ' NE2', 137.205, 117.718, 100.571], ['B', ' H ', 133.616, 114.639, 103.048], ['B', ' HA ', 135.2, 116.078, 102.107], ['B', ' HB ', 136.805, 114.207, 101.812], ['B', ' HB ', 136.087, 113.821, 100.274], ['B', ' HG ', 137.976, 114.908, 99.797], ['B', ' HG ', 136.588, 115.912, 99.311], ['B', ' HE2', 137.498, 118.542, 101.103], ['B', ' HE2', 136.489, 117.795, 99.809]] AA_SCO= 2.4031578947368417 CA_SCO= 1.7929473684210524
[['B', ' N ', 133.814, 116.97, 100.348], ['B', ' CA ', 132.958, 117.481, 99.321], ['B', ' C ', 133.62, 117.482, 98.003], ['B', ' O ', 134.85, 117.561, 97.907], ['B', ' CB ', 132.422, 118.855, 99.644], ['B', ' CG ', 131.443, 118.841, 100.757], ['B', ' CD ', 130.242, 117.994, 100.367], ['B', ' OE1', 129.779, 118.056, 99.221], ['B', ' NE2', 129.739, 117.199, 101.305], ['B', ' H ', 134.142, 117.566, 101.095], ['B', ' HA ', 132.109, 116.806, 99.228], ['B', ' HB ', 133.243, 119.516, 99.917], ['B', ' HB ', 131.952, 119.269, 98.767], ['B', ' HG ', 131.9, 118.406, 101.641], ['B', ' HG ', 131.105, 119.859, 100.962], ['B', ' HE2', 128.946, 116.62, 101.103], ['B', ' HE2', 130.144, 117.179, 102.219]] AA_SCO= 2.304736842105263 CA_SCO= 1.7981578947368417
[['B', ' N ', 132.74, 117.41, 97.008], ['B', ' CA ', 133.003, 117.271, 95.596], ['B', ' C ', 133.354, 115.832, 95.333], ['B', ' O ', 134.511, 115.477, 95.218], ['B', ' CB ', 134.09, 118.178, 95.11], ['B', ' H ', 131.768, 117.407, 97.293], ['B', ' HA ', 132.086, 117.511, 95.054], ['B', ' HB ', 134.186, 118.013, 94.051], ['B', ' HB ', 133.806, 119.201, 95.289], ['B', ' HB ', 135.034, 117.97, 95.593]] AA_SCO= 2.364736842105263 CA_SCO= 1.7952105263157891
[['B', ' N ', 132.298, 115.022, 95.23], ['B', ' CA ', 132.3, 113.564, 95.079], ['B', ' C ', 132.738, 112.74, 96.323], ['B', ' O ', 133.576, 111.833, 96.196], ['B', ' CB ', 133.217, 113.178, 93.945], ['B', ' CG ', 132.924, 113.757, 92.631], ['B', ' CD ', 131.772, 113.236, 92.006], ['B', ' OE1', 131.489, 112.036, 92.059], ['B', ' NE2', 131.083, 114.099, 91.339], ['B', ' H ', 131.397, 115.475, 95.291], ['B', ' HA ', 131.295, 113.255, 94.795], ['B', ' HB ', 134.235, 113.362, 94.164], ['B', ' HB ', 133.099, 112.121, 93.818], ['B', ' HG ', 132.797, 114.83, 92.72], ['B', ' HG ', 133.736, 113.557, 91.977], ['B', ' HE2', 130.292, 113.799, 90.779], ['B', ' HE2', 131.38, 115.064, 91.308]] AA_SCO= 2.4778947368421056 CA_SCO= 1.7951578947368418
[['B', ' N ', 132.021, 112.879, 97.466], ['B', ' CA ', 132.22, 112.225, 98.763], ['B', ' C ', 132.013, 110.708, 98.738], ['B', ' O ', 132.298, 109.989, 99.709], ['B', ' CB ', 131.155, 112.892, 99.641], ['B', ' CG ', 130.111, 113.358, 98.697], ['B', ' CD ', 130.863, 113.792, 97.478], ['B', ' HA ', 133.231, 112.472, 99.12], ['B', ' HB ', 130.774, 112.171, 100.374], ['B', ' HB ', 131.611, 113.719, 100.203], ['B', ' HG ', 129.388, 112.551, 98.495], ['B', ' HG ', 129.544, 114.185, 99.153], ['B', ' HD ', 130.21, 113.676, 96.617], ['B', ' HD ', 131.2, 114.828, 97.63]] AA_SCO= 2.463157894736842 CA_SCO= 1.7947894736842105
[['B', ' N ', 131.435, 110.225, 97.646], ['B', ' CA ', 131.139, 108.824, 97.449], ['B', ' C ', 132.361, 107.964, 97.148], ['B', ' O ', 132.266, 106.742, 97.2], ['B', ' CB ', 130.15, 108.677, 96.321], ['B', ' OG ', 130.723, 109.062, 95.105], ['B', ' H ', 131.188, 110.839, 96.886], ['B', ' HA ', 130.681, 108.448, 98.363], ['B', ' HB ', 129.822, 107.637, 96.259], ['B', ' HB ', 129.272, 109.288, 96.524], ['B', ' HG ', 130.053, 108.9, 94.43]] AA_SCO= 2.39421052631579 CA_SCO= 1.7602105263157892
[['B', ' N ', 133.515, 108.566, 96.845], ['B', ' CA ', 134.68, 107.741, 96.499], ['B', ' C ', 135.113, 106.786, 97.615], ['B', ' O ', 135.129, 105.565, 97.432], ['B', ' CB ', 135.853, 108.639, 96.127], ['B', ' CG ', 135.792, 109.166, 94.741], ['B', ' ND1', 135.082, 110.268, 94.391], ['B', ' CD2', 136.365, 108.723, 93.613], ['B', ' CE1', 135.229, 110.478, 93.092], ['B', ' NE2', 136.0, 109.56, 92.611], ['B', ' H ', 133.552, 109.588, 96.811], ['B', ' HA ', 134.436, 107.135, 95.626], ['B', ' HB ', 135.853, 109.494, 96.797], ['B', ' HB ', 136.786, 108.126, 96.284], ['B', ' HD1', 134.522, 110.872, 95.008], ['B', ' HD2', 137.007, 107.904, 93.394], ['B', ' HE1', 134.76, 111.304, 92.582]] AA_SCO= 2.378421052631579 CA_SCO= 1.7459473684210522
[['B', ' N ', 135.452, 107.338, 98.773], ['B', ' CA ', 135.794, 106.593, 99.99], ['B', ' C ', 136.91, 105.55, 99.985], ['B', ' O ', 137.899, 105.69, 100.711], ['B', ' CB ', 134.53, 105.893, 100.52], ['B', ' CG ', 134.731, 105.101, 101.827], ['B', ' CD ', 133.474, 104.483, 102.383], ['B', ' OE1', 132.418, 104.695, 101.841], ['B', ' OE2', 133.582, 103.777, 103.355], ['B', ' H ', 135.431, 108.347, 98.818], ['B', ' HA ', 136.106, 107.32, 100.719], ['B', ' HB ', 133.751, 106.636, 100.689], ['B', ' HB ', 134.149, 105.198, 99.775], ['B', ' HG ', 135.439, 104.297, 101.669], ['B', ' HG ', 135.158, 105.754, 102.566]] AA_SCO= 2.3652631578947365 CA_SCO= 1.6722105263157894
[['B', ' N ', 136.719, 104.474, 99.246], ['B', ' CA ', 137.584, 103.315, 99.378], ['B', ' C ', 138.679, 103.204, 98.354], ['B', ' O ', 138.431, 103.226, 97.15], ['B', ' CB ', 136.762, 102.059, 99.379], ['B', ' OG ', 137.595, 100.941, 99.427], ['B', ' H ', 135.933, 104.481, 98.603], ['B', ' HA ', 138.065, 103.381, 100.355], ['B', ' HB ', 136.094, 102.062, 100.241], ['B', ' HB ', 136.145, 102.024, 98.482], ['B', ' HG ', 137.018, 100.184, 99.566]] AA_SCO= 2.3010526315789472 CA_SCO= 1.674157894736842
[['B', ' N ', 139.897, 103.094, 98.864], ['B', ' CA ', 141.103, 102.967, 98.072], ['B', ' C ', 141.819, 101.666, 98.35], ['B', ' O ', 141.76, 101.142, 99.465], ['B', ' CB ', 142.036, 104.114, 98.361], ['B', ' CG ', 141.589, 105.427, 97.85], ['B', ' CD1', 140.629, 106.195, 98.479], ['B', ' CD2', 142.201, 105.926, 96.751], ['B', ' CE1', 140.3, 107.419, 97.974], ['B', ' CE2', 141.891, 107.143, 96.258], ['B', ' CZ ', 140.936, 107.891, 96.86], ['B', ' H ', 139.985, 103.094, 99.872], ['B', ' HA ', 140.821, 102.987, 97.032], ['B', ' HB ', 142.174, 104.2, 99.439], ['B', ' HB ', 143.014, 103.899, 97.927], ['B', ' HD1', 140.128, 105.83, 99.378], ['B', ' HD2', 142.961, 105.332, 96.268], ['B', ' HE1', 139.535, 108.029, 98.463], ['B', ' HE2', 142.408, 107.511, 95.368], ['B', ' HZ ', 140.68, 108.864, 96.455]] AA_SCO= 2.255263157894737 CA_SCO= 1.6715263157894735
[['B', ' N ', 142.478, 101.133, 97.333], ['B', ' CA ', 143.23, 99.905, 97.479], ['B', ' C ', 144.629, 100.008, 96.85], ['B', ' O ', 144.906, 100.933, 96.079], ['B', ' CB ', 142.445, 98.741, 96.827], ['B', ' CG1', 141.094, 98.579, 97.504], ['B', ' CG2', 142.277, 98.994, 95.35], ['B', ' H ', 142.445, 101.621, 96.435], ['B', ' HA ', 143.298, 99.707, 98.54], ['B', ' HB ', 142.984, 97.817, 96.966], ['B', ' HG1', 140.564, 97.742, 97.054], ['B', ' HG1', 141.242, 98.385, 98.566], ['B', ' HG1', 140.499, 99.479, 97.382], ['B', ' HG2', 141.736, 98.166, 94.9], ['B', ' HG2', 141.717, 99.921, 95.194], ['B', ' HG2', 143.254, 99.07, 94.881]] AA_SCO= 2.212105263157895 CA_SCO= 1.6539473684210526
[['B', ' N ', 145.548, 99.109, 97.203], ['B', ' CA ', 146.806, 98.888, 96.54], ['B', ' C ', 146.502, 98.415, 95.139], ['B', ' O ', 145.496, 97.753, 94.913], ['B', ' CB ', 147.429, 97.753, 97.344], ['B', ' CG ', 146.774, 97.824, 98.681], ['B', ' CD ', 145.386, 98.324, 98.427], ['B', ' HA ', 147.414, 99.804, 96.539], ['B', ' HB ', 147.248, 96.788, 96.84], ['B', ' HB ', 148.494, 97.895, 97.375], ['B', ' HG ', 146.749, 96.816, 99.135], ['B', ' HG ', 147.33, 98.444, 99.354], ['B', ' HD ', 144.714, 97.483, 98.285], ['B', ' HD ', 145.109, 98.944, 99.285]] AA_SCO= 2.1426315789473684 CA_SCO= 1.6605263157894736
[['B', ' N ', 147.389, 98.665, 94.209], ['B', ' CA ', 147.176, 98.217, 92.856], ['B', ' C ', 147.143, 96.723, 92.842], ['B', ' O ', 146.309, 96.131, 92.162], ['B', ' CB ', 148.209, 98.806, 91.909], ['B', ' CG1', 147.899, 100.277, 91.831], ['B', ' CG2', 148.133, 98.123, 90.545], ['B', ' CD1', 148.859, 101.101, 91.209], ['B', ' H ', 148.259, 99.143, 94.44], ['B', ' HA ', 146.202, 98.565, 92.524], ['B', ' HB ', 149.213, 98.693, 92.329], ['B', ' HG1', 147.004, 100.382, 91.263], ['B', ' HG1', 147.737, 100.656, 92.837], ['B', ' HG2', 148.847, 98.547, 89.857], ['B', ' HG2', 148.351, 97.087, 90.661], ['B', ' HG2', 147.133, 98.236, 90.14], ['B', ' HD1', 148.499, 102.126, 91.192], ['B', ' HD1', 149.787, 101.055, 91.742], ['B', ' HD1', 148.978, 100.756, 90.219]] AA_SCO= 1.9636842105263164 CA_SCO= 1.6610526315789473
[['B', ' N ', 148.002, 96.133, 93.645], ['B', ' CA ', 148.163, 94.701, 93.783], ['B', ' C ', 146.863, 93.979, 94.191], ['B', ' O ', 146.776, 92.762, 94.037], ['B', ' CB ', 149.257, 94.425, 94.799], ['B', ' H ', 148.632, 96.742, 94.153], ['B', ' HA ', 148.476, 94.306, 92.825], ['B', ' HB ', 149.422, 93.348, 94.883], ['B', ' HB ', 150.181, 94.907, 94.479], ['B', ' HB ', 148.956, 94.821, 95.764]] AA_SCO= 1.935789473684211 CA_SCO= 1.6770000000000003
[['B', ' N ', 145.868, 94.669, 94.76], ['B', ' CA ', 144.639, 93.963, 95.124], ['B', ' C ', 143.67, 93.863, 93.947], ['B', ' O ', 142.637, 93.197, 94.036], ['B', ' CB ', 143.907, 94.624, 96.287], ['B', ' CG ', 144.575, 94.489, 97.654], ['B', ' OD1', 145.393, 93.617, 97.858], ['B', ' OD2', 144.181, 95.222, 98.524], ['B', ' H ', 145.92, 95.683, 94.882], ['B', ' HA ', 144.905, 92.95, 95.427], ['B', ' HB ', 143.814, 95.692, 96.065], ['B', ' HB ', 142.898, 94.224, 96.354]] AA_SCO= 1.8910526315789478 CA_SCO= 1.6820526315789472
[['B', ' N ', 143.967, 94.576, 92.869], ['B', ' CA ', 143.13, 94.606, 91.672], ['B', ' C ', 143.832, 93.914, 90.517], ['B', ' O ', 143.231, 93.195, 89.717], ['B', ' CB ', 142.868, 96.065, 91.261], ['B', ' CG ', 142.01, 96.31, 89.976], ['B', ' CD1', 140.587, 95.824, 90.182], ['B', ' CD2', 142.063, 97.778, 89.625], ['B', ' H ', 144.849, 95.087, 92.855], ['B', ' HA ', 142.199, 94.089, 91.886], ['B', ' HB ', 142.36, 96.557, 92.088], ['B', ' HB ', 143.83, 96.561, 91.127], ['B', ' HG ', 142.427, 95.742, 89.145], ['B', ' HD1', 140.014, 95.998, 89.274], ['B', ' HD1', 140.584, 94.759, 90.405], ['B', ' HD1', 140.132, 96.369, 91.009], ['B', ' HD2', 141.485, 97.967, 88.714], ['B', ' HD2', 141.655, 98.354, 90.442], ['B', ' HD2', 143.093, 98.057, 89.463]] AA_SCO= 1.971578947368421 CA_SCO= 1.6490000000000002
[['B', ' N ', 145.113, 94.203, 90.431], ['B', ' CA ', 146.015, 93.803, 89.386], ['B', ' C ', 147.06, 92.867, 89.908], ['B', ' O ', 147.612, 93.098, 90.971], ['B', ' CB ', 146.714, 95.046, 88.823], ['B', ' CG1', 145.679, 96.06, 88.299], ['B', ' CG2', 147.752, 94.711, 87.812], ['B', ' CD1', 144.751, 95.601, 87.166], ['B', ' H ', 145.511, 94.794, 91.158], ['B', ' HA ', 145.46, 93.286, 88.608], ['B', ' HB ', 147.199, 95.534, 89.637], ['B', ' HG1', 145.068, 96.369, 89.129], ['B', ' HG1', 146.233, 96.917, 87.951], ['B', ' HG2', 148.232, 95.624, 87.465], ['B', ' HG2', 148.512, 94.069, 88.232], ['B', ' HG2', 147.278, 94.212, 87.011], ['B', ' HD1', 144.081, 96.414, 86.899], ['B', ' HD1', 145.328, 95.321, 86.292], ['B', ' HD1', 144.153, 94.755, 87.489]] AA_SCO= 2.03421052631579 CA_SCO= 1.5967894736842105
[['B', ' N ', 147.371, 91.835, 89.155], ['B', ' CA ', 148.443, 90.965, 89.582], ['B', ' C ', 149.754, 91.685, 89.251], ['B', ' O ', 150.103, 91.854, 88.077], ['B', ' CB ', 148.348, 89.619, 88.853], ['B', ' CG ', 149.372, 88.591, 89.308], ['B', ' OD1', 150.261, 88.954, 90.029], ['B', ' OD2', 149.244, 87.446, 88.934], ['B', ' H ', 146.868, 91.659, 88.299], ['B', ' HA ', 148.384, 90.809, 90.659], ['B', ' HB ', 147.354, 89.199, 88.999], ['B', ' HB ', 148.48, 89.779, 87.782]] AA_SCO= 2.0884210526315794 CA_SCO= 1.690157894736842
[['B', ' N ', 150.408, 92.199, 90.293], ['B', ' CA ', 151.621, 93.004, 90.2], ['B', ' C ', 152.816, 92.171, 90.62], ['B', ' O ', 152.829, 91.629, 91.725], ['B', ' CB ', 151.494, 94.237, 91.125], ['B', ' CG1', 152.73, 95.061, 91.107], ['B', ' CG2', 150.355, 95.093, 90.677], ['B', ' H ', 150.023, 91.994, 91.207], ['B', ' HA ', 151.759, 93.33, 89.168], ['B', ' HB ', 151.33, 93.897, 92.146], ['B', ' HG1', 152.616, 95.914, 91.772], ['B', ' HG1', 153.57, 94.467, 91.439], ['B', ' HG1', 152.913, 95.414, 90.106], ['B', ' HG2', 150.274, 95.949, 91.343], ['B', ' HG2', 150.531, 95.434, 89.663], ['B', ' HG2', 149.449, 94.539, 90.701]] AA_SCO= 2.0778947368421057 CA_SCO= 1.6332105263157897
[['B', ' N ', 153.793, 92.015, 89.729], ['B', ' CA ', 154.948, 91.2, 90.036], ['B', ' C ', 156.055, 91.882, 90.854], ['B', ' O ', 156.754, 91.216, 91.635], ['B', ' CB ', 155.469, 90.639, 88.721], ['B', ' CG ', 155.707, 91.739, 87.681], ['B', ' OD1', 154.734, 92.41, 87.27], ['B', ' OD2', 156.809, 91.894, 87.273], ['B', ' H ', 153.745, 92.452, 88.803], ['B', ' HA ', 154.594, 90.352, 90.625], ['B', ' HB ', 156.409, 90.11, 88.898], ['B', ' HB ', 154.75, 89.918, 88.324]] AA_SCO= 2.0742105263157895 CA_SCO= 1.6239473684210526
[['B', ' N ', 156.176, 93.2, 90.733], ['B', ' CA ', 157.225, 93.946, 91.409], ['B', ' C ', 156.684, 95.04, 92.301], ['B', ' O ', 155.636, 95.617, 92.01], ['B', ' CB ', 158.092, 94.63, 90.359], ['B', ' CG ', 158.849, 93.792, 89.354], ['B', ' CD1', 159.414, 94.719, 88.292], ['B', ' CD2', 159.962, 93.046, 90.035], ['B', ' H ', 155.562, 93.721, 90.096], ['B', ' HA ', 157.807, 93.27, 92.025], ['B', ' HB ', 157.44, 95.222, 89.765], ['B', ' HB ', 158.767, 95.274, 90.856], ['B', ' HG ', 158.175, 93.086, 88.872], ['B', ' HD1', 159.959, 94.136, 87.553], ['B', ' HD1', 158.596, 95.245, 87.8], ['B', ' HD1', 160.081, 95.437, 88.756], ['B', ' HD2', 160.507, 92.456, 89.3], ['B', ' HD2', 160.644, 93.742, 90.515], ['B', ' HD2', 159.544, 92.399, 90.758]] AA_SCO= 2.128421052631579 CA_SCO= 1.6053157894736843
[['B', ' N ', 157.383, 95.346, 93.385], ['B', ' CA ', 156.971, 96.521, 94.126], ['B', ' C ', 158.121, 97.234, 94.739], ['B', ' O ', 158.928, 96.667, 95.464], ['B', ' CB ', 156.01, 96.175, 95.223], ['B', ' H ', 158.19, 94.785, 93.684], ['B', ' HA ', 156.511, 97.207, 93.424], ['B', ' HB ', 155.715, 97.082, 95.747], ['B', ' HB ', 155.148, 95.711, 94.786], ['B', ' HB ', 156.487, 95.513, 95.913]] AA_SCO= 2.0878947368421055 CA_SCO= 1.6082631578947368
[['B', ' N ', 158.093, 98.525, 94.565], ['B', ' CA ', 159.078, 99.417, 95.09], ['B', ' C ', 158.447, 100.322, 96.127], ['B', ' O ', 157.908, 101.359, 95.762], ['B', ' CB ', 159.666, 100.222, 93.921], ['B', ' CG ', 160.917, 101.109, 94.165], ['B', ' CD1', 161.682, 101.203, 92.892], ['B', ' CD2', 160.491, 102.522, 94.572], ['B', ' H ', 157.371, 98.922, 93.958], ['B', ' HA ', 159.878, 98.833, 95.505], ['B', ' HB ', 159.922, 99.516, 93.137], ['B', ' HB ', 158.881, 100.868, 93.533], ['B', ' HG ', 161.559, 100.673, 94.923], ['B', ' HD1', 162.568, 101.817, 93.035], ['B', ' HD1', 161.976, 100.203, 92.609], ['B', ' HD1', 161.057, 101.638, 92.119], ['B', ' HD2', 161.354, 103.14, 94.696], ['B', ' HD2', 159.853, 102.955, 93.798], ['B', ' HD2', 159.955, 102.502, 95.499]] AA_SCO= 2.0847368421052637 CA_SCO= 1.6077894736842104
[['B', ' N ', 158.415, 99.939, 97.403], ['B', ' CA ', 157.834, 100.703, 98.462], ['B', ' C ', 158.704, 101.904, 98.727], ['B', ' O ', 159.876, 101.947, 98.342], ['B', ' CB ', 157.796, 99.719, 99.626], ['B', ' CG ', 158.91, 98.764, 99.343], ['B', ' CD ', 158.914, 98.622, 97.844], ['B', ' HA ', 156.819, 101.011, 98.179], ['B', ' HB ', 157.906, 100.258, 100.576], ['B', ' HB ', 156.81, 99.231, 99.655], ['B', ' HG ', 159.865, 99.157, 99.721], ['B', ' HG ', 158.739, 97.804, 99.858], ['B', ' HD ', 159.916, 98.417, 97.543], ['B', ' HD ', 158.224, 97.825, 97.547]] AA_SCO= 2.0968421052631583 CA_SCO= 1.607315789473684
[['B', ' N ', 158.131, 102.853, 99.418], ['B', ' CA ', 158.788, 104.072, 99.835], ['B', ' C ', 157.696, 105.054, 100.133], ['B', ' O ', 156.656, 105.005, 99.458], ['B', ' H ', 157.165, 102.72, 99.701], ['B', ' HA ', 159.443, 103.917, 100.673], ['B', ' HA ', 159.387, 104.43, 99.023]] AA_SCO= 2.1294736842105264 CA_SCO= 1.641842105263158
[['B', ' N ', 157.895, 105.965, 101.123], ['B', ' CA ', 156.855, 106.929, 101.472], ['B', ' C ', 156.916, 107.963, 100.343], ['B', ' O ', 155.937, 108.164, 99.632], ['B', ' CB ', 157.04, 107.446, 102.914], ['B', ' SG ', 156.953, 106.125, 104.242], ['B', ' H ', 158.768, 105.993, 101.646], ['B', ' HA ', 155.875, 106.436, 101.437], ['B', ' HB ', 157.982, 107.909, 103.05], ['B', ' HB ', 156.28, 108.195, 103.143]] AA_SCO= 2.1194736842105266 CA_SCO= 1.6559473684210526
[['B', ' N ', 158.003, 108.748, 100.181], ['B', ' CA ', 158.48, 109.181, 98.904], ['B', ' C ', 159.605, 108.187, 98.588], ['B', ' O ', 160.596, 108.209, 99.319], ['B', ' CB ', 159.01, 110.563, 99.146], ['B', ' CG ', 159.488, 110.536, 100.57], ['B', ' CD ', 158.661, 109.469, 101.275], ['B', ' HA ', 157.655, 109.181, 98.181], ['B', ' HB ', 159.811, 110.741, 98.434], ['B', ' HB ', 158.238, 111.292, 98.933], ['B', ' HG ', 160.565, 110.32, 100.605], ['B', ' HG ', 159.356, 111.522, 101.038], ['B', ' HD ', 159.392, 108.845, 101.768], ['B', ' HD ', 157.947, 109.945, 101.964]] AA_SCO= 2.0457894736842106 CA_SCO= 1.7300526315789475
[['B', ' N ', 159.524, 107.269, 97.639], ['B', ' CA ', 160.602, 106.347, 97.37], ['B', ' C ', 161.804, 107.171, 97.0], ['B', ' O ', 161.671, 108.206, 96.349], ['B', ' CB ', 160.051, 105.497, 96.24], ['B', ' CG ', 158.932, 106.322, 95.654], ['B', ' CD ', 158.38, 107.133, 96.812], ['B', ' HA ', 160.831, 105.765, 98.264], ['B', ' HB ', 160.851, 105.299, 95.514], ['B', ' HB ', 159.706, 104.528, 96.625], ['B', ' HG ', 159.305, 106.974, 94.853], ['B', ' HG ', 158.163, 105.674, 95.188], ['B', ' HD ', 158.064, 108.093, 96.42], ['B', ' HD ', 157.564, 106.608, 97.341]] AA_SCO= 2.0878947368421055 CA_SCO= 1.7323157894736843
[['B', ' N ', 162.967, 106.74, 97.463], ['B', ' CA ', 164.19, 107.475, 97.242], ['B', ' C ', 164.595, 107.431, 95.793], ['B', ' O ', 164.402, 106.409, 95.136], ['B', ' CB ', 165.289, 106.827, 98.069], ['B', ' OG ', 165.575, 105.542, 97.583], ['B', ' H ', 163.008, 105.879, 97.974], ['B', ' HA ', 164.015, 108.5, 97.565], ['B', ' HB ', 166.193, 107.427, 98.064], ['B', ' HB ', 164.956, 106.749, 99.099], ['B', ' HG ', 166.039, 105.066, 98.314]] AA_SCO= 1.9963157894736845 CA_SCO= 1.735315789473684
[['B', ' N ', 165.264, 108.464, 95.275], ['B', ' CA ', 165.749, 108.479, 93.927], ['B', ' C ', 166.79, 107.417, 93.681], ['B', ' O ', 166.87, 106.868, 92.588], ['B', ' CB ', 166.361, 109.872, 93.829], ['B', ' CG ', 166.632, 110.294, 95.247], ['B', ' CD ', 165.548, 109.675, 96.051], ['B', ' HA ', 164.906, 108.38, 93.229], ['B', ' HB ', 167.285, 109.834, 93.255], ['B', ' HB ', 165.693, 110.533, 93.286], ['B', ' HG ', 167.63, 109.966, 95.55], ['B', ' HG ', 166.627, 111.394, 95.309], ['B', ' HD ', 165.948, 109.473, 97.048], ['B', ' HD ', 164.662, 110.335, 96.072]] AA_SCO= 2.026315789473684 CA_SCO= 1.7547894736842107
[['B', ' N ', 167.505, 107.014, 94.725], ['B', ' CA ', 168.525, 106.017, 94.531], ['B', ' C ', 167.933, 104.653, 94.312], ['B', ' O ', 168.421, 103.909, 93.464], ['B', ' CB ', 169.491, 106.025, 95.701], ['B', ' CG ', 170.333, 107.302, 95.748], ['B', ' CD ', 171.273, 107.376, 96.902], ['B', ' OE1', 171.244, 106.496, 97.722], ['B', ' OE2', 172.034, 108.318, 96.957], ['B', ' H ', 167.431, 107.456, 95.629], ['B', ' HA ', 169.089, 106.282, 93.637], ['B', ' HB ', 168.934, 105.944, 96.639], ['B', ' HB ', 170.16, 105.167, 95.636], ['B', ' HG ', 170.908, 107.372, 94.825], ['B', ' HG ', 169.663, 108.161, 95.785]] AA_SCO= 2.08578947368421 CA_SCO= 1.765473684210526
[['B', ' N ', 166.862, 104.309, 95.026], ['B', ' CA ', 166.315, 102.99, 94.788], ['B', ' C ', 165.659, 103.006, 93.438], ['B', ' O ', 165.656, 101.999, 92.742], ['B', ' CB ', 165.33, 102.495, 95.87], ['B', ' CG1', 165.066, 100.99, 95.732], ['B', ' CG2', 164.006, 103.185, 95.814], ['B', ' CD1', 166.21, 100.065, 96.014], ['B', ' H ', 166.466, 104.937, 95.729], ['B', ' HA ', 167.143, 102.297, 94.746], ['B', ' HB ', 165.77, 102.671, 96.844], ['B', ' HG1', 164.3, 100.759, 96.4], ['B', ' HG1', 164.712, 100.785, 94.725], ['B', ' HG2', 163.364, 102.802, 96.6], ['B', ' HG2', 164.133, 104.23, 95.948], ['B', ' HG2', 163.541, 102.995, 94.871], ['B', ' HD1', 165.874, 99.034, 95.908], ['B', ' HD1', 167.036, 100.228, 95.335], ['B', ' HD1', 166.523, 100.233, 97.024]] AA_SCO= 2.2352631578947366 CA_SCO= 1.731052631578947
[['B', ' N ', 165.08, 104.141, 93.061], ['B', ' CA ', 164.434, 104.188, 91.781], ['B', ' C ', 165.465, 104.023, 90.695], ['B', ' O ', 165.263, 103.236, 89.778], ['B', ' CB ', 163.717, 105.523, 91.598], ['B', ' CG1', 162.533, 105.589, 92.59], ['B', ' CG2', 163.275, 105.667, 90.136], ['B', ' CD1', 161.906, 106.981, 92.751], ['B', ' H ', 165.07, 104.949, 93.691], ['B', ' HA ', 163.72, 103.377, 91.707], ['B', ' HB ', 164.387, 106.34, 91.851], ['B', ' HG1', 161.779, 104.894, 92.275], ['B', ' HG1', 162.885, 105.273, 93.566], ['B', ' HG2', 162.771, 106.6, 90.019], ['B', ' HG2', 164.128, 105.649, 89.461], ['B', ' HG2', 162.606, 104.852, 89.872], ['B', ' HD1', 161.107, 106.925, 93.471], ['B', ' HD1', 162.655, 107.681, 93.115], ['B', ' HD1', 161.507, 107.341, 91.819]] AA_SCO= 2.28 CA_SCO= 1.6427894736842106
[['B', ' N ', 166.576, 104.748, 90.759], ['B', ' CA ', 167.555, 104.595, 89.71], ['B', ' C ', 168.097, 103.18, 89.684], ['B', ' O ', 168.246, 102.59, 88.616], ['B', ' CB ', 168.695, 105.561, 89.902], ['B', ' H ', 166.726, 105.415, 91.518], ['B', ' HA ', 167.072, 104.805, 88.76], ['B', ' HB ', 169.414, 105.445, 89.096], ['B', ' HB ', 168.315, 106.563, 89.907], ['B', ' HB ', 169.179, 105.356, 90.859]] AA_SCO= 2.2394736842105263 CA_SCO= 1.5988947368421051
[['B', ' N ', 168.329, 102.584, 90.85], ['B', ' CA ', 168.88, 101.252, 90.855], ['B', ' C ', 167.958, 100.227, 90.259], ['B', ' O ', 168.427, 99.369, 89.511], ['B', ' CB ', 169.249, 100.824, 92.264], ['B', ' CG ', 170.472, 101.498, 92.84], ['B', ' CD ', 170.685, 101.049, 94.278], ['B', ' CE ', 171.901, 101.676, 94.918], ['B', ' NZ ', 173.164, 101.109, 94.374], ['B', ' H ', 168.188, 103.076, 91.736], ['B', ' HA ', 169.787, 101.263, 90.253], ['B', ' HB ', 168.408, 101.032, 92.929], ['B', ' HB ', 169.417, 99.75, 92.285], ['B', ' HG ', 171.334, 101.224, 92.24], ['B', ' HG ', 170.358, 102.575, 92.801], ['B', ' HD ', 169.804, 101.308, 94.869], ['B', ' HD ', 170.807, 99.967, 94.304], ['B', ' HE ', 171.886, 102.753, 94.746], ['B', ' HE ', 171.863, 101.489, 95.994], ['B', ' HZ ', 173.957, 101.532, 94.83], ['B', ' HZ ', 173.159, 100.111, 94.554], ['B', ' HZ ', 173.224, 101.271, 93.384]] AA_SCO= 2.2010526315789476 CA_SCO= 1.6356842105263156
[['B', ' N ', 166.657, 100.312, 90.52], ['B', ' CA ', 165.79, 99.294, 89.984], ['B', ' C ', 165.385, 99.553, 88.551], ['B', ' O ', 165.181, 98.597, 87.801], ['B', ' CB ', 164.532, 99.18, 90.819], ['B', ' OG1', 163.851, 100.423, 90.771], ['B', ' CG2', 164.923, 98.849, 92.253], ['B', ' H ', 166.28, 101.022, 91.16], ['B', ' HA ', 166.319, 98.348, 90.029], ['B', ' HB ', 163.883, 98.41, 90.42], ['B', ' HG1', 162.961, 100.313, 91.097], ['B', ' HG2', 164.056, 98.798, 92.871], ['B', ' HG2', 165.43, 97.896, 92.264], ['B', ' HG2', 165.579, 99.602, 92.651]] AA_SCO= 1.9910526315789476 CA_SCO= 1.6351052631578944
[['B', ' N ', 165.323, 100.805, 88.096], ['B', ' CA ', 164.938, 100.944, 86.7], ['B', ' C ', 166.135, 100.562, 85.853], ['B', ' O ', 165.969, 99.956, 84.795], ['B', ' CB ', 164.371, 102.338, 86.327], ['B', ' CG1', 163.138, 102.635, 87.211], ['B', ' CG2', 165.42, 103.417, 86.444], ['B', ' H ', 165.454, 101.607, 88.725], ['B', ' HA ', 164.14, 100.232, 86.493], ['B', ' HB ', 164.018, 102.308, 85.297], ['B', ' HG1', 162.702, 103.595, 86.933], ['B', ' HG1', 162.398, 101.848, 87.069], ['B', ' HG1', 163.43, 102.663, 88.257], ['B', ' HG2', 164.981, 104.369, 86.168], ['B', ' HG2', 165.773, 103.465, 87.447], ['B', ' HG2', 166.244, 103.21, 85.784]] AA_SCO= 2.0210526315789474 CA_SCO= 1.625052631578947
[['B', ' N ', 167.34, 100.883, 86.325], ['B', ' CA ', 168.533, 100.513, 85.616], ['B', ' C ', 168.737, 99.01, 85.709], ['B', ' O ', 169.059, 98.375, 84.709], ['B', ' CB ', 169.743, 101.278, 86.127], ['B', ' CG1', 171.013, 100.752, 85.459], ['B', ' CG2', 169.526, 102.753, 85.808], ['B', ' H ', 167.433, 101.417, 87.194], ['B', ' HA ', 168.402, 100.783, 84.571], ['B', ' HB ', 169.844, 101.139, 87.207], ['B', ' HG1', 171.871, 101.315, 85.825], ['B', ' HG1', 171.155, 99.699, 85.694], ['B', ' HG1', 170.93, 100.873, 84.378], ['B', ' HG2', 170.374, 103.337, 86.16], ['B', ' HG2', 169.42, 102.857, 84.746], ['B', ' HG2', 168.625, 103.113, 86.288]] AA_SCO= 2.0221052631578944 CA_SCO= 1.6265263157894736
[['B', ' N ', 168.543, 98.404, 86.882], ['B', ' CA ', 168.69, 96.971, 86.948], ['B', ' C ', 167.712, 96.321, 85.977], ['B', ' O ', 168.062, 95.348, 85.315], ['B', ' CB ', 168.458, 96.48, 88.362], ['B', ' H ', 168.329, 98.917, 87.737], ['B', ' HA ', 169.702, 96.711, 86.641], ['B', ' HB ', 168.57, 95.403, 88.41], ['B', ' HB ', 169.174, 96.948, 89.035], ['B', ' HB ', 167.466, 96.747, 88.659]] AA_SCO= 2.0052631578947366 CA_SCO= 1.617736842105263
[['B', ' N ', 166.493, 96.846, 85.83], ['B', ' CA ', 165.609, 96.252, 84.84], ['B', ' C ', 166.127, 96.496, 83.431], ['B', ' O ', 166.142, 95.578, 82.617], ['B', ' CB ', 164.172, 96.766, 85.018], ['B', ' CG ', 163.416, 96.207, 86.256], ['B', ' CD1', 162.177, 96.966, 86.513], ['B', ' CD2', 163.003, 94.754, 85.961], ['B', ' H ', 166.164, 97.613, 86.423], ['B', ' HA ', 165.612, 95.18, 84.996], ['B', ' HB ', 164.217, 97.851, 85.126], ['B', ' HB ', 163.597, 96.531, 84.125], ['B', ' HG ', 164.047, 96.278, 87.133], ['B', ' HD1', 161.67, 96.549, 87.375], ['B', ' HD1', 162.421, 98.012, 86.71], ['B', ' HD1', 161.545, 96.883, 85.654], ['B', ' HD2', 162.451, 94.349, 86.808], ['B', ' HD2', 162.386, 94.75, 85.092], ['B', ' HD2', 163.86, 94.129, 85.769]] AA_SCO= 1.8915789473684206 CA_SCO= 1.6332631578947368
[['B', ' N ', 166.671, 97.681, 83.165], ['B', ' CA ', 167.195, 98.032, 81.848], ['B', ' C ', 168.295, 97.063, 81.433], ['B', ' O ', 168.376, 96.648, 80.275], ['B', ' CB ', 167.775, 99.459, 81.911], ['B', ' CG ', 168.329, 100.12, 80.639], ['B', ' CD1', 167.23, 100.275, 79.596], ['B', ' CD2', 168.913, 101.487, 81.034], ['B', ' H ', 166.623, 98.415, 83.874], ['B', ' HA ', 166.381, 97.976, 81.132], ['B', ' HB ', 167.015, 100.117, 82.329], ['B', ' HB ', 168.603, 99.438, 82.597], ['B', ' HG ', 169.119, 99.495, 80.209], ['B', ' HD1', 167.64, 100.757, 78.705], ['B', ' HD1', 166.835, 99.301, 79.321], ['B', ' HD1', 166.429, 100.893, 79.997], ['B', ' HD2', 169.322, 101.981, 80.148], ['B', ' HD2', 168.127, 102.102, 81.461], ['B', ' HD2', 169.704, 101.345, 81.772]] AA_SCO= 1.6631578947368422 CA_SCO= 1.6331052631578948
[['B', ' N ', 169.123, 96.684, 82.399], ['B', ' CA ', 170.239, 95.78, 82.184], ['B', ' C ', 169.959, 94.32, 82.564], ['B', ' O ', 170.888, 93.512, 82.616], ['B', ' CB ', 171.43, 96.284, 82.956], ['B', ' CG ', 171.937, 97.573, 82.414], ['B', ' OD1', 171.912, 97.828, 81.203], ['B', ' ND2', 172.417, 98.407, 83.291], ['B', ' H ', 168.994, 97.122, 83.316], ['B', ' HA ', 170.479, 95.791, 81.122], ['B', ' HB ', 171.141, 96.432, 84.001], ['B', ' HB ', 172.229, 95.547, 82.933], ['B', ' HD2', 172.78, 99.291, 82.995], ['B', ' HD2', 172.425, 98.161, 84.261]] AA_SCO= 1.698947368421053 CA_SCO= 1.6246842105263157
[['B', ' N ', 168.7, 93.99, 82.854], ['B', ' CA ', 168.247, 92.657, 83.254], ['B', ' C ', 168.953, 92.071, 84.488], ['B', ' O ', 169.136, 90.849, 84.601], ['B', ' CB ', 168.385, 91.705, 82.084], ['B', ' CG ', 167.53, 92.113, 80.93], ['B', ' OD1', 166.338, 92.408, 81.09], ['B', ' ND2', 168.114, 92.147, 79.759], ['B', ' H ', 167.97, 94.704, 82.772], ['B', ' HA ', 167.189, 92.74, 83.512], ['B', ' HB ', 169.421, 91.645, 81.758], ['B', ' HB ', 168.084, 90.707, 82.396], ['B', ' HD2', 167.594, 92.42, 78.95], ['B', ' HD2', 169.081, 91.908, 79.676]] AA_SCO= 1.565263157894737 CA_SCO= 1.6254736842105262
[['B', ' N ', 169.287, 92.899, 85.467], ['B', ' CA ', 169.946, 92.377, 86.65], ['B', ' C ', 168.936, 91.899, 87.659], ['B', ' O ', 168.53, 92.621, 88.58], ['B', ' CB ', 170.887, 93.406, 87.277], ['B', ' CG ', 171.663, 92.843, 88.488], ['B', ' OD1', 171.228, 91.838, 89.051], ['B', ' OD2', 172.684, 93.389, 88.825], ['B', ' H ', 169.08, 93.889, 85.38], ['B', ' HA ', 170.551, 91.523, 86.352], ['B', ' HB ', 171.603, 93.755, 86.521], ['B', ' HB ', 170.323, 94.26, 87.596]] AA_SCO= 1.4878947368421054 CA_SCO= 1.2409473684210524
[['B', ' N ', 168.522, 90.657, 87.494], ['B', ' CA ', 167.486, 90.183, 88.367], ['B', ' C ', 167.999, 89.586, 89.653], ['B', ' O ', 167.209, 89.194, 90.507], ['B', ' CB ', 166.494, 89.307, 87.646], ['B', ' CG ', 165.724, 90.117, 86.591], ['B', ' SD ', 164.454, 89.21, 85.738], ['B', ' CE ', 163.159, 89.251, 87.005], ['B', ' H ', 168.893, 90.108, 86.712], ['B', ' HA ', 166.92, 91.046, 88.655], ['B', ' HB ', 167.016, 88.486, 87.151], ['B', ' HB ', 165.799, 88.88, 88.362], ['B', ' HG ', 165.251, 90.958, 87.082], ['B', ' HG ', 166.424, 90.511, 85.851], ['B', ' HE ', 162.272, 88.733, 86.638], ['B', ' HE ', 163.507, 88.762, 87.913], ['B', ' HE ', 162.901, 90.289, 87.23]] AA_SCO= 1.4947368421052634 CA_SCO= 1.2113157894736843
[['B', ' N ', 169.312, 89.539, 89.839], ['B', ' CA ', 169.788, 89.046, 91.116], ['B', ' C ', 169.505, 90.169, 92.094], ['B', ' O ', 169.027, 89.947, 93.208], ['B', ' CB ', 171.289, 88.773, 91.099], ['B', ' CG ', 171.733, 87.576, 90.255], ['B', ' OD1', 170.929, 86.742, 89.907], ['B', ' OD2', 172.913, 87.519, 89.963], ['B', ' H ', 169.957, 89.867, 89.123], ['B', ' HA ', 169.236, 88.154, 91.407], ['B', ' HB ', 171.794, 89.662, 90.712], ['B', ' HB ', 171.636, 88.636, 92.125]] AA_SCO= 1.578421052631579 CA_SCO= 1.1981052631578948
[['B', ' N ', 169.73, 91.398, 91.62], ['B', ' CA ', 169.458, 92.592, 92.393], ['B', ' C ', 167.973, 92.769, 92.636], ['B', ' O ', 167.554, 93.085, 93.745], ['B', ' CB ', 169.983, 93.845, 91.713], ['B', ' CG ', 169.687, 95.066, 92.539], ['B', ' CD1', 170.448, 95.323, 93.657], ['B', ' CD2', 168.646, 95.914, 92.202], ['B', ' CE1', 170.176, 96.401, 94.438], ['B', ' CE2', 168.379, 96.998, 92.993], ['B', ' CZ ', 169.135, 97.239, 94.108], ['B', ' OH ', 168.847, 98.314, 94.91], ['B', ' H ', 170.175, 91.494, 90.693], ['B', ' HA ', 169.95, 92.49, 93.36], ['B', ' HB ', 171.063, 93.769, 91.565], ['B', ' HB ', 169.518, 93.959, 90.731], ['B', ' HD1', 171.268, 94.659, 93.928], ['B', ' HD2', 168.038, 95.718, 91.319], ['B', ' HE1', 170.777, 96.592, 95.324], ['B', ' HE2', 167.569, 97.668, 92.747], ['B', ' HH ', 169.51, 98.38, 95.627]] AA_SCO= 1.618421052631579 CA_SCO= 1.1846842105263158
[['B', ' N ', 167.176, 92.597, 91.586], ['B', ' CA ', 165.738, 92.809, 91.646], ['B', ' C ', 164.916, 91.698, 92.283], ['B', ' O ', 163.86, 91.99, 92.836], ['B', ' CB ', 165.236, 92.974, 90.238], ['B', ' CG ', 165.75, 94.168, 89.506], ['B', ' CD1', 165.485, 93.964, 88.1], ['B', ' CD2', 165.024, 95.426, 89.97], ['B', ' H ', 167.604, 92.368, 90.683], ['B', ' HA ', 165.567, 93.715, 92.219], ['B', ' HB ', 165.445, 92.096, 89.689], ['B', ' HB ', 164.151, 93.071, 90.285], ['B', ' HG ', 166.82, 94.275, 89.656], ['B', ' HD1', 165.834, 94.807, 87.546], ['B', ' HD1', 165.995, 93.079, 87.748], ['B', ' HD1', 164.436, 93.843, 87.988], ['B', ' HD2', 165.378, 96.274, 89.403], ['B', ' HD2', 163.957, 95.312, 89.797], ['B', ' HD2', 165.201, 95.605, 91.026]] AA_SCO= 1.6721052631578948 CA_SCO= 1.1794210526315794
[['B', ' N ', 165.349, 90.441, 92.244], ['B', ' CA ', 164.536, 89.383, 92.837], ['B', ' C ', 164.026, 89.676, 94.254], ['B', ' O ', 162.933, 89.24, 94.569], ['B', ' CB ', 165.225, 88.016, 92.755], ['B', ' CG ', 164.451, 86.876, 93.425], ['B', ' CD ', 163.1, 86.575, 92.796], ['B', ' OE1', 162.984, 86.355, 91.586], ['B', ' NE2', 162.069, 86.561, 93.628], ['B', ' H ', 166.202, 90.184, 91.74], ['B', ' HA ', 163.654, 89.286, 92.207], ['B', ' HB ', 165.303, 87.749, 91.701], ['B', ' HB ', 166.235, 88.038, 93.125], ['B', ' HG ', 165.057, 85.978, 93.334], ['B', ' HG ', 164.3, 87.098, 94.481], ['B', ' HE2', 161.149, 86.369, 93.291], ['B', ' HE2', 162.209, 86.768, 94.602]] AA_SCO= 1.5431578947368423 CA_SCO= 1.1217894736842107
[['B', ' N ', 164.79, 90.256, 95.184], ['B', ' CA ', 164.321, 90.658, 96.5], ['B', ' C ', 163.201, 91.725, 96.476], ['B', ' O ', 162.486, 91.88, 97.462], ['B', ' CB ', 165.608, 91.18, 97.136], ['B', ' CG ', 166.698, 90.476, 96.397], ['B', ' CD ', 166.221, 90.367, 95.017], ['B', ' HA ', 163.968, 89.76, 97.03], ['B', ' HB ', 165.684, 92.265, 97.009], ['B', ' HB ', 165.616, 90.967, 98.217], ['B', ' HG ', 167.607, 91.05, 96.42], ['B', ' HG ', 166.921, 89.504, 96.852], ['B', ' HD ', 166.462, 91.251, 94.511], ['B', ' HD ', 166.682, 89.509, 94.571]] AA_SCO= 1.436842105263158 CA_SCO= 1.1216315789473683
[['B', ' N ', 163.063, 92.478, 95.368], ['B', ' CA ', 162.028, 93.506, 95.218], ['B', ' C ', 160.802, 92.828, 94.632], ['B', ' O ', 159.638, 93.248, 94.781], ['B', ' CB ', 162.488, 94.637, 94.307], ['B', ' CG ', 161.462, 95.735, 94.203], ['B', ' SD ', 161.896, 97.09, 93.171], ['B', ' CE ', 161.596, 96.465, 91.541], ['B', ' H ', 163.664, 92.321, 94.572], ['B', ' HA ', 161.782, 93.904, 96.191], ['B', ' HB ', 163.418, 95.054, 94.68], ['B', ' HB ', 162.683, 94.239, 93.312], ['B', ' HG ', 160.529, 95.337, 93.835], ['B', ' HG ', 161.285, 96.119, 95.2], ['B', ' HE ', 161.825, 97.23, 90.803], ['B', ' HE ', 162.208, 95.59, 91.362], ['B', ' HE ', 160.57, 96.202, 91.464]] AA_SCO= 1.4694736842105265 CA_SCO= 1.142157894736842
[['B', ' N ', 161.081, 91.782, 93.895], ['B', ' CA ', 160.065, 90.998, 93.272], ['B', ' C ', 159.382, 90.33, 94.433], ['B', ' O ', 160.012, 89.975, 95.424], ['B', ' CB ', 160.695, 90.014, 92.278], ['B', ' CG ', 159.782, 89.359, 91.219], ['B', ' CD1', 160.636, 89.066, 89.99], ['B', ' CD2', 159.165, 88.07, 91.739], ['B', ' H ', 162.058, 91.535, 93.73], ['B', ' HA ', 159.348, 91.633, 92.774], ['B', ' HB ', 161.496, 90.533, 91.758], ['B', ' HB ', 161.136, 89.208, 92.849], ['B', ' HG ', 158.988, 90.052, 90.936], ['B', ' HD1', 160.017, 88.616, 89.212], ['B', ' HD1', 161.067, 89.993, 89.614], ['B', ' HD1', 161.441, 88.375, 90.26], ['B', ' HD2', 158.543, 87.63, 90.961], ['B', ' HD2', 159.952, 87.377, 91.999], ['B', ' HD2', 158.556, 88.255, 92.604]] AA_SCO= 1.473684210526316 CA_SCO= 1.1703157894736842
[['B', ' N ', 158.08, 90.238, 94.359], ['B', ' CA ', 157.274, 89.66, 95.428], ['B', ' C ', 157.142, 90.572, 96.672], ['B', ' O ', 156.408, 90.237, 97.598], ['B', ' CB ', 157.846, 88.293, 95.86], ['B', ' CG ', 156.775, 87.298, 96.368], ['B', ' OD1', 155.687, 87.302, 95.826], ['B', ' OD2', 157.063, 86.53, 97.267], ['B', ' H ', 157.622, 90.559, 93.495], ['B', ' HA ', 156.272, 89.492, 95.031], ['B', ' HB ', 158.379, 87.837, 95.028], ['B', ' HB ', 158.57, 88.441, 96.665]] AA_SCO= 1.5536842105263158 CA_SCO= 1.210421052631579
[['B', ' N ', 157.629, 91.833, 96.631], ['B', ' CA ', 157.304, 92.743, 97.742], ['B', ' C ', 155.919, 93.286, 97.457], ['B', ' O ', 155.285, 93.944, 98.273], ['B', ' CB ', 158.264, 93.931, 97.927], ['B', ' CG ', 159.699, 93.665, 98.38], ['B', ' CD1', 160.472, 95.01, 98.371], ['B', ' CD2', 159.72, 93.068, 99.776], ['B', ' H ', 158.256, 92.155, 95.88], ['B', ' HA ', 157.263, 92.173, 98.663], ['B', ' HB ', 158.348, 94.441, 96.965], ['B', ' HB ', 157.815, 94.625, 98.638], ['B', ' HG ', 160.177, 92.979, 97.685], ['B', ' HD1', 161.507, 94.838, 98.676], ['B', ' HD1', 160.453, 95.439, 97.368], ['B', ' HD1', 160.004, 95.705, 99.061], ['B', ' HD2', 160.75, 92.907, 100.073], ['B', ' HD2', 159.245, 93.752, 100.478], ['B', ' HD2', 159.199, 92.118, 99.787]] AA_SCO= 1.332105263157895 CA_SCO= 1.2127368421052631
[['B', ' N ', 155.408, 92.926, 96.289], ['B', ' CA ', 154.083, 93.26, 95.829], ['B', ' C ', 153.083, 92.471, 96.662], ['B', ' O ', 151.892, 92.772, 96.671], ['B', ' CB ', 153.947, 92.972, 94.346], ['B', ' H ', 156.006, 92.404, 95.669], ['B', ' HA ', 153.898, 94.315, 96.013], ['B', ' HB ', 152.944, 93.228, 94.012], ['B', ' HB ', 154.667, 93.554, 93.783], ['B', ' HB ', 154.124, 91.913, 94.159]] AA_SCO= 1.5263157894736843 CA_SCO= 1.2565263157894737
[['B', ' N ', 153.58, 91.456, 97.388], ['B', ' CA ', 152.77, 90.636, 98.254], ['B', ' C ', 152.407, 91.386, 99.538], ['B', ' O ', 151.586, 90.904, 100.32], ['B', ' H ', 154.573, 91.222, 97.353], ['B', ' HA ', 151.864, 90.333, 97.73], ['B', ' HA ', 153.322, 89.728, 98.501]] AA_SCO= 1.5310526315789474 CA_SCO= 1.275157894736842
[['B', ' N ', 153.009, 92.556, 99.77], ['B', ' CA ', 152.67, 93.341, 100.936], ['B', ' C ', 151.622, 94.345, 100.542], ['B', ' O ', 151.906, 95.369, 99.916], ['B', ' CB ', 153.875, 94.1, 101.485], ['B', ' CG ', 154.872, 93.27, 102.152], ['B', ' CD1', 155.797, 92.581, 101.417], ['B', ' CD2', 154.883, 93.216, 103.532], ['B', ' CE1', 156.734, 91.811, 102.043], ['B', ' CE2', 155.824, 92.451, 104.172], ['B', ' CZ ', 156.748, 91.743, 103.427], ['B', ' OH ', 157.684, 90.964, 104.058], ['B', ' H ', 153.7, 92.928, 99.114], ['B', ' HA ', 152.258, 92.691, 101.707], ['B', ' HB ', 154.368, 94.626, 100.665], ['B', ' HB ', 153.53, 94.856, 102.194], ['B', ' HD1', 155.779, 92.64, 100.342], ['B', ' HD2', 154.144, 93.78, 104.11], ['B', ' HE1', 157.464, 91.256, 101.455], ['B', ' HE2', 155.841, 92.399, 105.261], ['B', ' HH ', 158.248, 90.542, 103.403]] AA_SCO= 1.5373684210526315 CA_SCO= 1.3212105263157894
[['B', ' N ', 150.408, 94.081, 100.97], ['B', ' CA ', 149.279, 94.911, 100.639], ['B', ' C ', 148.812, 95.643, 101.883], ['B', ' O ', 147.945, 96.521, 101.839], ['B', ' CB ', 148.178, 94.042, 100.041], ['B', ' OG1', 147.789, 93.047, 100.997], ['B', ' CG2', 148.718, 93.36, 98.776], ['B', ' H ', 150.23, 93.227, 101.487], ['B', ' HA ', 149.583, 95.646, 99.897], ['B', ' HB ', 147.313, 94.652, 99.786], ['B', ' HG1', 146.979, 92.619, 100.684], ['B', ' HG2', 147.934, 92.738, 98.34], ['B', ' HG2', 149.014, 94.119, 98.06], ['B', ' HG2', 149.578, 92.737, 99.015]] AA_SCO= 1.3568421052631578 CA_SCO= 1.3374736842105261
[['B', ' N ', 149.413, 95.282, 102.998], ['B', ' CA ', 149.12, 95.874, 104.276], ['B', ' C ', 150.402, 95.873, 105.084], ['B', ' O ', 151.107, 94.861, 105.123], ['B', ' CB ', 148.018, 95.093, 104.976], ['B', ' CG ', 147.541, 95.693, 106.274], ['B', ' CD ', 146.374, 94.941, 106.849], ['B', ' OE1', 146.597, 93.946, 107.493], ['B', ' OE2', 145.246, 95.354, 106.629], ['B', ' H ', 150.124, 94.574, 102.936], ['B', ' HA ', 148.786, 96.898, 104.136], ['B', ' HB ', 147.157, 95.005, 104.313], ['B', ' HB ', 148.371, 94.084, 105.186], ['B', ' HG ', 148.358, 95.679, 106.997], ['B', ' HG ', 147.256, 96.731, 106.105]] AA_SCO= 1.4352631578947368 CA_SCO= 1.3341052631578945
[['B', ' N ', 150.733, 97.015, 105.674], ['B', ' CA ', 151.912, 97.153, 106.516], ['B', ' C ', 151.804, 98.468, 107.297], ['B', ' O ', 151.112, 99.382, 106.844], ['B', ' CB ', 153.207, 97.081, 105.703], ['B', ' H ', 150.09, 97.794, 105.619], ['B', ' HA ', 151.91, 96.318, 107.221], ['B', ' HB ', 154.049, 97.149, 106.388], ['B', ' HB ', 153.258, 96.133, 105.176], ['B', ' HB ', 153.267, 97.871, 105.007]] AA_SCO= 1.6468421052631579 CA_SCO= 1.3345263157894733
[['B', ' N ', 152.466, 98.543, 108.459], ['B', ' CA ', 152.613, 99.707, 109.345], ['B', ' C ', 153.682, 99.406, 110.382], ['B', ' O ', 154.264, 98.318, 110.415], ['B', ' CB ', 151.267, 100.068, 110.04], ['B', ' SG ', 151.256, 101.546, 111.234], ['B', ' H ', 152.958, 97.68, 108.712], ['B', ' HA ', 152.939, 100.56, 108.744], ['B', ' HB ', 150.521, 100.261, 109.283], ['B', ' HB ', 150.913, 99.196, 110.603]] AA_SCO= 1.6178947368421053 CA_SCO= 1.3418421052631577
[['B', ' N ', 153.92, 100.321, 111.291], ['B', ' CA ', 154.722, 99.907, 112.393], ['B', ' C ', 153.713, 98.951, 112.989], ['B', ' O ', 152.582, 98.918, 112.527], ['B', ' H ', 153.503, 101.241, 111.245], ['B', ' HA ', 155.633, 99.404, 112.067], ['B', ' HA ', 154.96, 100.733, 113.054]] AA_SCO= 1.7768421052631582 CA_SCO= 1.3267894736842105
[['B', ' N ', 154.062, 98.188, 113.99], ['B', ' CA ', 153.2, 97.114, 114.527], ['B', ' C ', 153.522, 95.821, 113.76], ['B', ' O ', 153.481, 94.746, 114.347], ['B', ' CB ', 151.682, 97.337, 114.365], ['B', ' SG ', 151.045, 98.858, 115.075], ['B', ' H ', 154.981, 98.312, 114.388], ['B', ' HA ', 153.423, 96.972, 115.582], ['B', ' HB ', 151.339, 97.219, 113.333], ['B', ' HB ', 151.194, 96.533, 114.911], ['B', ' HG ', 151.523, 99.601, 114.05]] AA_SCO= 1.8010526315789477 CA_SCO= 1.7108947368421052
[['B', ' N ', 154.041, 95.914, 112.526], ['B', ' CA ', 154.529, 94.718, 111.832], ['B', ' C ', 155.805, 94.33, 112.544], ['B', ' O ', 156.126, 93.161, 112.789], ['B', ' CB ', 154.841, 95.03, 110.387], ['B', ' CG ', 153.626, 95.331, 109.615], ['B', ' OD1', 152.552, 94.949, 109.998], ['B', ' OD2', 153.762, 96.019, 108.644], ['B', ' H ', 154.047, 96.809, 112.019], ['B', ' HA ', 153.794, 93.919, 111.902], ['B', ' HB ', 155.518, 95.888, 110.327], ['B', ' HB ', 155.34, 94.178, 109.926]] AA_SCO= 1.8289473684210527 CA_SCO= 1.7371578947368418
[['B', ' N ', 156.439, 95.344, 113.073], ['B', ' CA ', 157.642, 95.191, 113.824], ['B', ' C ', 157.369, 94.637, 115.205], ['B', ' O ', 158.3, 94.488, 115.962], ['B', ' CB ', 158.327, 96.535, 113.957], ['B', ' CG ', 158.842, 97.155, 112.68], ['B', ' CD1', 159.283, 98.559, 112.977], ['B', ' CD2', 160.022, 96.339, 112.155], ['B', ' H ', 156.117, 96.275, 112.851], ['B', ' HA ', 158.278, 94.483, 113.312], ['B', ' HB ', 157.635, 97.231, 114.423], ['B', ' HB ', 159.179, 96.407, 114.624], ['B', ' HG ', 158.056, 97.189, 111.926], ['B', ' HD1', 159.658, 99.017, 112.063], ['B', ' HD1', 158.438, 99.139, 113.349], ['B', ' HD1', 160.064, 98.541, 113.73], ['B', ' HD2', 160.396, 96.806, 111.26], ['B', ' HD2', 160.816, 96.315, 112.905], ['B', ' HD2', 159.731, 95.328, 111.918]] AA_SCO= 1.8342105263157895 CA_SCO= 1.7471578947368416
[['B', ' N ', 156.094, 94.478, 115.589], ['B', ' CA ', 155.704, 93.871, 116.847], ['B', ' C ', 154.968, 92.561, 116.569], ['B', ' O ', 154.395, 91.97, 117.493], ['B', ' CB ', 154.778, 94.782, 117.643], ['B', ' CG ', 155.362, 96.085, 118.055], ['B', ' CD ', 156.495, 95.924, 119.002], ['B', ' OE1', 156.504, 95.003, 119.822], ['B', ' NE2', 157.443, 96.828, 118.928], ['B', ' H ', 155.33, 94.672, 114.951], ['B', ' HA ', 156.591, 93.645, 117.431], ['B', ' HB ', 153.887, 94.984, 117.052], ['B', ' HB ', 154.455, 94.263, 118.544], ['B', ' HG ', 155.738, 96.593, 117.169], ['B', ' HG ', 154.593, 96.688, 118.535], ['B', ' HE2', 158.221, 96.803, 119.553], ['B', ' HE2', 157.378, 97.567, 118.255]] AA_SCO= 1.8605263157894738 CA_SCO= 1.7594210526315788
[['B', ' N ', 154.914, 92.16, 115.296], ['B', ' CA ', 154.17, 90.987, 114.866], ['B', ' C ', 155.052, 89.957, 114.192], ['B', ' O ', 154.948, 88.757, 114.473], ['B', ' CB ', 153.06, 91.387, 113.879], ['B', ' OG1', 152.177, 92.325, 114.499], ['B', ' CG2', 152.264, 90.164, 113.462], ['B', ' H ', 155.418, 92.679, 114.589], ['B', ' HA ', 153.716, 90.525, 115.74], ['B', ' HB ', 153.502, 91.846, 113.001], ['B', ' HG1', 152.624, 93.203, 114.543], ['B', ' HG2', 151.48, 90.467, 112.772], ['B', ' HG2', 152.905, 89.435, 112.971], ['B', ' HG2', 151.816, 89.711, 114.346]] AA_SCO= 1.7426315789473683 CA_SCO= 1.7486842105263154
[['B', ' N ', 155.881, 90.428, 113.265], ['B', ' CA ', 156.746, 89.593, 112.454], ['B', ' C ', 158.198, 89.694, 112.93], ['B', ' O ', 158.984, 88.763, 112.773], ['B', ' CB ', 156.602, 90.06, 111.024], ['B', ' CG ', 155.211, 89.866, 110.465], ['B', ' CD ', 155.089, 90.388, 109.041], ['B', ' CE ', 153.661, 90.241, 108.528], ['B', ' NZ ', 153.507, 90.763, 107.142], ['B', ' H ', 155.879, 91.422, 113.083], ['B', ' HA ', 156.427, 88.555, 112.542], ['B', ' HB ', 156.798, 91.116, 110.992], ['B', ' HB ', 157.327, 89.556, 110.389], ['B', ' HG ', 154.96, 88.807, 110.486], ['B', ' HG ', 154.5, 90.399, 111.088], ['B', ' HD ', 155.367, 91.446, 109.015], ['B', ' HD ', 155.766, 89.838, 108.387], ['B', ' HE ', 153.382, 89.188, 108.542], ['B', ' HE ', 152.99, 90.794, 109.188], ['B', ' HZ ', 152.548, 90.651, 106.839], ['B', ' HZ ', 153.75, 91.748, 107.114], ['B', ' HZ ', 154.118, 90.241, 106.527]] AA_SCO= 1.873157894736842 CA_SCO= 1.8007368421052632
[['B', ' N ', 158.544, 90.851, 113.47], ['B', ' CA ', 159.859, 91.177, 114.007], ['B', ' C ', 159.576, 91.607, 115.433], ['B', ' O ', 158.416, 91.845, 115.744], ['B', ' CB ', 160.595, 92.2, 113.12], ['B', ' CG1', 161.91, 92.636, 113.722], ['B', ' CG2', 160.887, 91.535, 111.778], ['B', ' H ', 157.827, 91.572, 113.499], ['B', ' HA ', 160.465, 90.272, 114.042], ['B', ' HB ', 159.98, 93.07, 112.976], ['B', ' HG1', 162.386, 93.324, 113.043], ['B', ' HG1', 161.739, 93.14, 114.652], ['B', ' HG1', 162.556, 91.773, 113.873], ['B', ' HG2', 161.4, 92.239, 111.124], ['B', ' HG2', 161.517, 90.658, 111.933], ['B', ' HG2', 159.966, 91.219, 111.311]] AA_SCO= 2.0557894736842104 CA_SCO= 1.556578947368421
[['B', ' N ', 160.567, 91.522, 116.336], ['B', ' CA ', 160.442, 91.766, 117.81], ['B', ' C ', 159.741, 90.576, 118.392], ['B', ' O ', 160.274, 89.834, 119.225], ['B', ' CB ', 159.667, 93.034, 118.213], ['B', ' CG1', 159.448, 93.064, 119.705], ['B', ' CG2', 160.436, 94.265, 117.827], ['B', ' H ', 161.457, 91.26, 115.945], ['B', ' HA ', 161.429, 91.822, 118.257], ['B', ' HB ', 158.716, 93.029, 117.757], ['B', ' HG1', 158.902, 93.968, 119.965], ['B', ' HG1', 158.87, 92.206, 120.031], ['B', ' HG1', 160.401, 93.058, 120.208], ['B', ' HG2', 159.85, 95.134, 118.113], ['B', ' HG2', 161.374, 94.283, 118.334], ['B', ' HG2', 160.594, 94.278, 116.752]] AA_SCO= 2.075263157894737 CA_SCO= 1.5737368421052629
[['B', ' N ', 158.562, 90.359, 117.896], ['B', ' CA ', 157.842, 89.229, 118.255], ['B', ' C ', 158.605, 88.195, 117.495], ['B', ' O ', 159.619, 88.501, 116.849], ['B', ' CB ', 156.442, 89.389, 117.763], ['B', ' CG ', 155.486, 88.594, 118.424], ['B', ' OD1', 155.776, 87.449, 118.819], ['B', ' ND2', 154.317, 89.153, 118.568], ['B', ' H ', 158.173, 91.021, 117.242], ['B', ' HA ', 157.895, 89.035, 119.326], ['B', ' HB ', 156.18, 90.416, 117.892], ['B', ' HB ', 156.41, 89.178, 116.698], ['B', ' HD2', 153.571, 88.669, 119.022], ['B', ' HD2', 154.178, 90.102, 118.2]] AA_SCO= 2.0563157894736843 CA_SCO= 1.6139473684210526
[['B', ' N ', 158.209, 86.975, 117.617], ['B', ' CA ', 158.906, 85.891, 116.963], ['B', ' C ', 160.369, 85.75, 117.449], ['B', ' O ', 161.069, 84.887, 116.926], ['B', ' CB ', 158.969, 86.103, 115.439], ['B', ' CG ', 157.68, 86.43, 114.749], ['B', ' CD ', 156.655, 85.405, 114.858], ['B', ' OE1', 156.933, 84.205, 114.98], ['B', ' NE2', 155.418, 85.856, 114.798], ['B', ' H ', 157.369, 86.801, 118.168], ['B', ' HA ', 158.381, 84.96, 117.181], ['B', ' HB ', 159.694, 86.864, 115.171], ['B', ' HB ', 159.314, 85.185, 114.98], ['B', ' HG ', 157.273, 87.353, 115.151], ['B', ' HG ', 157.899, 86.574, 113.7], ['B', ' HE2', 154.643, 85.228, 114.861], ['B', ' HE2', 155.253, 86.868, 114.681]] AA_SCO= 2.1173684210526313 CA_SCO= 1.6027894736842103
[['B', ' N ', 160.841, 86.563, 118.43], ['B', ' CA ', 162.195, 86.458, 118.957], ['B', ' C ', 163.261, 87.031, 118.024], ['B', ' O ', 164.425, 86.656, 118.127], ['B', ' H ', 160.264, 87.311, 118.827], ['B', ' HA ', 162.238, 86.981, 119.912], ['B', ' HA ', 162.42, 85.414, 119.163]] AA_SCO= 2.3699999999999997 CA_SCO= 1.6019999999999996
[['B', ' N ', 162.885, 87.907, 117.099], ['B', ' CA ', 163.888, 88.4, 116.159], ['B', ' C ', 164.561, 89.774, 116.331], ['B', ' O ', 165.706, 89.938, 115.918], ['B', ' CB ', 163.261, 88.348, 114.773], ['B', ' CG ', 162.86, 86.978, 114.238], ['B', ' CD1', 162.188, 87.164, 112.898], ['B', ' CD2', 164.079, 86.104, 114.074], ['B', ' H ', 161.898, 88.184, 117.032], ['B', ' HA ', 164.708, 87.695, 116.189], ['B', ' HB ', 162.366, 88.961, 114.787], ['B', ' HB ', 163.925, 88.749, 114.081], ['B', ' HG ', 162.153, 86.5, 114.914], ['B', ' HD1', 161.894, 86.189, 112.505], ['B', ' HD1', 161.301, 87.786, 113.015], ['B', ' HD1', 162.873, 87.642, 112.2], ['B', ' HD2', 163.786, 85.156, 113.658], ['B', ' HD2', 164.77, 86.588, 113.399], ['B', ' HD2', 164.57, 85.925, 115.023]] AA_SCO= 2.3568421052631576 CA_SCO= 1.610315789473684
[['B', ' N ', 163.919, 90.781, 116.894], ['B', ' CA ', 164.565, 92.106, 116.838], ['B', ' C ', 165.786, 92.158, 117.722], ['B', ' O ', 165.808, 91.561, 118.801], ['B', ' CB ', 163.661, 93.257, 117.209], ['B', ' SG ', 164.395, 94.897, 116.951], ['B', ' H ', 163.02, 90.633, 117.327], ['B', ' HA ', 164.885, 92.282, 115.811], ['B', ' HB ', 162.775, 93.206, 116.629], ['B', ' HB ', 163.397, 93.176, 118.261], ['B', ' HG ', 163.235, 95.54, 116.864]] AA_SCO= 2.353684210526316 CA_SCO= 1.5976315789473685
[['B', ' N ', 166.823, 92.821, 117.226], ['B', ' CA ', 168.071, 92.956, 117.939], ['B', ' C ', 168.447, 94.405, 118.307], ['B', ' O ', 169.606, 94.701, 118.563], ['B', ' CB ', 169.172, 92.194, 117.181], ['B', ' CG1', 170.454, 91.951, 118.085], ['B', ' CG2', 169.531, 92.938, 115.899], ['B', ' CD1', 170.206, 91.143, 119.388], ['B', ' H ', 166.712, 93.292, 116.341], ['B', ' HA ', 167.95, 92.419, 118.853], ['B', ' HB ', 168.789, 91.207, 116.909], ['B', ' HG1', 171.159, 91.378, 117.493], ['B', ' HG1', 170.926, 92.875, 118.338], ['B', ' HG2', 170.279, 92.368, 115.349], ['B', ' HG2', 168.648, 93.049, 115.281], ['B', ' HG2', 169.936, 93.927, 116.131], ['B', ' HD1', 171.143, 91.009, 119.911], ['B', ' HD1', 169.532, 91.654, 120.048], ['B', ' HD1', 169.804, 90.204, 119.149]] AA_SCO= 2.4321052631578945 CA_SCO= 1.5955263157894737
[['B', ' N ', 167.512, 95.348, 118.262], ['B', ' CA ', 167.894, 96.708, 118.655], ['B', ' C ', 168.79, 97.343, 117.598], ['B', ' O ', 169.718, 98.097, 117.921], ['B', ' H ', 166.556, 95.112, 118.034], ['B', ' HA ', 167.008, 97.31, 118.819], ['B', ' HA ', 168.414, 96.674, 119.609]] AA_SCO= 2.6231578947368424 CA_SCO= 1.5967894736842105
[['B', ' N ', 168.547, 96.974, 116.348], ['B', ' CA ', 169.365, 97.42, 115.248], ['B', ' C ', 169.324, 98.886, 114.869], ['B', ' O ', 170.3, 99.4, 114.349], ['B', ' CB ', 168.925, 96.66, 114.019], ['B', ' SG ', 167.246, 97.067, 113.578], ['B', ' H ', 167.784, 96.342, 116.163], ['B', ' HA ', 170.389, 97.14, 115.484], ['B', ' HB ', 169.58, 96.892, 113.175], ['B', ' HB ', 168.987, 95.589, 114.201], ['B', ' HG ', 167.539, 98.263, 112.986]] AA_SCO= 2.621578947368421 CA_SCO= 1.6025789473684209
[['B', ' N ', 168.213, 99.564, 115.061], ['B', ' CA ', 168.11, 100.981, 114.714], ['B', ' C ', 167.661, 101.267, 113.275], ['B', ' O ', 167.209, 102.374, 112.986], ['B', ' H ', 167.405, 99.115, 115.477], ['B', ' HA ', 167.434, 101.488, 115.385], ['B', ' HA ', 169.07, 101.451, 114.896]] AA_SCO= 2.6357894736842096 CA_SCO= 1.5966315789473684
[['B', ' N ', 167.734, 100.285, 112.368], ['B', ' CA ', 167.339, 100.565, 110.967], ['B', ' C ', 165.827, 100.804, 110.87], ['B', ' O ', 165.355, 101.671, 110.112], ['B', ' CB ', 167.679, 99.408, 110.094], ['B', ' OG1', 166.962, 98.335, 110.56], ['B', ' CG2', 169.095, 99.098, 110.15], ['B', ' H ', 168.061, 99.361, 112.622], ['B', ' HA ', 167.868, 101.454, 110.62], ['B', ' HB ', 167.399, 99.622, 109.063], ['B', ' HG1', 166.246, 98.19, 109.906], ['B', ' HG2', 169.257, 98.247, 109.514], ['B', ' HG2', 169.66, 99.932, 109.778], ['B', ' HG2', 169.404, 98.87, 111.163]] AA_SCO= 2.648421052631579 CA_SCO= 1.5983684210526317
[['B', ' N ', 165.056, 100.071, 111.694], ['B', ' CA ', 163.659, 100.259, 111.949], ['B', ' C ', 163.602, 101.405, 112.96], ['B', ' O ', 164.03, 101.271, 114.105], ['B', ' CB ', 162.962, 98.946, 112.37], ['B', ' SG ', 163.783, 97.877, 113.688], ['B', ' H ', 165.537, 99.336, 112.214], ['B', ' HA ', 163.169, 100.591, 111.023], ['B', ' HB ', 161.974, 99.182, 112.734], ['B', ' HB ', 162.825, 98.362, 111.502]] AA_SCO= 2.620526315789473 CA_SCO= 1.6132105263157892
[['B', ' N ', 163.071, 102.51, 112.472], ['B', ' CA ', 163.117, 103.862, 113.024], ['B', ' C ', 164.007, 104.73, 112.113], ['B', ' O ', 163.512, 105.747, 111.621], ['B', ' CB ', 163.628, 103.906, 114.459], ['B', ' H ', 162.685, 102.413, 111.551], ['B', ' HA ', 162.13, 104.272, 112.993], ['B', ' HB ', 163.617, 104.941, 114.8], ['B', ' HB ', 162.981, 103.315, 115.096], ['B', ' HB ', 164.651, 103.528, 114.518]] AA_SCO= 2.6263157894736837 CA_SCO= 1.6134210526315789
[['B', ' N ', 165.241, 104.326, 111.751], ['B', ' CA ', 166.04, 105.182, 110.854], ['B', ' C ', 165.317, 105.446, 109.547], ['B', ' O ', 165.39, 106.539, 108.987], ['B', ' CB ', 167.358, 104.535, 110.451], ['B', ' CG ', 168.32, 105.485, 109.709], ['B', ' SD ', 169.894, 104.725, 109.379], ['B', ' CE ', 170.629, 105.668, 108.072], ['B', ' H ', 165.691, 103.486, 112.131], ['B', ' HA ', 166.234, 106.128, 111.349], ['B', ' HB ', 167.837, 104.053, 111.26], ['B', ' HB ', 167.126, 103.734, 109.751], ['B', ' HG ', 167.888, 105.846, 108.78], ['B', ' HG ', 168.503, 106.334, 110.353], ['B', ' HE ', 171.614, 105.262, 107.835], ['B', ' HE ', 169.998, 105.602, 107.192], ['B', ' HE ', 170.732, 106.706, 108.378]] AA_SCO= 2.6521052631578943 CA_SCO= 1.6174736842105262
[['B', ' N ', 164.624, 104.428, 109.061], ['B', ' CA ', 163.901, 104.448, 107.8], ['B', ' C ', 162.417, 104.787, 107.897], ['B', ' O ', 161.679, 104.571, 106.936], ['B', ' CB ', 164.013, 103.098, 107.166], ['B', ' H ', 164.676, 103.543, 109.577], ['B', ' HA ', 164.378, 105.193, 107.163], ['B', ' HB ', 163.535, 103.129, 106.205], ['B', ' HB ', 165.036, 102.842, 107.047], ['B', ' HB ', 163.531, 102.359, 107.805]] AA_SCO= 2.6184210526315783 CA_SCO= 1.6063684210526314
[['B', ' N ', 161.928, 105.237, 109.041], ['B', ' CA ', 160.486, 105.457, 109.14], ['B', ' C ', 159.892, 106.484, 108.17], ['B', ' O ', 158.747, 106.326, 107.757], ['B', ' CB ', 160.07, 105.794, 110.544], ['B', ' SG ', 158.278, 105.878, 110.714], ['B', ' H ', 162.553, 105.421, 109.836], ['B', ' HA ', 160.01, 104.505, 108.912], ['B', ' HB ', 160.442, 105.026, 111.209], ['B', ' HB ', 160.508, 106.73, 110.851], ['B', ' HG ', 157.999, 105.072, 109.686]] AA_SCO= 2.563157894736842 CA_SCO= 1.6059473684210526
[['B', ' N ', 160.613, 107.581, 107.903], ['B', ' CA ', 160.221, 108.692, 106.996], ['B', ' C ', 159.052, 109.583, 107.424], ['B', ' O ', 158.67, 110.489, 106.692], ['B', ' CB ', 159.865, 108.121, 105.627], ['B', ' CG ', 160.976, 107.387, 104.941], ['B', ' CD ', 160.427, 106.522, 103.884], ['B', ' OE1', 160.158, 106.805, 102.699], ['B', ' NE2', 160.202, 105.351, 104.349], ['B', ' H ', 161.54, 107.632, 108.315], ['B', ' HA ', 161.095, 109.335, 106.873], ['B', ' HB ', 159.014, 107.481, 105.696], ['B', ' HB ', 159.588, 108.941, 104.969], ['B', ' HG ', 161.65, 108.113, 104.482], ['B', ' HG ', 161.523, 106.77, 105.644], ['B', ' HE2', 159.801, 104.666, 103.766], ['B', ' HE2', 160.473, 105.121, 105.319]] AA_SCO= 2.766315789473684 CA_SCO= 1.4734736842105263
[['B', ' N ', 158.52, 109.372, 108.613], ['B', ' CA ', 157.547, 110.266, 109.22], ['B', ' C ', 158.11, 110.498, 110.596], ['B', ' O ', 157.708, 111.384, 111.354], ['B', ' CB ', 156.15, 109.674, 109.358], ['B', ' OG1', 156.18, 108.594, 110.284], ['B', ' CG2', 155.666, 109.173, 108.049], ['B', ' H ', 158.828, 108.583, 109.158], ['B', ' HA ', 157.507, 111.214, 108.68], ['B', ' HB ', 155.465, 110.442, 109.727], ['B', ' HG1', 155.228, 108.393, 110.506], ['B', ' HG2', 154.671, 108.766, 108.188], ['B', ' HG2', 155.63, 109.992, 107.335], ['B', ' HG2', 156.33, 108.394, 107.675]] AA_SCO= 2.752105263157895 CA_SCO= 1.4758421052631576
[['B', ' N ', 159.074, 109.64, 110.899], ['B', ' CA ', 159.712, 109.495, 112.187], ['B', ' C ', 158.735, 109.116, 113.292], ['B', ' O ', 158.917, 109.496, 114.446], ['B', ' CB ', 160.495, 110.74, 112.539], ['B', ' CG ', 161.611, 111.019, 111.555], ['B', ' CD ', 162.421, 112.197, 111.929], ['B', ' NE ', 163.541, 112.399, 110.986], ['B', ' CZ ', 164.442, 113.412, 111.033], ['B', ' NH1', 164.37, 114.339, 111.959], ['B', ' NH2', 165.412, 113.471, 110.138], ['B', ' H ', 159.358, 109.025, 110.153], ['B', ' HA ', 160.438, 108.687, 112.111], ['B', ' HB ', 159.846, 111.609, 112.588], ['B', ' HB ', 160.948, 110.614, 113.523], ['B', ' HG ', 162.266, 110.157, 111.517], ['B', ' HG ', 161.197, 111.178, 110.571], ['B', ' HD ', 161.792, 113.086, 111.918], ['B', ' HD ', 162.826, 112.054, 112.927], ['B', ' HE ', 163.655, 111.714, 110.251], ['B', ' HH1', 163.641, 114.322, 112.654], ['B', ' HH1', 165.051, 115.091, 111.975], ['B', ' HH2', 165.485, 112.764, 109.423], ['B', ' HH2', 166.093, 114.224, 110.182]] AA_SCO= 2.6984210526315793 CA_SCO= 1.7098947368421051
[['B', ' N ', 157.731, 108.3, 112.941], ['B', ' CA ', 156.797, 107.753, 113.906], ['B', ' C ', 157.508, 106.81, 114.858], ['B', ' O ', 157.133, 106.683, 116.021], ['B', ' CB ', 155.682, 107.005, 113.212], ['B', ' H ', 157.581, 108.075, 111.958], ['B', ' HA ', 156.379, 108.579, 114.476], ['B', ' HB ', 154.978, 106.635, 113.948], ['B', ' HB ', 155.189, 107.67, 112.553], ['B', ' HB ', 156.083, 106.176, 112.652]] AA_SCO= 2.6652631578947372 CA_SCO= 1.717157894736842
[['B', ' N ', 158.506, 106.099, 114.362], ['B', ' CA ', 159.231, 105.156, 115.183], ['B', ' C ', 160.456, 105.742, 115.83], ['B', ' O ', 161.241, 106.459, 115.206], ['B', ' CB ', 159.672, 103.988, 114.341], ['B', ' CG ', 158.652, 103.092, 113.789], ['B', ' CD1', 159.304, 102.198, 112.835], ['B', ' CD2', 158.066, 102.256, 114.886], ['B', ' H ', 158.769, 106.209, 113.394], ['B', ' HA ', 158.573, 104.822, 115.975], ['B', ' HB ', 160.127, 104.417, 113.496], ['B', ' HB ', 160.407, 103.402, 114.895], ['B', ' HG ', 157.874, 103.664, 113.282], ['B', ' HD1', 158.546, 101.529, 112.441], ['B', ' HD1', 159.742, 102.78, 112.029], ['B', ' HD1', 160.083, 101.621, 113.335], ['B', ' HD2', 157.334, 101.565, 114.474], ['B', ' HD2', 158.853, 101.7, 115.361], ['B', ' HD2', 157.598, 102.868, 115.605]] AA_SCO= 2.621578947368421 CA_SCO= 1.7314210526315785
[['B', ' N ', 160.651, 105.345, 117.07], ['B', ' CA ', 161.784, 105.737, 117.889], ['B', ' C ', 162.114, 104.537, 118.759], ['B', ' O ', 161.216, 104.014, 119.412], ['B', ' CB ', 161.418, 106.965, 118.727], ['B', ' CG ', 162.594, 107.604, 119.439], ['B', ' OD1', 163.658, 107.06, 119.365], ['B', ' OD2', 162.417, 108.643, 120.045], ['B', ' H ', 159.908, 104.774, 117.491], ['B', ' HA ', 162.641, 105.963, 117.254], ['B', ' HB ', 160.953, 107.711, 118.078], ['B', ' HB ', 160.675, 106.676, 119.473]] AA_SCO= 2.5600000000000005 CA_SCO= 1.7496842105263157
[['B', ' N ', 163.303, 103.961, 118.663], ['B', ' CA ', 163.506, 102.77, 119.469], ['B', ' C ', 163.787, 103.14, 120.904], ['B', ' O ', 164.637, 103.982, 121.189], ['B', ' CB ', 164.634, 101.902, 118.932], ['B', ' CG ', 164.379, 101.365, 117.555], ['B', ' SD ', 165.617, 100.283, 116.961], ['B', ' CE ', 165.073, 98.687, 117.376], ['B', ' H ', 164.043, 104.387, 118.118], ['B', ' HA ', 162.594, 102.204, 119.474], ['B', ' HB ', 165.54, 102.492, 118.886], ['B', ' HB ', 164.808, 101.068, 119.613], ['B', ' HG ', 163.474, 100.833, 117.535], ['B', ' HG ', 164.294, 102.191, 116.857], ['B', ' HE ', 165.782, 97.958, 117.017], ['B', ' HE ', 164.951, 98.6, 118.448], ['B', ' HE ', 164.141, 98.524, 116.877]] AA_SCO= 2.5131578947368425 CA_SCO= 1.7505789473684212
[['B', ' N ', 163.096, 102.473, 121.815], ['B', ' CA ', 163.255, 102.703, 123.229], ['B', ' C ', 163.608, 101.384, 123.86], ['B', ' O ', 163.04, 100.349, 123.536], ['B', ' CB ', 161.957, 103.293, 123.819], ['B', ' OG1', 160.87, 102.369, 123.622], ['B', ' CG2', 161.629, 104.589, 123.075], ['B', ' H ', 162.42, 101.775, 121.506], ['B', ' HA ', 164.073, 103.402, 123.395], ['B', ' HB ', 162.084, 103.488, 124.883], ['B', ' HG1', 160.006, 102.796, 123.855], ['B', ' HG2', 160.709, 105.012, 123.48], ['B', ' HG2', 162.444, 105.3, 123.2], ['B', ' HG2', 161.487, 104.388, 122.017]] AA_SCO= 2.475263157894737 CA_SCO= 1.7511052631578947
[['B', ' N ', 164.607, 101.394, 124.72], ['B', ' CA ', 165.053, 100.183, 125.39], ['B', ' C ', 165.373, 99.074, 124.385], ['B', ' O ', 165.128, 97.899, 124.65], ['B', ' CB ', 164.006, 99.718, 126.369], ['B', ' CG ', 163.776, 100.71, 127.424], ['B', ' OD1', 164.72, 101.226, 128.037], ['B', ' ND2', 162.532, 101.018, 127.648], ['B', ' H ', 165.044, 102.276, 124.937], ['B', ' HA ', 165.973, 100.403, 125.933], ['B', ' HB ', 163.066, 99.51, 125.862], ['B', ' HB ', 164.332, 98.788, 126.833], ['B', ' HD2', 162.295, 101.691, 128.348], ['B', ' HD2', 161.817, 100.583, 127.1]] AA_SCO= 2.488947368421053 CA_SCO= 1.7616842105263155
[['B', ' N ', 165.925, 99.44, 123.23], ['B', ' CA ', 166.284, 98.457, 122.223], ['B', ' C ', 165.109, 97.941, 121.375], ['B', ' O ', 165.264, 96.93, 120.687], ['B', ' H ', 166.134, 100.414, 123.063], ['B', ' HA ', 167.034, 98.893, 121.562], ['B', ' HA ', 166.763, 97.611, 122.715]] AA_SCO= 2.4757894736842108 CA_SCO= 1.7737894736842104
[['B', ' N ', 163.939, 98.577, 121.424], ['B', ' CA ', 162.798, 98.099, 120.65], ['B', ' C ', 162.066, 99.246, 119.997], ['B', ' O ', 161.876, 100.282, 120.617], ['B', ' CB ', 161.766, 97.45, 121.545], ['B', ' CG ', 162.177, 96.274, 122.278], ['B', ' CD ', 162.428, 95.129, 121.431], ['B', ' NE ', 162.707, 94.023, 122.251], ['B', ' CZ ', 163.894, 93.769, 122.798], ['B', ' NH1', 164.933, 94.562, 122.592], ['B', ' NH2', 164.02, 92.717, 123.581], ['B', ' H ', 163.812, 99.365, 122.063], ['B', ' HA ', 163.162, 97.406, 119.9], ['B', ' HB ', 161.472, 98.183, 122.299], ['B', ' HB ', 160.87, 97.2, 120.988], ['B', ' HG ', 163.065, 96.51, 122.856], ['B', ' HG ', 161.379, 96.0, 122.965], ['B', ' HD ', 161.542, 94.921, 120.852], ['B', ' HD ', 163.267, 95.289, 120.764], ['B', ' HE ', 161.948, 93.384, 122.452], ['B', ' HH1', 164.881, 95.383, 121.974], ['B', ' HH1', 165.829, 94.332, 123.046], ['B', ' HH2', 163.227, 92.114, 123.753], ['B', ' HH2', 164.916, 92.526, 124.015]] AA_SCO= 2.288421052631579 CA_SCO= 1.763157894736842
[['B', ' N ', 161.545, 99.1, 118.793], ['B', ' CA ', 160.825, 100.159, 118.157], ['B', ' C ', 159.562, 100.444, 118.93], ['B', ' O ', 158.812, 99.517, 119.235], ['B', ' CB ', 160.547, 99.564, 116.78], ['B', ' CG ', 160.573, 98.066, 116.981], ['B', ' CD ', 161.522, 97.816, 118.108], ['B', ' HA ', 161.42, 101.066, 118.069], ['B', ' HB ', 159.571, 99.894, 116.429], ['B', ' HB ', 161.298, 99.924, 116.05], ['B', ' HG ', 159.559, 97.688, 117.186], ['B', ' HG ', 160.906, 97.576, 116.049], ['B', ' HD ', 161.085, 97.051, 118.742], ['B', ' HD ', 162.48, 97.518, 117.734]] AA_SCO= 2.2857894736842104 CA_SCO= 1.7515789473684216
[['B', ' N ', 159.284, 101.716, 119.155], ['B', ' CA ', 158.069, 102.169, 119.791], ['B', ' C ', 157.39, 103.034, 118.758], ['B', ' O ', 158.039, 103.887, 118.144], ['B', ' CB ', 158.374, 102.926, 121.082], ['B', ' CG ', 157.156, 103.418, 121.832], ['B', ' CD ', 157.485, 104.084, 123.149], ['B', ' OE1', 158.4, 103.655, 123.835], ['B', ' OE2', 156.813, 105.032, 123.472], ['B', ' H ', 159.983, 102.431, 118.947], ['B', ' HA ', 157.429, 101.315, 120.018], ['B', ' HB ', 158.942, 102.278, 121.749], ['B', ' HB ', 159.002, 103.789, 120.858], ['B', ' HG ', 156.624, 104.136, 121.206], ['B', ' HG ', 156.493, 102.576, 122.013]] AA_SCO= 2.354736842105263 CA_SCO= 1.7276315789473686
[['B', ' N ', 156.114, 102.784, 118.497], ['B', ' CA ', 155.451, 103.527, 117.444], ['B', ' C ', 154.524, 104.638, 117.872], ['B', ' O ', 153.486, 104.414, 118.507], ['B', ' CB ', 154.617, 102.551, 116.601], ['B', ' CG ', 153.824, 103.159, 115.43], ['B', ' CD1', 154.798, 103.673, 114.374], ['B', ' CD2', 152.86, 102.133, 114.879], ['B', ' H ', 155.613, 102.081, 119.023], ['B', ' HA ', 156.217, 103.99, 116.836], ['B', ' HB ', 155.28, 101.793, 116.196], ['B', ' HB ', 153.901, 102.058, 117.259], ['B', ' HG ', 153.261, 103.995, 115.775], ['B', ' HD1', 154.265, 104.114, 113.563], ['B', ' HD1', 155.456, 104.419, 114.794], ['B', ' HD1', 155.385, 102.858, 113.998], ['B', ' HD2', 152.289, 102.56, 114.058], ['B', ' HD2', 153.391, 101.283, 114.534], ['B', ' HD2', 152.175, 101.824, 115.667]] AA_SCO= 2.3668421052631574 CA_SCO= 1.7274210526315792
[['B', ' N ', 154.804, 105.833, 117.391], ['B', ' CA ', 153.924, 106.938, 117.631], ['B', ' C ', 152.894, 106.804, 116.548], ['B', ' O ', 153.055, 107.356, 115.462], ['B', ' CB ', 154.659, 108.256, 117.518], ['B', ' CG ', 153.821, 109.424, 117.865], ['B', ' OD1', 152.598, 109.306, 117.939], ['B', ' ND2', 154.44, 110.556, 118.082], ['B', ' H ', 155.68, 105.998, 116.891], ['B', ' HA ', 153.44, 106.838, 118.603], ['B', ' HB ', 155.537, 108.24, 118.165], ['B', ' HB ', 155.016, 108.38, 116.499], ['B', ' HD2', 153.919, 111.379, 118.327], ['B', ' HD2', 155.439, 110.6, 118.011]] AA_SCO= 2.2578947368421054 CA_SCO= 1.725578947368421
[['B', ' N ', 151.825, 106.089, 116.854], ['B', ' CA ', 150.843, 105.704, 115.855], ['B', ' C ', 150.166, 106.875, 115.186], ['B', ' O ', 149.799, 106.774, 114.018], ['B', ' CB ', 149.812, 104.806, 116.483], ['B', ' OG ', 149.049, 105.507, 117.415], ['B', ' H ', 151.787, 105.685, 117.792], ['B', ' HA ', 151.356, 105.135, 115.081], ['B', ' HB ', 149.166, 104.393, 115.711], ['B', ' HB ', 150.317, 103.971, 116.973], ['B', ' HG ', 148.438, 104.868, 117.795]] AA_SCO= 2.369473684210526 CA_SCO= 1.7011578947368422
[['B', ' N ', 150.152, 108.031, 115.836], ['B', ' CA ', 149.566, 109.245, 115.278], ['B', ' C ', 150.322, 109.686, 114.025], ['B', ' O ', 149.819, 110.473, 113.225], ['B', ' CB ', 149.606, 110.37, 116.309], ['B', ' CG ', 148.625, 110.182, 117.473], ['B', ' OD1', 147.708, 109.402, 117.366], ['B', ' OD2', 148.831, 110.809, 118.481], ['B', ' H ', 150.463, 108.044, 116.801], ['B', ' HA ', 148.53, 109.042, 115.005], ['B', ' HB ', 150.612, 110.45, 116.711], ['B', ' HB ', 149.385, 111.315, 115.817]] AA_SCO= 2.3468421052631583 CA_SCO= 1.6896315789473686
[['B', ' N ', 151.56, 109.231, 113.882], ['B', ' CA ', 152.381, 109.564, 112.733], ['B', ' C ', 152.657, 108.385, 111.767], ['B', ' O ', 153.539, 108.524, 110.905], ['B', ' CB ', 153.704, 110.135, 113.191], ['B', ' CG ', 153.602, 111.418, 113.938], ['B', ' CD ', 154.934, 111.961, 114.267], ['B', ' NE ', 155.636, 112.348, 113.065], ['B', ' CZ ', 155.461, 113.495, 112.398], ['B', ' NH1', 154.606, 114.413, 112.803], ['B', ' NH2', 156.172, 113.682, 111.317], ['B', ' H ', 151.935, 108.568, 114.564], ['B', ' HA ', 151.862, 110.337, 112.166], ['B', ' HB ', 154.167, 109.429, 113.869], ['B', ' HB ', 154.372, 110.272, 112.341], ['B', ' HG ', 153.055, 112.137, 113.335], ['B', ' HG ', 153.063, 111.251, 114.873], ['B', ' HD ', 154.841, 112.828, 114.918], ['B', ' HD ', 155.524, 111.191, 114.77], ['B', ' HE ', 156.342, 111.7, 112.675], ['B', ' HH1', 154.072, 114.299, 113.673], ['B', ' HH1', 154.504, 115.267, 112.28], ['B', ' HH2', 156.828, 112.94, 111.054], ['B', ' HH2', 156.093, 114.536, 110.776]] AA_SCO= 2.375263157894737 CA_SCO= 1.702421052631579
[['B', ' N ', 151.954, 107.216, 111.913], ['B', ' CA ', 152.128, 106.065, 111.03], ['B', ' C ', 151.169, 106.306, 109.893], ['B', ' O ', 150.036, 106.754, 110.063], ['B', ' CB ', 151.854, 104.676, 111.652], ['B', ' SG ', 152.309, 103.214, 110.482], ['B', ' H ', 151.231, 107.161, 112.643], ['B', ' HA ', 153.151, 106.05, 110.646], ['B', ' HB ', 152.412, 104.574, 112.562], ['B', ' HB ', 150.791, 104.577, 111.937]] AA_SCO= 2.3126315789473684 CA_SCO= 1.6891052631578949
[['B', ' N ', 151.653, 106.042, 108.728], ['B', ' CA ', 150.912, 106.226, 107.52], ['B', ' C ', 150.729, 104.942, 106.777], ['B', ' O ', 150.398, 104.948, 105.6], ['B', ' CB ', 151.639, 107.25, 106.689], ['B', ' CG1', 153.031, 106.739, 106.501], ['B', ' CG2', 151.605, 108.575, 107.381], ['B', ' CD1', 153.81, 107.413, 105.533], ['B', ' H ', 152.587, 105.664, 108.678], ['B', ' HA ', 149.931, 106.621, 107.773], ['B', ' HB ', 151.174, 107.336, 105.708], ['B', ' HG1', 153.554, 106.851, 107.442], ['B', ' HG1', 153.003, 105.703, 106.244], ['B', ' HG2', 152.125, 109.305, 106.801], ['B', ' HG2', 150.577, 108.888, 107.499], ['B', ' HG2', 152.071, 108.506, 108.359], ['B', ' HD1', 154.767, 106.979, 105.541], ['B', ' HD1', 153.355, 107.274, 104.579], ['B', ' HD1', 153.905, 108.461, 105.76]] AA_SCO= 2.364736842105263 CA_SCO= 1.7995263157894739
[['B', ' N ', 150.922, 103.83, 107.454], ['B', ' CA ', 150.805, 102.537, 106.794], ['B', ' C ', 151.703, 102.423, 105.549], ['B', ' O ', 151.256, 102.054, 104.474], ['B', ' CB ', 149.339, 102.223, 106.487], ['B', ' CG ', 148.466, 102.094, 107.751], ['B', ' CD ', 147.024, 101.75, 107.41], ['B', ' CE ', 146.124, 101.609, 108.64], ['B', ' NZ ', 146.541, 100.496, 109.52], ['B', ' H ', 151.157, 103.88, 108.438], ['B', ' HA ', 151.142, 101.78, 107.499], ['B', ' HB ', 148.906, 102.985, 105.839], ['B', ' HB ', 149.287, 101.277, 105.944], ['B', ' HG ', 148.862, 101.297, 108.34], ['B', ' HG ', 148.523, 102.993, 108.335], ['B', ' HD ', 146.626, 102.568, 106.825], ['B', ' HD ', 146.985, 100.84, 106.811], ['B', ' HE ', 146.149, 102.527, 109.206], ['B', ' HE ', 145.102, 101.43, 108.306], ['B', ' HZ ', 145.921, 100.439, 110.318], ['B', ' HZ ', 146.516, 99.622, 109.011], ['B', ' HZ ', 147.477, 100.689, 109.829]] AA_SCO= 2.292105263157895 CA_SCO= 1.8000526315789473
[['B', ' N ', 152.974, 102.82, 105.702], ['B', ' CA ', 154.047, 102.759, 104.737], ['B', ' C ', 154.888, 101.624, 105.296], ['B', ' O ', 155.335, 101.67, 106.447], ['B', ' CB ', 154.765, 104.124, 104.675], ['B', ' SG ', 156.138, 104.308, 103.587], ['B', ' H ', 153.234, 103.156, 106.622], ['B', ' HA ', 153.664, 102.496, 103.748], ['B', ' HB ', 154.037, 104.864, 104.346], ['B', ' HB ', 155.102, 104.427, 105.676]] AA_SCO= 2.291052631578948 CA_SCO= 1.808157894736842
[['B', ' N ', 155.134, 100.611, 104.486], ['B', ' CA ', 155.808, 99.409, 104.96], ['B', ' C ', 157.322, 99.49, 105.026], ['B', ' O ', 157.977, 98.501, 105.365], ['B', ' H ', 154.762, 100.632, 103.543], ['B', ' HA ', 155.424, 99.169, 105.953], ['B', ' HA ', 155.525, 98.577, 104.317]] AA_SCO= 2.2947368421052636 CA_SCO= 1.8053684210526313
[['B', ' N ', 157.895, 100.646, 104.75], ['B', ' CA ', 159.338, 100.748, 104.77], ['B', ' C ', 159.928, 100.422, 106.098], ['B', ' O ', 160.954, 99.745, 106.19], ['B', ' CB ', 159.844, 102.104, 104.35], ['B', ' CG1', 159.558, 102.346, 102.898], ['B', ' CG2', 161.356, 102.229, 104.666], ['B', ' CD1', 160.216, 101.393, 101.943], ['B', ' H ', 157.319, 101.44, 104.497], ['B', ' HA ', 159.701, 100.02, 104.089], ['B', ' HB ', 159.297, 102.868, 104.902], ['B', ' HG1', 158.483, 102.331, 102.726], ['B', ' HG1', 159.925, 103.305, 102.668], ['B', ' HG2', 161.728, 103.203, 104.374], ['B', ' HG2', 161.536, 102.116, 105.725], ['B', ' HG2', 161.918, 101.481, 104.14], ['B', ' HD1', 160.005, 101.677, 100.968], ['B', ' HD1', 161.27, 101.425, 102.075], ['B', ' HD1', 159.879, 100.386, 102.066]] AA_SCO= 2.4694736842105267 CA_SCO= 1.7196315789473686
[['B', ' N ', 159.281, 100.844, 107.146], ['B', ' CA ', 159.806, 100.571, 108.451], ['B', ' C ', 159.975, 99.071, 108.716], ['B', ' O ', 160.665, 98.694, 109.657], ['B', ' CB ', 158.913, 101.23, 109.479], ['B', ' SG ', 157.203, 100.699, 109.462], ['B', ' H ', 158.427, 101.379, 107.025], ['B', ' HA ', 160.789, 101.04, 108.519], ['B', ' HB ', 159.317, 100.988, 110.432], ['B', ' HB ', 158.939, 102.31, 109.363], ['B', ' HG ', 157.457, 99.391, 109.456]] AA_SCO= 2.561578947368421 CA_SCO= 1.4183157894736838
[['B', ' N ', 159.329, 98.219, 107.917], ['B', ' CA ', 159.456, 96.788, 108.041], ['B', ' C ', 160.51, 96.258, 107.07], ['B', ' O ', 161.361, 95.444, 107.452], ['B', ' CB ', 158.135, 96.1, 107.767], ['B', ' CG ', 158.244, 94.658, 107.923], ['B', ' CD1', 158.264, 94.132, 109.176], ['B', ' CD2', 158.354, 93.847, 106.82], ['B', ' CE1', 158.386, 92.805, 109.339], ['B', ' CE2', 158.481, 92.508, 106.989], ['B', ' CZ ', 158.494, 91.982, 108.238], ['B', ' OH ', 158.626, 90.629, 108.404], ['B', ' H ', 158.772, 98.577, 107.142], ['B', ' HA ', 159.779, 96.551, 109.05], ['B', ' HB ', 157.372, 96.47, 108.454], ['B', ' HB ', 157.802, 96.316, 106.753], ['B', ' HD1', 158.182, 94.783, 110.048], ['B', ' HD2', 158.346, 94.274, 105.817], ['B', ' HE1', 158.403, 92.404, 110.335], ['B', ' HE2', 158.574, 91.86, 106.129], ['B', ' HH ', 158.865, 90.221, 107.564]] AA_SCO= 2.6078947368421055 CA_SCO= 1.3661578947368418
[['B', ' N ', 160.487, 96.748, 105.811], ['B', ' CA ', 161.388, 96.226, 104.77], ['B', ' C ', 162.805, 96.607, 105.108], ['B', ' O ', 163.724, 96.082, 104.512], ['B', ' CB ', 161.094, 96.734, 103.334], ['B', ' CG1', 161.661, 98.118, 103.097], ['B', ' CG2', 161.651, 95.745, 102.284], ['B', ' H ', 159.763, 97.434, 105.572], ['B', ' HA ', 161.317, 95.138, 104.764], ['B', ' HB ', 160.009, 96.817, 103.232], ['B', ' HG1', 161.383, 98.455, 102.1], ['B', ' HG1', 161.296, 98.776, 103.813], ['B', ' HG1', 162.748, 98.105, 103.162], ['B', ' HG2', 161.401, 96.097, 101.286], ['B', ' HG2', 162.731, 95.656, 102.363], ['B', ' HG2', 161.206, 94.762, 102.439]] AA_SCO= 2.6257894736842107 CA_SCO= 1.2920526315789471
[['B', ' N ', 162.982, 97.594, 105.983], ['B', ' CA ', 164.299, 97.994, 106.449], ['B', ' C ', 164.781, 97.469, 107.831], ['B', ' O ', 165.821, 97.95, 108.27], ['B', ' CB ', 164.458, 99.517, 106.448], ['B', ' CG ', 164.423, 100.179, 105.093], ['B', ' CD ', 165.521, 99.753, 104.197], ['B', ' OE1', 166.472, 99.074, 104.583], ['B', ' NE2', 165.44, 100.181, 102.969], ['B', ' H ', 162.153, 98.083, 106.325], ['B', ' HA ', 164.994, 97.614, 105.724], ['B', ' HB ', 163.654, 99.952, 107.042], ['B', ' HB ', 165.4, 99.792, 106.923], ['B', ' HG ', 163.491, 99.911, 104.622], ['B', ' HG ', 164.485, 101.247, 105.19], ['B', ' HE2', 166.17, 99.934, 102.309], ['B', ' HE2', 164.668, 100.797, 102.688]] AA_SCO= 2.6068421052631585 CA_SCO= 1.2816842105263158
[['B', ' N ', 164.084, 96.515, 108.542], ['B', ' CA ', 164.568, 96.001, 109.859], ['B', ' C ', 165.272, 94.659, 109.475], ['B', ' O ', 164.567, 93.691, 109.161], ['B', ' CB ', 163.424, 95.787, 110.909], ['B', ' SG ', 164.0, 95.71, 112.779], ['B', ' H ', 163.2, 96.144, 108.155], ['B', ' HA ', 165.244, 96.707, 110.306], ['B', ' HB ', 162.643, 96.488, 110.779], ['B', ' HB ', 162.924, 94.828, 110.716]] AA_SCO= 2.5057894736842106 CA_SCO= 1.2821052631578946
[['B', ' N ', 166.627, 94.511, 109.567], ['B', ' CA ', 167.487, 93.428, 109.059], ['B', ' C ', 167.361, 92.086, 109.744], ['B', ' O ', 168.352, 91.479, 110.152], ['B', ' CB ', 168.868, 94.009, 109.312], ['B', ' CG ', 168.687, 94.81, 110.509], ['B', ' CD ', 167.362, 95.461, 110.293], ['B', ' HA ', 167.397, 93.315, 108.005], ['B', ' HB ', 169.62, 93.221, 109.431], ['B', ' HB ', 169.163, 94.62, 108.446], ['B', ' HG ', 168.713, 94.171, 111.406], ['B', ' HG ', 169.499, 95.536, 110.619], ['B', ' HD ', 166.888, 95.678, 111.233], ['B', ' HD ', 167.511, 96.319, 109.651]] AA_SCO= 2.670526315789474 CA_SCO= 1.293263157894737
[['B', ' N ', 166.12, 91.654, 109.865], ['B', ' CA ', 165.656, 90.403, 110.364], ['B', ' C ', 164.735, 89.847, 109.321], ['B', ' O ', 164.6, 88.65, 109.143], ['B', ' CB ', 164.88, 90.624, 111.639], ['B', ' CG ', 165.595, 90.446, 112.93], ['B', ' CD ', 166.749, 91.268, 113.126], ['B', ' NE ', 167.962, 90.574, 112.751], ['B', ' CZ ', 168.606, 89.62, 113.499], ['B', ' NH1', 168.14, 89.226, 114.687], ['B', ' NH2', 169.719, 89.087, 113.033], ['B', ' H ', 165.387, 92.243, 109.502], ['B', ' HA ', 166.491, 89.724, 110.52], ['B', ' HB ', 164.472, 91.637, 111.633], ['B', ' HB ', 164.029, 89.942, 111.654], ['B', ' HG ', 164.904, 90.738, 113.698], ['B', ' HG ', 165.879, 89.403, 113.048], ['B', ' HD ', 166.672, 92.18, 112.538], ['B', ' HD ', 166.82, 91.537, 114.176], ['B', ' HE ', 168.352, 90.821, 111.832], ['B', ' HH1', 167.265, 89.6, 115.075], ['B', ' HH1', 168.65, 88.535, 115.261], ['B', ' HH2', 170.084, 89.38, 112.137], ['B', ' HH2', 170.207, 88.386, 113.57]] AA_SCO= 2.6700000000000004 CA_SCO= 1.2990000000000002
[['B', ' N ', 164.07, 90.755, 108.639], ['B', ' CA ', 162.958, 90.387, 107.763], ['B', ' C ', 163.153, 89.99, 106.302], ['B', ' O ', 162.21, 89.47, 105.705], ['B', ' CB ', 162.007, 91.552, 107.728], ['B', ' OG ', 162.628, 92.648, 107.132], ['B', ' H ', 164.27, 91.753, 108.809], ['B', ' HA ', 162.455, 89.55, 108.249], ['B', ' HB ', 161.129, 91.28, 107.159], ['B', ' HB ', 161.687, 91.809, 108.734], ['B', ' HG ', 162.013, 93.404, 107.205]] AA_SCO= 2.6110526315789473 CA_SCO= 1.324684210526316
[['B', ' N ', 164.289, 90.265, 105.68], ['B', ' CA ', 164.29, 90.115, 104.224], ['B', ' C ', 165.56, 89.819, 103.386], ['B', ' O ', 165.456, 89.29, 102.282], ['B', ' CB ', 163.542, 91.353, 103.709], ['B', ' CG ', 163.545, 91.589, 102.284], ['B', ' CD1', 162.818, 90.982, 101.33], ['B', ' CD2', 164.269, 92.61, 101.633], ['B', ' NE1', 163.086, 91.551, 100.126], ['B', ' CE2', 163.967, 92.546, 100.309], ['B', ' CE3', 165.104, 93.549, 102.058], ['B', ' CZ2', 164.513, 93.409, 99.412], ['B', ' CZ3', 165.661, 94.408, 101.165], ['B', ' CH2', 165.376, 94.327, 99.88], ['B', ' H ', 165.073, 90.637, 106.182], ['B', ' HA ', 163.631, 89.274, 104.021], ['B', ' HB ', 162.496, 91.284, 104.001], ['B', ' HB ', 163.933, 92.234, 104.203], ['B', ' HD1', 162.127, 90.163, 101.499], ['B', ' HE1', 162.69, 91.319, 99.19], ['B', ' HE3', 165.314, 93.618, 103.084], ['B', ' HZ2', 164.275, 93.383, 98.365], ['B', ' HZ3', 166.337, 95.168, 101.53], ['B', ' HH2', 165.829, 95.016, 99.203]] AA_SCO= 2.5294736842105263 CA_SCO= 1.3140526315789476
[['B', ' N ', 166.715, 90.285, 103.817], ['B', ' CA ', 167.84, 90.517, 102.923], ['B', ' C ', 168.731, 89.446, 102.316], ['B', ' O ', 169.179, 88.506, 102.979], ['B', ' CB ', 168.832, 91.418, 103.605], ['B', ' CG ', 168.424, 92.761, 103.669], ['B', ' CD1', 168.863, 93.769, 102.881], ['B', ' CD2', 167.472, 93.322, 104.528], ['B', ' NE1', 168.287, 94.904, 103.241], ['B', ' CE2', 167.42, 94.648, 104.239], ['B', ' CE3', 166.661, 92.817, 105.517], ['B', ' CZ2', 166.626, 95.447, 104.892], ['B', ' CZ3', 165.845, 93.616, 106.116], ['B', ' CH2', 165.828, 94.864, 105.842], ['B', ' H ', 166.783, 90.582, 104.764], ['B', ' HA ', 167.359, 91.094, 102.155], ['B', ' HB ', 168.986, 91.064, 104.616], ['B', ' HB ', 169.797, 91.377, 103.095], ['B', ' HD1', 169.596, 93.678, 102.101], ['B', ' HE1', 168.48, 95.854, 102.855], ['B', ' HE3', 166.67, 91.806, 105.813], ['B', ' HZ2', 166.579, 96.51, 104.672], ['B', ' HZ3', 165.188, 93.212, 106.875], ['B', ' HH2', 165.152, 95.428, 106.375]] AA_SCO= 2.5968421052631583 CA_SCO= 1.2830526315789477
[['B', ' N ', 169.141, 89.698, 101.052], ['B', ' CA ', 170.077, 88.968, 100.248], ['B', ' C ', 171.473, 89.331, 100.668], ['B', ' O ', 172.117, 90.168, 100.025], ['B', ' CB ', 169.797, 89.462, 98.842], ['B', ' CG ', 169.374, 90.867, 99.042], ['B', ' CD ', 168.589, 90.874, 100.297], ['B', ' HA ', 169.902, 87.886, 100.345], ['B', ' HB ', 170.686, 89.344, 98.218], ['B', ' HB ', 169.014, 88.84, 98.383], ['B', ' HG ', 170.257, 91.498, 99.132], ['B', ' HG ', 168.827, 91.24, 98.196], ['B', ' HD ', 168.805, 91.83, 100.776], ['B', ' HD ', 167.515, 90.738, 100.047]] AA_SCO= 2.5277777777777777 CA_SCO= 1.2709444444444447
[['B', ' N ', 171.95, 88.734, 101.732], ['B', ' CA ', 173.272, 89.097, 102.218], ['B', ' C ', 174.319, 88.894, 101.134], ['B', ' O ', 175.315, 89.623, 101.092], ['B', ' CB ', 173.619, 88.31, 103.463], ['B', ' CG ', 172.823, 88.745, 104.652], ['B', ' CD ', 173.09, 87.948, 105.864], ['B', ' OE1', 173.797, 86.953, 105.775], ['B', ' OE2', 172.593, 88.335, 106.904], ['B', ' H ', 171.365, 88.053, 102.231], ['B', ' HA ', 173.263, 90.15, 102.481], ['B', ' HB ', 173.429, 87.251, 103.289], ['B', ' HB ', 174.679, 88.427, 103.69], ['B', ' HG ', 173.084, 89.778, 104.853], ['B', ' HG ', 171.759, 88.705, 104.41]] AA_SCO= 2.502352941176471 CA_SCO= 1.2427647058823528
[['B', ' N ', 174.112, 87.913, 100.262], ['B', ' CA ', 175.042, 87.681, 99.186], ['B', ' C ', 175.085, 88.837, 98.173], ['B', ' O ', 176.132, 89.048, 97.561], ['B', ' CB ', 174.675, 86.373, 98.468], ['B', ' CG ', 173.283, 86.345, 97.755], ['B', ' CD ', 172.123, 86.002, 98.669], ['B', ' OE1', 172.292, 86.074, 99.866], ['B', ' OE2', 171.07, 85.689, 98.173], ['B', ' H ', 173.302, 87.296, 100.362], ['B', ' HA ', 176.036, 87.571, 99.617], ['B', ' HB ', 175.429, 86.157, 97.713], ['B', ' HB ', 174.694, 85.555, 99.187], ['B', ' HG ', 173.074, 87.28, 97.261], ['B', ' HG ', 173.335, 85.585, 96.978]] AA_SCO= 2.5081249999999997 CA_SCO= 1.1991249999999998
[['B', ' N ', 173.987, 89.604, 98.002], ['B', ' CA ', 173.987, 90.723, 97.064], ['B', ' C ', 174.792, 91.832, 97.669], ['B', ' O ', 175.533, 92.541, 96.99], ['B', ' CB ', 172.577, 91.239, 96.789], ['B', ' CG ', 172.472, 92.33, 95.72], ['B', ' CD ', 172.875, 91.851, 94.35], ['B', ' OE1', 172.6, 90.7, 93.991], ['B', ' NE2', 173.497, 92.717, 93.559], ['B', ' H ', 173.143, 89.434, 98.547], ['B', ' HA ', 174.454, 90.41, 96.131], ['B', ' HB ', 171.945, 90.412, 96.478], ['B', ' HB ', 172.161, 91.64, 97.71], ['B', ' HG ', 171.45, 92.663, 95.668], ['B', ' HG ', 173.116, 93.174, 95.988], ['B', ' HE2', 173.765, 92.461, 92.632], ['B', ' HE2', 173.694, 93.678, 93.863]] AA_SCO= 2.5866666666666664 CA_SCO= 1.1667333333333334
[['B', ' N ', 174.647, 91.954, 98.975], ['B', ' CA ', 175.333, 92.995, 99.701], ['B', ' C ', 176.81, 92.755, 99.643], ['B', ' O ', 177.582, 93.689, 99.44], ['B', ' CB ', 174.852, 93.037, 101.142], ['B', ' CG1', 173.424, 93.522, 101.109], ['B', ' CG2', 175.759, 93.925, 101.989], ['B', ' CD1', 172.698, 93.373, 102.347], ['B', ' H ', 173.983, 91.325, 99.439], ['B', ' HA ', 175.118, 93.951, 99.236], ['B', ' HB ', 174.85, 92.037, 101.556], ['B', ' HG1', 173.424, 94.575, 100.845], ['B', ' HG1', 172.881, 92.97, 100.342], ['B', ' HG2', 175.404, 93.946, 103.007], ['B', ' HG2', 176.778, 93.544, 101.992], ['B', ' HG2', 175.755, 94.936, 101.573], ['B', ' HD1', 171.717, 93.753, 102.189], ['B', ' HD1', 172.643, 92.333, 102.632], ['B', ' HD1', 173.177, 93.939, 103.131]] AA_SCO= 2.476428571428571 CA_SCO= 1.1615
[['B', ' N ', 177.225, 91.519, 99.848], ['B', ' CA ', 178.632, 91.23, 99.757], ['B', ' C ', 179.119, 91.405, 98.318], ['B', ' O ', 180.159, 92.014, 98.092], ['B', ' CB ', 178.908, 89.838, 100.3], ['B', ' CG ', 178.731, 89.77, 101.813], ['B', ' CD ', 178.961, 88.382, 102.377], ['B', ' CE ', 178.745, 88.371, 103.902], ['B', ' NZ ', 178.924, 87.015, 104.493], ['B', ' H ', 176.548, 90.785, 100.082], ['B', ' HA ', 179.169, 91.945, 100.379], ['B', ' HB ', 178.218, 89.126, 99.84], ['B', ' HB ', 179.922, 89.534, 100.048], ['B', ' HG ', 179.427, 90.466, 102.281], ['B', ' HG ', 177.717, 90.086, 102.063], ['B', ' HD ', 178.262, 87.683, 101.913], ['B', ' HD ', 179.978, 88.059, 102.158], ['B', ' HE ', 179.459, 89.052, 104.369], ['B', ' HE ', 177.733, 88.716, 104.12], ['B', ' HZ ', 178.772, 87.066, 105.522], ['B', ' HZ ', 178.261, 86.375, 104.09], ['B', ' HZ ', 179.861, 86.685, 104.323]] AA_SCO= 2.5815384615384613 CA_SCO= 1.1032307692307692
[['B', ' N ', 178.327, 90.985, 97.323], ['B', ' CA ', 178.727, 91.118, 95.924], ['B', ' C ', 179.062, 92.564, 95.575], ['B', ' O ', 180.041, 92.833, 94.875], ['B', ' CB ', 177.608, 90.611, 95.008], ['B', ' CG ', 177.919, 90.603, 93.516], ['B', ' CD ', 176.74, 90.01, 92.723], ['B', ' CE ', 177.028, 89.949, 91.225], ['B', ' NZ ', 175.868, 89.387, 90.452], ['B', ' H ', 177.463, 90.478, 97.527], ['B', ' HA ', 179.619, 90.515, 95.762], ['B', ' HB ', 177.335, 89.599, 95.302], ['B', ' HB ', 176.727, 91.233, 95.145], ['B', ' HG ', 178.101, 91.626, 93.177], ['B', ' HG ', 178.816, 90.012, 93.335], ['B', ' HD ', 176.53, 89.002, 93.084], ['B', ' HD ', 175.852, 90.624, 92.891], ['B', ' HE ', 177.247, 90.95, 90.857], ['B', ' HE ', 177.899, 89.314, 91.062], ['B', ' HZ ', 176.092, 89.353, 89.467], ['B', ' HZ ', 175.65, 88.446, 90.778], ['B', ' HZ ', 175.067, 89.987, 90.587]] AA_SCO= 2.5558333333333336 CA_SCO= 1.0344166666666668
[['B', ' N ', 178.27, 93.497, 96.086], ['B', ' CA ', 178.472, 94.923, 95.825], ['B', ' C ', 179.411, 95.698, 96.791], ['B', ' O ', 179.543, 96.917, 96.621], ['B', ' CB ', 177.118, 95.647, 95.816], ['B', ' CG ', 176.172, 95.195, 94.721], ['B', ' CD ', 174.897, 96.013, 94.621], ['B', ' OE1', 174.813, 97.083, 95.185], ['B', ' OE2', 173.976, 95.532, 94.008], ['B', ' H ', 177.442, 93.196, 96.612], ['B', ' HA ', 178.902, 95.006, 94.829], ['B', ' HB ', 176.618, 95.477, 96.775], ['B', ' HB ', 177.273, 96.719, 95.712], ['B', ' HG ', 176.697, 95.243, 93.769], ['B', ' HG ', 175.912, 94.151, 94.903]] AA_SCO= 2.5736363636363637 CA_SCO= 0.9546363636363636
[['B', ' N ', 180.005, 95.034, 97.818], ['B', ' CA ', 180.842, 95.643, 98.876], ['B', ' C ', 182.32, 95.187, 98.771], ['B', ' O ', 182.718, 94.15, 99.315], ['B', ' OXT', 183.156, 95.998, 98.358], ['B', ' CB ', 180.194, 95.308, 100.274], ['B', ' CG ', 180.899, 95.829, 101.648], ['B', ' CD1', 180.867, 97.411, 101.727], ['B', ' CD2', 180.135, 95.185, 102.889], ['B', ' H ', 179.889, 94.016, 97.865], ['B', ' HA ', 180.831, 96.723, 98.756], ['B', ' HB ', 179.159, 95.68, 100.265], ['B', ' HB ', 180.134, 94.212, 100.341], ['B', ' HG ', 181.96, 95.508, 101.664], ['B', ' HD1', 181.352, 97.747, 102.65], ['B', ' HD1', 181.406, 97.838, 100.878], ['B', ' HD1', 179.835, 97.773, 101.715], ['B', ' HD2', 180.602, 95.509, 103.824], ['B', ' HD2', 179.087, 95.492, 102.891], ['B', ' HD2', 180.185, 94.096, 102.832]] AA_SCO= 2.3609999999999998 CA_SCO= 1.0283
[['A', ' N ', 127.544, 122.825, 67.273], ['A', ' CA ', 128.994, 123.016, 67.42], ['A', ' C ', 129.617, 121.873, 68.259], ['A', ' O ', 129.011, 121.45, 69.25], ['A', ' CB ', 129.267, 124.383, 68.057], ['A', ' OG ', 128.845, 125.399, 67.21], ['A', ' H ', 127.098, 123.727, 67.158], ['A', ' H ', 127.352, 122.249, 66.465], ['A', ' H ', 127.181, 122.372, 68.105], ['A', ' HA ', 129.436, 123.02, 66.413], ['A', ' HB ', 128.761, 124.484, 69.023], ['A', ' HB ', 130.323, 124.508, 68.246], ['A', ' HG ', 129.091, 126.253, 67.664]]
[['A', ' N ', 130.795, 121.37, 67.827], ['A', ' CA ', 131.571, 120.307, 68.471], ['A', ' C ', 132.375, 120.817, 69.654], ['A', ' O ', 132.625, 122.024, 69.788], ['A', ' CB ', 132.495, 119.604, 67.466], ['A', ' CG ', 133.727, 120.383, 66.989], ['A', ' CD ', 133.436, 121.33, 65.849], ['A', ' OE1', 132.292, 121.71, 65.676], ['A', ' OE2', 134.352, 121.649, 65.132], ['A', ' H ', 131.204, 121.768, 66.976], ['A', ' HA ', 130.883, 119.548, 68.851], ['A', ' HB ', 132.854, 118.674, 67.906], ['A', ' HB ', 131.918, 119.338, 66.581], ['A', ' HG ', 134.15, 120.949, 67.817], ['A', ' HG ', 134.48, 119.667, 66.669]]
[['A', ' N ', 132.733, 119.889, 70.531], ['A', ' CA ', 133.551, 120.243, 71.657], ['A', ' C ', 134.856, 119.518, 71.576], ['A', ' O ', 134.924, 118.36, 71.162], ['A', ' CB ', 132.883, 119.874, 72.966], ['A', ' CG ', 131.593, 120.562, 73.174], ['A', ' CD ', 131.104, 120.476, 74.566], ['A', ' NE ', 130.777, 119.116, 74.963], ['A', ' CZ ', 130.241, 118.767, 76.159], ['A', ' NH1', 129.967, 119.68, 77.076], ['A', ' NH2', 129.97, 117.5, 76.41], ['A', ' H ', 132.468, 118.925, 70.383], ['A', ' HA ', 133.743, 121.312, 71.635], ['A', ' HB ', 132.72, 118.8, 73.009], ['A', ' HB ', 133.542, 120.143, 73.796], ['A', ' HG ', 131.708, 121.592, 72.881], ['A', ' HG ', 130.844, 120.101, 72.533], ['A', ' HD ', 131.871, 120.858, 75.233], ['A', ' HD ', 130.206, 121.089, 74.66], ['A', ' HE ', 130.955, 118.376, 74.297], ['A', ' HH1', 130.155, 120.654, 76.907], ['A', ' HH1', 129.514, 119.399, 77.971], ['A', ' HH2', 130.164, 116.792, 75.719], ['A', ' HH2', 129.553, 117.24, 77.303]]
[['A', ' N ', 135.881, 120.19, 72.019], ['A', ' CA ', 137.185, 119.614, 72.084], ['A', ' C ', 137.364, 119.197, 73.511], ['A', ' O ', 137.375, 120.035, 74.413], ['A', ' CB ', 138.248, 120.66, 71.717], ['A', ' CG1', 137.916, 121.32, 70.348], ['A', ' CG2', 139.654, 120.052, 71.752], ['A', ' CD1', 137.797, 120.398, 69.16], ['A', ' H ', 135.723, 121.146, 72.33], ['A', ' HA ', 137.251, 118.736, 71.445], ['A', ' HB ', 138.204, 121.449, 72.441], ['A', ' HG1', 136.976, 121.855, 70.45], ['A', ' HG1', 138.69, 122.039, 70.13], ['A', ' HG2', 140.387, 120.824, 71.522], ['A', ' HG2', 139.857, 119.655, 72.745], ['A', ' HG2', 139.738, 119.251, 71.026], ['A', ' HD1', 137.565, 120.99, 68.275], ['A', ' HD1', 138.734, 119.872, 68.998], ['A', ' HD1', 136.997, 119.678, 69.322]]
[['A', ' N ', 137.46, 117.908, 73.743], ['A', ' CA ', 137.566, 117.456, 75.108], ['A', ' C ', 138.841, 116.702, 75.312], ['A', ' O ', 139.079, 115.675, 74.676], ['A', ' CB ', 136.363, 116.589, 75.468], ['A', ' CG1', 136.505, 116.092, 76.898], ['A', ' CG2', 135.096, 117.431, 75.291], ['A', ' H ', 137.453, 117.251, 72.972], ['A', ' HA ', 137.574, 118.315, 75.773], ['A', ' HB ', 136.32, 115.719, 74.816], ['A', ' HG1', 135.644, 115.482, 77.165], ['A', ' HG1', 137.405, 115.491, 77.011], ['A', ' HG1', 136.562, 116.937, 77.572], ['A', ' HG2', 134.222, 116.839, 75.548], ['A', ' HG2', 135.164, 118.282, 75.941], ['A', ' HG2', 135.009, 117.767, 74.261]]
[['A', ' N ', 139.65, 117.202, 76.219], ['A', ' CA ', 140.914, 116.571, 76.476], ['A', ' C ', 140.932, 116.02, 77.896], ['A', ' O ', 141.005, 116.783, 78.859], ['A', ' CB ', 142.036, 117.603, 76.288], ['A', ' CG1', 141.951, 118.21, 74.854], ['A', ' CG2', 143.374, 116.905, 76.485], ['A', ' CD1', 142.826, 119.429, 74.617], ['A', ' H ', 139.36, 118.057, 76.706], ['A', ' HA ', 141.059, 115.748, 75.781], ['A', ' HB ', 141.925, 118.407, 77.01], ['A', ' HG1', 142.222, 117.439, 74.134], ['A', ' HG1', 140.931, 118.516, 74.661], ['A', ' HG2', 144.195, 117.599, 76.371], ['A', ' HG2', 143.407, 116.494, 77.466], ['A', ' HG2', 143.482, 116.103, 75.756], ['A', ' HD1', 142.685, 119.783, 73.592], ['A', ' HD1', 142.539, 120.219, 75.311], ['A', ' HD1', 143.871, 119.184, 74.763]]
[['A', ' N ', 140.85, 114.693, 78.0], ['A', ' CA ', 140.862, 113.947, 79.265], ['A', ' C ', 142.196, 114.029, 80.048], ['A', ' O ', 142.173, 114.069, 81.275], ['A', ' CB ', 140.426, 112.512, 79.035], ['A', ' OG ', 140.479, 111.778, 80.218], ['A', ' H ', 140.768, 114.171, 77.138], ['A', ' HA ', 140.098, 114.392, 79.905], ['A', ' HB ', 139.396, 112.525, 78.679], ['A', ' HB ', 141.003, 112.027, 78.274], ['A', ' HG ', 140.159, 110.905, 80.001]]
[['A', ' N ', 143.373, 113.834, 79.412], ['A', ' CA ', 144.68, 113.981, 80.009], ['A', ' C ', 144.985, 115.456, 80.201], ['A', ' O ', 144.4, 116.3, 79.542], ['A', ' CB ', 145.575, 113.3, 78.998], ['A', ' CG ', 144.863, 113.435, 77.719], ['A', ' CD ', 143.447, 113.346, 78.018], ['A', ' HA ', 144.698, 113.457, 80.976], ['A', ' HB ', 146.543, 113.808, 78.971], ['A', ' HB ', 145.752, 112.253, 79.286], ['A', ' HG ', 145.132, 114.371, 77.219], ['A', ' HG ', 145.133, 112.623, 77.075], ['A', ' HD ', 143.022, 113.986, 77.283], ['A', ' HD ', 143.137, 112.308, 77.926]]
[['A', ' N ', 145.943, 115.772, 81.051], ['A', ' CA ', 146.312, 117.158, 81.303], ['A', ' C ', 147.663, 117.529, 80.738], ['A', ' O ', 148.175, 118.611, 81.025], ['A', ' CB ', 146.396, 117.406, 82.801], ['A', ' OG1', 147.417, 116.598, 83.36], ['A', ' CG2', 145.152, 116.996, 83.393], ['A', ' H ', 146.423, 115.06, 81.582], ['A', ' HA ', 145.557, 117.81, 80.862], ['A', ' HB ', 146.583, 118.454, 83.014], ['A', ' HG1', 147.573, 116.88, 84.281], ['A', ' HG2', 145.202, 117.138, 84.456], ['A', ' HG2', 144.364, 117.601, 82.962], ['A', ' HG2', 144.959, 115.952, 83.193]]
[['A', ' N ', 148.246, 116.635, 79.955], ['A', ' CA ', 149.615, 116.788, 79.482], ['A', ' C ', 150.556, 116.818, 80.658], ['A', ' O ', 150.334, 116.137, 81.66], ['A', ' CB ', 149.801, 118.052, 78.662], ['A', ' OG ', 151.104, 118.118, 78.149], ['A', ' H ', 147.721, 115.808, 79.72], ['A', ' HA ', 149.869, 115.932, 78.854], ['A', ' HB ', 149.089, 118.043, 77.838], ['A', ' HB ', 149.614, 118.941, 79.239], ['A', ' HG ', 151.024, 118.578, 77.29]]
[['A', ' N ', 151.6, 117.621, 80.572], ['A', ' CA ', 152.624, 117.619, 81.606], ['A', ' C ', 152.262, 118.553, 82.748], ['A', ' O ', 152.908, 119.578, 82.973], ['A', ' CB ', 153.928, 117.992, 80.956], ['A', ' CG ', 154.36, 116.971, 79.923], ['A', ' CD ', 155.688, 117.247, 79.413], ['A', ' NE ', 155.722, 118.528, 78.822], ['A', ' CZ ', 155.387, 118.859, 77.566], ['A', ' NH1', 155.016, 117.971, 76.697], ['A', ' NH2', 155.428, 120.107, 77.222], ['A', ' H ', 151.702, 118.18, 79.732], ['A', ' HA ', 152.717, 116.611, 82.004], ['A', ' HB ', 153.836, 118.963, 80.473], ['A', ' HB ', 154.712, 118.062, 81.677], ['A', ' HG ', 154.358, 115.99, 80.389], ['A', ' HG ', 153.658, 116.968, 79.09], ['A', ' HD ', 156.41, 117.228, 80.235], ['A', ' HD ', 155.961, 116.518, 78.668], ['A', ' HE ', 156.006, 119.281, 79.435], ['A', ' HH1', 154.982, 117.009, 76.958], ['A', ' HH1', 154.743, 118.278, 75.768], ['A', ' HH2', 155.698, 120.814, 77.9], ['A', ' HH2', 155.157, 120.418, 76.272]]
[['A', ' N ', 151.197, 118.158, 83.447], ['A', ' CA ', 150.547, 118.839, 84.57], ['A', ' C ', 150.035, 117.86, 85.59], ['A', ' O ', 148.861, 117.865, 85.952], ['A', ' CB ', 149.406, 119.708, 84.054], ['A', ' CG ', 149.87, 120.838, 83.225], ['A', ' CD ', 150.521, 121.806, 84.124], ['A', ' OE1', 149.79, 122.511, 84.748], ['A', ' NE2', 151.827, 121.811, 84.267], ['A', ' H ', 150.784, 117.282, 83.105], ['A', ' HA ', 151.282, 119.447, 85.084], ['A', ' HB ', 148.751, 119.106, 83.452], ['A', ' HB ', 148.832, 120.106, 84.89], ['A', ' HG ', 150.544, 120.537, 82.446], ['A', ' HG ', 148.997, 121.315, 82.782], ['A', ' HE2', 152.274, 122.442, 84.965], ['A', ' HE2', 152.378, 121.123, 83.75]]
[['A', ' N ', 150.915, 116.979, 86.015], ['A', ' CA ', 150.662, 115.918, 86.99], ['A', ' C ', 149.69, 114.881, 86.431], ['A', ' O ', 150.085, 113.757, 86.111], ['A', ' CB ', 150.112, 116.465, 88.311], ['A', ' CG ', 151.026, 117.444, 88.993], ['A', ' CD ', 152.363, 116.899, 89.224], ['A', ' OE1', 152.484, 115.725, 89.473], ['A', ' OE2', 153.295, 117.653, 89.103], ['A', ' H ', 151.854, 117.052, 85.648], ['A', ' HA ', 151.602, 115.41, 87.198], ['A', ' HB ', 149.145, 116.933, 88.181], ['A', ' HB ', 149.967, 115.636, 88.999], ['A', ' HG ', 151.103, 118.34, 88.38], ['A', ' HG ', 150.58, 117.73, 89.948]]
[['A', ' N ', 148.427, 115.285, 86.275], ['A', ' CA ', 147.379, 114.443, 85.72], ['A', ' C ', 145.977, 114.727, 86.251], ['A', ' O ', 145.758, 115.631, 87.048], ['A', ' H ', 148.224, 116.242, 86.548], ['A', ' HA ', 147.382, 114.537, 84.637], ['A', ' HA ', 147.63, 113.405, 85.921]]
[['A', ' N ', 145.039, 113.91, 85.794], ['A', ' CA ', 143.634, 113.913, 86.194], ['A', ' C ', 142.751, 115.152, 86.093], ['A', ' O ', 142.112, 115.524, 87.082], ['A', ' CB ', 143.538, 113.45, 87.62], ['A', ' CG ', 144.132, 112.125, 87.879], ['A', ' ND1', 144.247, 111.617, 89.143], ['A', ' CD2', 144.642, 111.181, 87.052], ['A', ' CE1', 144.793, 110.433, 89.088], ['A', ' NE2', 145.044, 110.149, 87.834], ['A', ' H ', 145.328, 113.212, 85.125], ['A', ' HA ', 143.131, 113.162, 85.585], ['A', ' HB ', 143.983, 114.178, 88.256], ['A', ' HB ', 142.5, 113.389, 87.878], ['A', ' HD2', 144.722, 111.214, 85.97], ['A', ' HE1', 145.003, 109.802, 89.937], ['A', ' HE2', 145.479, 109.276, 87.506]]
[['A', ' N ', 142.695, 115.797, 84.955], ['A', ' CA ', 141.767, 116.909, 84.801], ['A', ' C ', 141.348, 116.987, 83.38], ['A', ' O ', 142.086, 116.62, 82.48], ['A', ' CB ', 142.336, 118.217, 85.249], ['A', ' H ', 143.255, 115.486, 84.172], ['A', ' HA ', 140.883, 116.695, 85.386], ['A', ' HB ', 141.588, 118.999, 85.125], ['A', ' HB ', 142.609, 118.136, 86.286], ['A', ' HB ', 143.177, 118.46, 84.668]]
[['A', ' N ', 140.167, 117.495, 83.173], ['A', ' CA ', 139.634, 117.569, 81.845], ['A', ' C ', 139.301, 118.965, 81.388], ['A', ' O ', 138.692, 119.769, 82.102], ['A', ' CB ', 138.402, 116.68, 81.776], ['A', ' CG ', 137.705, 116.641, 80.445], ['A', ' CD ', 136.531, 115.722, 80.445], ['A', ' OE1', 136.629, 114.658, 80.996], ['A', ' OE2', 135.512, 116.096, 79.919], ['A', ' H ', 139.627, 117.83, 83.974], ['A', ' HA ', 140.379, 117.167, 81.161], ['A', ' HB ', 138.69, 115.659, 82.023], ['A', ' HB ', 137.704, 117.0, 82.525], ['A', ' HG ', 137.364, 117.633, 80.191], ['A', ' HG ', 138.413, 116.326, 79.68]]
[['A', ' N ', 139.777, 119.268, 80.192], ['A', ' CA ', 139.517, 120.553, 79.569], ['A', ' C ', 138.471, 120.419, 78.485], ['A', ' O ', 138.634, 119.655, 77.53], ['A', ' CB ', 140.831, 121.148, 79.015], ['A', ' CG ', 140.731, 122.484, 78.229], ['A', ' CD1', 140.214, 123.609, 79.126], ['A', ' CD2', 142.129, 122.871, 77.676], ['A', ' H ', 140.314, 118.536, 79.705], ['A', ' HA ', 139.102, 121.219, 80.316], ['A', ' HB ', 141.52, 121.293, 79.834], ['A', ' HB ', 141.27, 120.413, 78.342], ['A', ' HG ', 140.044, 122.354, 77.413], ['A', ' HD1', 140.145, 124.528, 78.548], ['A', ' HD1', 139.227, 123.369, 79.508], ['A', ' HD1', 140.891, 123.759, 79.957], ['A', ' HD2', 142.05, 123.795, 77.116], ['A', ' HD2', 142.826, 123.015, 78.487], ['A', ' HD2', 142.501, 122.086, 77.022]]
[['A', ' N ', 137.371, 121.143, 78.645], ['A', ' CA ', 136.274, 121.09, 77.698], ['A', ' C ', 136.099, 122.419, 76.999], ['A', ' O ', 135.774, 123.439, 77.62], ['A', ' CB ', 134.969, 120.743, 78.435], ['A', ' CG1', 133.779, 120.716, 77.467], ['A', ' CG2', 135.14, 119.415, 79.108], ['A', ' H ', 137.294, 121.764, 79.457], ['A', ' HA ', 136.487, 120.328, 76.947], ['A', ' HB ', 134.769, 121.508, 79.189], ['A', ' HG1', 132.872, 120.473, 78.019], ['A', ' HG1', 133.657, 121.693, 76.997], ['A', ' HG1', 133.938, 119.973, 76.702], ['A', ' HG2', 134.238, 119.152, 79.648], ['A', ' HG2', 135.34, 118.658, 78.369], ['A', ' HG2', 135.969, 119.46, 79.803]]
[['A', ' N ', 136.269, 122.419, 75.689], ['A', ' CA ', 136.142, 123.663, 74.964], ['A', ' C ', 135.119, 123.6, 73.854], ['A', ' O ', 135.12, 122.698, 73.018], ['A', ' CB ', 137.494, 124.016, 74.4], ['A', ' CG ', 138.545, 124.248, 75.448], ['A', ' SD ', 140.177, 124.512, 74.77], ['A', ' CE ', 140.687, 122.861, 74.289], ['A', ' H ', 136.556, 121.554, 75.218], ['A', ' HA ', 135.822, 124.447, 75.649], ['A', ' HB ', 137.82, 123.228, 73.757], ['A', ' HB ', 137.397, 124.889, 73.811], ['A', ' HG ', 138.266, 125.107, 76.053], ['A', ' HG ', 138.585, 123.39, 76.092], ['A', ' HE ', 141.689, 122.901, 73.852], ['A', ' HE ', 140.697, 122.206, 75.152], ['A', ' HE ', 140.005, 122.461, 73.559]]
[['A', ' N ', 134.278, 124.604, 73.798], ['A', ' CA ', 133.272, 124.684, 72.762], ['A', ' C ', 133.793, 125.602, 71.686], ['A', ' O ', 134.034, 126.793, 71.94], ['A', ' CB ', 131.959, 125.218, 73.321], ['A', ' CG ', 131.364, 124.362, 74.423], ['A', ' CD ', 130.011, 124.808, 74.884], ['A', ' OE1', 129.484, 125.744, 74.336], ['A', ' OE2', 129.503, 124.211, 75.803], ['A', ' H ', 134.322, 125.327, 74.517], ['A', ' HA ', 133.107, 123.698, 72.327], ['A', ' HB ', 132.123, 126.213, 73.701], ['A', ' HB ', 131.227, 125.292, 72.516], ['A', ' HG ', 131.291, 123.365, 74.079], ['A', ' HG ', 132.05, 124.373, 75.272]]
[['A', ' N ', 133.925, 125.065, 70.48], ['A', ' CA ', 134.47, 125.833, 69.371], ['A', ' C ', 133.393, 126.071, 68.33], ['A', ' O ', 132.605, 125.179, 68.039], ['A', ' CB ', 135.687, 125.109, 68.757], ['A', ' CG1', 136.814, 125.063, 69.766], ['A', ' CG2', 135.32, 123.674, 68.345], ['A', ' H ', 133.632, 124.088, 70.339], ['A', ' HA ', 134.798, 126.799, 69.743], ['A', ' HB ', 136.032, 125.67, 67.882], ['A', ' HG1', 137.67, 124.568, 69.317], ['A', ' HG1', 137.086, 126.067, 70.032], ['A', ' HG1', 136.499, 124.515, 70.657], ['A', ' HG2', 136.191, 123.189, 67.913], ['A', ' HG2', 134.989, 123.104, 69.211], ['A', ' HG2', 134.521, 123.681, 67.601]]
[['A', ' N ', 133.327, 127.292, 67.81], ['A', ' CA ', 132.289, 127.626, 66.824], ['A', ' C ', 132.829, 127.912, 65.431], ['A', ' O ', 133.462, 128.948, 65.21], ['A', ' CB ', 131.448, 128.84, 67.258], ['A', ' CG ', 130.488, 128.62, 68.481], ['A', ' OD1', 129.742, 127.656, 68.504], ['A', ' OD2', 130.476, 129.474, 69.352], ['A', ' H ', 134.064, 127.95, 68.088], ['A', ' HA ', 131.616, 126.773, 66.741], ['A', ' HB ', 132.12, 129.662, 67.495], ['A', ' HB ', 130.842, 129.163, 66.409]]
[['A', ' N ', 132.578, 126.991, 64.486], ['A', ' CA ', 133.016, 127.036, 63.069], ['A', ' C ', 134.529, 126.967, 62.877], ['A', ' O ', 135.053, 126.077, 62.207], ['A', ' CB ', 132.469, 128.276, 62.366], ['A', ' CG ', 130.966, 128.22, 62.196], ['A', ' OD1', 130.396, 127.16, 62.358], ['A', ' OD2', 130.393, 129.238, 61.901], ['A', ' H ', 132.029, 126.187, 64.762], ['A', ' HA ', 132.589, 126.167, 62.568], ['A', ' HB ', 132.733, 129.179, 62.906], ['A', ' HB ', 132.928, 128.354, 61.379]]
[['A', ' N ', 135.204, 127.924, 63.471], ['A', ' CA ', 136.633, 128.061, 63.509], ['A', ' C ', 137.096, 127.209, 64.658], ['A', ' O ', 136.29, 126.565, 65.322], ['A', ' CB ', 137.036, 129.519, 63.736], ['A', ' CG ', 136.683, 130.439, 62.603], ['A', ' CD ', 137.477, 130.138, 61.387], ['A', ' OE1', 138.62, 129.775, 61.53], ['A', ' OE2', 136.952, 130.26, 60.311], ['A', ' H ', 134.658, 128.608, 63.98], ['A', ' HA ', 137.069, 127.689, 62.58], ['A', ' HB ', 136.534, 129.892, 64.631], ['A', ' HB ', 138.107, 129.59, 63.909], ['A', ' HG ', 135.623, 130.327, 62.373], ['A', ' HG ', 136.859, 131.47, 62.908]]
[['A', ' N ', 138.392, 127.16, 64.895], ['A', ' CA ', 138.888, 126.355, 65.998], ['A', ' C ', 138.883, 127.165, 67.286], ['A', ' O ', 139.371, 126.711, 68.316], ['A', ' H ', 139.037, 127.68, 64.311], ['A', ' HA ', 138.258, 125.472, 66.117], ['A', ' HA ', 139.887, 126.002, 65.778]]
[['A', ' N ', 138.351, 128.376, 67.208], ['A', ' CA ', 138.3, 129.32, 68.299], ['A', ' C ', 137.274, 128.919, 69.312], ['A', ' O ', 136.106, 128.661, 68.992], ['A', ' CB ', 138.011, 130.716, 67.761], ['A', ' CG1', 139.186, 131.117, 66.845], ['A', ' CG2', 137.853, 131.702, 68.936], ['A', ' CD1', 138.941, 132.333, 66.001], ['A', ' H ', 137.96, 128.655, 66.322], ['A', ' HA ', 139.247, 129.346, 68.804], ['A', ' HB ', 137.102, 130.705, 67.16], ['A', ' HG1', 140.059, 131.304, 67.469], ['A', ' HG1', 139.413, 130.293, 66.176], ['A', ' HG2', 137.665, 132.702, 68.57], ['A', ' HG2', 137.022, 131.414, 69.577], ['A', ' HG2', 138.766, 131.7, 69.515], ['A', ' HD1', 139.824, 132.529, 65.393], ['A', ' HD1', 138.086, 132.158, 65.346], ['A', ' HD1', 138.744, 133.197, 66.624]]
[['A', ' N ', 137.732, 128.899, 70.551], ['A', ' CA ', 136.928, 128.545, 71.69], ['A', ' C ', 136.091, 129.726, 72.069], ['A', ' O ', 136.604, 130.821, 72.284], ['A', ' CB ', 137.842, 128.181, 72.862], ['A', ' CG1', 137.032, 127.86, 74.116], ['A', ' CG2', 138.708, 127.053, 72.451], ['A', ' H ', 138.719, 129.136, 70.697], ['A', ' HA ', 136.281, 127.71, 71.439], ['A', ' HB ', 138.479, 129.035, 73.096], ['A', ' HG1', 137.708, 127.616, 74.933], ['A', ' HG1', 136.427, 128.71, 74.408], ['A', ' HG1', 136.378, 127.011, 73.921], ['A', ' HG2', 139.377, 126.82, 73.262], ['A', ' HG2', 138.105, 126.199, 72.208], ['A', ' HG2', 139.288, 127.337, 71.58]]
[['A', ' N ', 134.802, 129.524, 72.176], ['A', ' CA ', 133.941, 130.626, 72.544], ['A', ' C ', 133.454, 130.439, 73.956], ['A', ' O ', 133.094, 131.401, 74.63], ['A', ' CB ', 132.784, 130.749, 71.559], ['A', ' OG1', 132.024, 129.537, 71.575], ['A', ' CG2', 133.356, 130.986, 70.16], ['A', ' H ', 134.421, 128.592, 71.992], ['A', ' HA ', 134.51, 131.552, 72.508], ['A', ' HB ', 132.142, 131.58, 71.842], ['A', ' HG1', 131.281, 129.603, 70.917], ['A', ' HG2', 132.536, 131.073, 69.452], ['A', ' HG2', 133.94, 131.903, 70.157], ['A', ' HG2', 133.992, 130.151, 69.871]]
[['A', ' N ', 133.496, 129.2, 74.414], ['A', ' CA ', 133.125, 128.873, 75.78], ['A', ' C ', 133.994, 127.742, 76.294], ['A', ' O ', 134.317, 126.829, 75.537], ['A', ' CB ', 131.649, 128.495, 75.87], ['A', ' CG ', 131.133, 128.183, 77.271], ['A', ' CD ', 129.645, 127.901, 77.225], ['A', ' CE ', 129.082, 127.536, 78.584], ['A', ' NZ ', 127.632, 127.205, 78.499], ['A', ' H ', 133.735, 128.458, 73.751], ['A', ' HA ', 133.286, 129.743, 76.405], ['A', ' HB ', 131.049, 129.308, 75.466], ['A', ' HB ', 131.456, 127.627, 75.264], ['A', ' HG ', 131.624, 127.291, 77.66], ['A', ' HG ', 131.337, 129.021, 77.939], ['A', ' HD ', 129.122, 128.78, 76.849], ['A', ' HD ', 129.457, 127.076, 76.544], ['A', ' HE ', 129.618, 126.673, 78.981], ['A', ' HE ', 129.213, 128.377, 79.264], ['A', ' HZ ', 127.268, 126.956, 79.429], ['A', ' HZ ', 127.117, 127.984, 78.148], ['A', ' HZ ', 127.484, 126.41, 77.896]]
[['A', ' N ', 134.3, 127.725, 77.581], ['A', ' CA ', 134.978, 126.537, 78.085], ['A', ' C ', 134.98, 126.39, 79.598], ['A', ' O ', 134.708, 127.32, 80.368], ['A', ' H ', 134.11, 128.551, 78.161], ['A', ' HA ', 134.507, 125.655, 77.652], ['A', ' HA ', 136.008, 126.538, 77.728]]
[['A', ' N ', 135.281, 125.166, 80.008], ['A', ' CA ', 135.342, 124.762, 81.398], ['A', ' C ', 136.482, 123.814, 81.665], ['A', ' O ', 136.899, 123.039, 80.805], ['A', ' CB ', 134.051, 124.099, 81.864], ['A', ' CG ', 132.775, 124.976, 81.922], ['A', ' CD ', 132.871, 126.0, 83.037], ['A', ' NE ', 131.651, 126.77, 83.236], ['A', ' CZ ', 131.307, 127.879, 82.55], ['A', ' NH1', 132.071, 128.352, 81.57], ['A', ' NH2', 130.185, 128.504, 82.873], ['A', ' H ', 135.483, 124.473, 79.277], ['A', ' HA ', 135.503, 125.651, 82.0], ['A', ' HB ', 133.827, 123.273, 81.191], ['A', ' HB ', 134.205, 123.668, 82.849], ['A', ' HG ', 132.642, 125.497, 80.98], ['A', ' HG ', 131.906, 124.347, 82.104], ['A', ' HD ', 133.101, 125.511, 83.963], ['A', ' HD ', 133.666, 126.701, 82.817], ['A', ' HE ', 131.02, 126.477, 84.02], ['A', ' HH1', 132.959, 127.89, 81.294], ['A', ' HH1', 131.799, 129.188, 81.076], ['A', ' HH2', 129.608, 128.141, 83.626], ['A', ' HH2', 129.906, 129.338, 82.384]]
[['A', ' N ', 136.98, 123.863, 82.874], ['A', ' CA ', 138.054, 122.993, 83.266], ['A', ' C ', 137.759, 122.492, 84.644], ['A', ' O ', 137.262, 123.24, 85.488], ['A', ' CB ', 139.358, 123.756, 83.2], ['A', ' CG ', 140.523, 123.009, 83.539], ['A', ' CD1', 140.977, 122.118, 82.66], ['A', ' CD2', 141.167, 123.225, 84.677], ['A', ' CE1', 142.068, 121.418, 82.892], ['A', ' CE2', 142.287, 122.528, 84.922], ['A', ' CZ ', 142.734, 121.627, 84.02], ['A', ' OH ', 143.854, 120.942, 84.232], ['A', ' H ', 136.606, 124.511, 83.554], ['A', ' HA ', 138.092, 122.133, 82.599], ['A', ' HB ', 139.498, 124.114, 82.19], ['A', ' HB ', 139.308, 124.621, 83.86], ['A', ' HD1', 140.446, 121.976, 81.761], ['A', ' HD2', 140.798, 123.962, 85.387], ['A', ' HE1', 142.421, 120.693, 82.161], ['A', ' HE2', 142.819, 122.701, 85.827], ['A', ' HH ', 144.236, 121.216, 85.063]]
[['A', ' N ', 137.974, 121.211, 84.854], ['A', ' CA ', 137.724, 120.629, 86.153], ['A', ' C ', 138.592, 119.429, 86.416], ['A', ' O ', 139.048, 118.774, 85.479], ['A', ' CB ', 136.257, 120.271, 86.213], ['A', ' CG ', 135.854, 119.308, 85.159], ['A', ' CD1', 135.748, 117.964, 85.408], ['A', ' CD2', 135.593, 119.759, 83.874], ['A', ' CE1', 135.36, 117.107, 84.413], ['A', ' CE2', 135.234, 118.898, 82.901], ['A', ' CZ ', 135.106, 117.573, 83.17], ['A', ' H ', 138.307, 120.622, 84.08], ['A', ' HA ', 137.935, 121.37, 86.912], ['A', ' HB ', 136.036, 119.83, 87.178], ['A', ' HB ', 135.649, 121.164, 86.114], ['A', ' HD1', 135.961, 117.582, 86.397], ['A', ' HD2', 135.668, 120.818, 83.639], ['A', ' HE1', 135.257, 116.048, 84.608], ['A', ' HE2', 135.034, 119.265, 81.907], ['A', ' HZ ', 134.802, 116.884, 82.377]]
[['A', ' N ', 138.793, 119.097, 87.689], ['A', ' CA ', 139.557, 117.906, 87.994], ['A', ' C ', 138.678, 116.687, 87.925], ['A', ' O ', 137.479, 116.758, 88.216], ['A', ' CB ', 140.187, 118.016, 89.356], ['A', ' OG ', 139.214, 118.036, 90.355], ['A', ' H ', 138.418, 119.659, 88.442], ['A', ' HA ', 140.352, 117.802, 87.268], ['A', ' HB ', 140.866, 117.176, 89.513], ['A', ' HB ', 140.785, 118.926, 89.408], ['A', ' HG ', 139.703, 118.114, 91.182]]
[['A', ' N ', 139.286, 115.544, 87.617], ['A', ' CA ', 138.582, 114.267, 87.609], ['A', ' C ', 139.297, 113.27, 88.499], ['A', ' O ', 139.099, 112.065, 88.376], ['A', ' CB ', 138.421, 113.711, 86.181], ['A', ' CG1', 139.785, 113.488, 85.528], ['A', ' CG2', 137.592, 114.699, 85.375], ['A', ' CD1', 139.776, 112.716, 84.222], ['A', ' H ', 140.285, 115.559, 87.393], ['A', ' HA ', 137.584, 114.419, 88.021], ['A', ' HB ', 137.903, 112.751, 86.222], ['A', ' HG1', 140.21, 114.443, 85.325], ['A', ' HG1', 140.425, 112.949, 86.221], ['A', ' HG2', 137.421, 114.336, 84.364], ['A', ' HG2', 136.637, 114.818, 85.879], ['A', ' HG2', 138.098, 115.664, 85.321], ['A', ' HD1', 140.8, 112.628, 83.848], ['A', ' HD1', 139.365, 111.719, 84.388], ['A', ' HD1', 139.18, 113.228, 83.474]]
[['A', ' N ', 140.17, 113.787, 89.34], ['A', ' CA ', 140.976, 113.008, 90.264], ['A', ' C ', 140.065, 112.33, 91.247], ['A', ' O ', 139.057, 112.922, 91.592], ['A', ' CB ', 141.944, 113.95, 91.015], ['A', ' OG1', 142.844, 113.179, 91.825], ['A', ' CG2', 141.167, 114.928, 91.925], ['A', ' H ', 140.258, 114.792, 89.341], ['A', ' HA ', 141.532, 112.265, 89.7], ['A', ' HB ', 142.497, 114.523, 90.289], ['A', ' HG1', 143.608, 113.719, 92.141], ['A', ' HG2', 141.883, 115.588, 92.419], ['A', ' HG2', 140.481, 115.522, 91.331], ['A', ' HG2', 140.609, 114.391, 92.686]]
[['A', ' N ', 140.335, 111.126, 91.733], ['A', ' CA ', 139.519, 110.508, 92.728], ['A', ' C ', 139.642, 111.335, 93.965], ['A', ' O ', 140.708, 111.881, 94.238], ['A', ' CB ', 140.145, 109.137, 92.895], ['A', ' CG ', 141.563, 109.313, 92.416], ['A', ' CD ', 141.467, 110.33, 91.294], ['A', ' HA ', 138.485, 110.457, 92.366], ['A', ' HB ', 140.077, 108.833, 93.947], ['A', ' HB ', 139.581, 108.403, 92.304], ['A', ' HG ', 142.205, 109.661, 93.24], ['A', ' HG ', 141.982, 108.349, 92.08], ['A', ' HD ', 142.395, 110.899, 91.262], ['A', ' HD ', 141.24, 109.836, 90.33]]
[['A', ' N ', 138.601, 111.392, 94.749], ['A', ' CA ', 138.692, 112.159, 95.958], ['A', ' C ', 139.429, 111.382, 97.002], ['A', ' O ', 139.009, 110.306, 97.402], ['A', ' CB ', 137.296, 112.514, 96.429], ['A', ' CG1', 137.311, 113.218, 97.709], ['A', ' CG2', 136.679, 113.372, 95.428], ['A', ' H ', 137.743, 110.915, 94.492], ['A', ' HA ', 139.236, 113.082, 95.744], ['A', ' HB ', 136.715, 111.614, 96.55], ['A', ' HG1', 136.277, 113.459, 97.983], ['A', ' HG1', 137.746, 112.594, 98.481], ['A', ' HG1', 137.882, 114.134, 97.598], ['A', ' HG2', 135.699, 113.585, 95.791], ['A', ' HG2', 137.24, 114.302, 95.308], ['A', ' HG2', 136.621, 112.869, 94.469]]
[['A', ' N ', 140.492, 111.993, 97.482], ['A', ' CA ', 141.419, 111.426, 98.444], ['A', ' C ', 140.84, 111.353, 99.838], ['A', ' O ', 141.168, 110.464, 100.612], ['A', ' CB ', 142.614, 112.326, 98.463], ['A', ' CG ', 143.381, 112.375, 97.154], ['A', ' CD ', 144.253, 111.226, 96.911], ['A', ' NE ', 145.191, 111.113, 97.962], ['A', ' CZ ', 146.263, 111.909, 98.122], ['A', ' NH1', 146.519, 112.912, 97.296], ['A', ' NH2', 147.047, 111.714, 99.127], ['A', ' H ', 140.709, 112.892, 97.076], ['A', ' HA ', 141.691, 110.423, 98.123], ['A', ' HB ', 142.299, 113.342, 98.687], ['A', ' HB ', 143.29, 112.018, 99.259], ['A', ' HG ', 142.668, 112.385, 96.327], ['A', ' HG ', 143.947, 113.295, 97.12], ['A', ' HD ', 143.667, 110.307, 96.869], ['A', ' HD ', 144.788, 111.352, 95.971], ['A', ' HE ', 145.05, 110.374, 98.638], ['A', ' HH1', 145.918, 113.097, 96.516], ['A', ' HH1', 147.323, 113.557, 97.485], ['A', ' HH2', 146.875, 110.971, 99.78], ['A', ' HH2', 147.845, 112.336, 99.225]]
[['A', ' N ', 139.997, 112.323, 100.168], ['A', ' CA ', 139.355, 112.361, 101.471], ['A', ' C ', 140.174, 112.973, 102.604], ['A', ' O ', 139.786, 112.853, 103.767], ['A', ' H ', 139.791, 113.039, 99.489], ['A', ' HA ', 138.424, 112.893, 101.375], ['A', ' HA ', 139.082, 111.343, 101.749]]
[['A', ' N ', 141.257, 113.676, 102.297], ['A', ' CA ', 142.114, 114.204, 103.351], ['A', ' C ', 141.5, 115.158, 104.329], ['A', ' O ', 141.934, 115.209, 105.479], ['A', ' CB ', 143.398, 114.775, 102.758], ['A', ' CG ', 144.409, 113.702, 102.299], ['A', ' CD1', 145.467, 114.293, 101.459], ['A', ' CD2', 145.123, 113.143, 103.554], ['A', ' H ', 141.516, 113.807, 101.333], ['A', ' HA ', 142.408, 113.351, 103.927], ['A', ' HB ', 143.142, 115.399, 101.904], ['A', ' HB ', 143.886, 115.402, 103.509], ['A', ' HG ', 143.893, 112.911, 101.751], ['A', ' HD1', 146.183, 113.525, 101.174], ['A', ' HD1', 145.028, 114.727, 100.565], ['A', ' HD1', 145.969, 115.044, 102.036], ['A', ' HD2', 145.858, 112.394, 103.259], ['A', ' HD2', 145.63, 113.96, 104.059], ['A', ' HD2', 144.442, 112.697, 104.243]]
[['A', ' N ', 140.508, 115.939, 103.962], ['A', ' CA ', 140.02, 116.815, 104.995], ['A', ' C ', 139.363, 115.965, 106.096], ['A', ' O ', 139.418, 116.317, 107.276], ['A', ' CB ', 139.07, 117.864, 104.417], ['A', ' CG ', 139.776, 118.879, 103.475], ['A', ' CD ', 138.835, 119.859, 102.783], ['A', ' OE1', 137.671, 119.581, 102.7], ['A', ' OE2', 139.278, 120.902, 102.368], ['A', ' H ', 140.07, 115.939, 103.032], ['A', ' HA ', 140.869, 117.334, 105.424], ['A', ' HB ', 138.252, 117.383, 103.902], ['A', ' HB ', 138.633, 118.437, 105.235], ['A', ' HG ', 140.517, 119.433, 104.045], ['A', ' HG ', 140.312, 118.316, 102.709]]
[['A', ' N ', 138.745, 114.827, 105.737], ['A', ' CA ', 138.047, 114.029, 106.734], ['A', ' C ', 138.995, 113.058, 107.419], ['A', ' O ', 138.825, 112.723, 108.603], ['A', ' CB ', 136.877, 113.303, 106.086], ['A', ' CG ', 135.806, 114.238, 105.496], ['A', ' CD ', 135.158, 115.135, 106.559], ['A', ' CE ', 134.007, 115.946, 105.986], ['A', ' NZ ', 133.403, 116.857, 107.011], ['A', ' H ', 138.776, 114.486, 104.774], ['A', ' HA ', 137.668, 114.69, 107.505], ['A', ' HB ', 137.245, 112.67, 105.27], ['A', ' HB ', 136.397, 112.649, 106.813], ['A', ' HG ', 136.261, 114.864, 104.725], ['A', ' HG ', 135.039, 113.626, 105.032], ['A', ' HD ', 134.795, 114.523, 107.384], ['A', ' HD ', 135.885, 115.849, 106.945], ['A', ' HE ', 134.372, 116.543, 105.15], ['A', ' HE ', 133.237, 115.263, 105.625], ['A', ' HZ ', 132.642, 117.38, 106.601], ['A', ' HZ ', 133.052, 116.311, 107.787], ['A', ' HZ ', 134.108, 117.501, 107.345]]
[['A', ' N ', 140.028, 112.634, 106.69], ['A', ' CA ', 141.024, 111.737, 107.253], ['A', ' C ', 141.673, 112.42, 108.416], ['A', ' O ', 141.927, 111.801, 109.448], ['A', ' CB ', 142.09, 111.411, 106.236], ['A', ' CG ', 141.631, 110.558, 105.161], ['A', ' SD ', 142.735, 110.462, 103.767], ['A', ' CE ', 144.137, 109.655, 104.403], ['A', ' H ', 140.088, 112.923, 105.711], ['A', ' HA ', 140.538, 110.827, 107.599], ['A', ' HB ', 142.494, 112.319, 105.837], ['A', ' HB ', 142.901, 110.894, 106.741], ['A', ' HG ', 141.557, 109.582, 105.59], ['A', ' HG ', 140.652, 110.852, 104.823], ['A', ' HE ', 144.875, 109.547, 103.615], ['A', ' HE ', 144.569, 110.218, 105.225], ['A', ' HE ', 143.835, 108.688, 104.741]]
[['A', ' N ', 141.936, 113.706, 108.228], ['A', ' CA ', 142.532, 114.546, 109.229], ['A', ' C ', 141.562, 114.919, 110.32], ['A', ' O ', 141.915, 114.869, 111.489], ['A', ' CB ', 143.087, 115.812, 108.578], ['A', ' CG1', 143.542, 116.775, 109.625], ['A', ' CG2', 144.253, 115.431, 107.695], ['A', ' H ', 141.718, 114.117, 107.315], ['A', ' HA ', 143.359, 113.997, 109.68], ['A', ' HB ', 142.31, 116.29, 107.974], ['A', ' HG1', 143.957, 117.661, 109.148], ['A', ' HG1', 142.715, 117.078, 110.264], ['A', ' HG1', 144.29, 116.283, 110.216], ['A', ' HG2', 144.653, 116.324, 107.223], ['A', ' HG2', 145.01, 114.966, 108.304], ['A', ' HG2', 143.929, 114.733, 106.925]]
[['A', ' N ', 140.34, 115.3, 109.962], ['A', ' CA ', 139.42, 115.763, 110.973], ['A', ' C ', 139.154, 114.764, 112.072], ['A', ' O ', 139.241, 115.114, 113.234], ['A', ' CB ', 138.061, 116.155, 110.363], ['A', ' OG1', 138.239, 117.217, 109.426], ['A', ' CG2', 137.157, 116.66, 111.464], ['A', ' H ', 140.063, 115.354, 108.982], ['A', ' HA ', 139.85, 116.647, 111.424], ['A', ' HB ', 137.609, 115.3, 109.864], ['A', ' HG1', 138.698, 116.889, 108.626], ['A', ' HG2', 136.203, 116.968, 111.044], ['A', ' HG2', 136.975, 115.897, 112.215], ['A', ' HG2', 137.636, 117.507, 111.928]]
[['A', ' N ', 138.89, 113.505, 111.774], ['A', ' CA ', 138.561, 112.603, 112.895], ['A', ' C ', 139.768, 112.004, 113.642], ['A', ' O ', 139.807, 110.791, 113.88], ['A', ' H ', 138.858, 113.203, 110.792], ['A', ' HA ', 137.938, 113.142, 113.608], ['A', ' HA ', 137.947, 111.79, 112.51]]
[['A', ' N ', 140.738, 112.85, 113.983], ['A', ' CA ', 142.023, 112.485, 114.59], ['A', ' C ', 142.59, 113.601, 115.463], ['A', ' O ', 142.047, 114.696, 115.514], ['A', ' CB ', 143.041, 112.048, 113.531], ['A', ' CG ', 142.604, 110.801, 112.767], ['A', ' CD ', 143.612, 110.262, 111.804], ['A', ' CE ', 143.097, 109.024, 111.117], ['A', ' NZ ', 141.743, 109.245, 110.587], ['A', ' H ', 140.525, 113.83, 113.791], ['A', ' HA ', 141.853, 111.63, 115.243], ['A', ' HB ', 143.177, 112.856, 112.804], ['A', ' HB ', 144.007, 111.853, 113.993], ['A', ' HG ', 142.287, 110.023, 113.461], ['A', ' HG ', 141.764, 111.101, 112.161], ['A', ' HD ', 143.849, 111.015, 111.05], ['A', ' HD ', 144.517, 109.992, 112.342], ['A', ' HE ', 143.762, 108.803, 110.283], ['A', ' HE ', 143.086, 108.176, 111.798], ['A', ' HZ ', 141.411, 108.436, 110.097], ['A', ' HZ ', 141.114, 109.447, 111.351], ['A', ' HZ ', 141.773, 110.07, 109.959]]
[['A', ' N ', 143.62, 113.272, 116.222], ['A', ' CA ', 144.322, 114.19, 117.117], ['A', ' C ', 145.153, 115.221, 116.345], ['A', ' O ', 145.392, 115.01, 115.164], ['A', ' CB ', 145.231, 113.396, 118.03], ['A', ' H ', 143.991, 112.335, 116.122], ['A', ' HA ', 143.586, 114.695, 117.712], ['A', ' HB ', 145.743, 114.057, 118.722], ['A', ' HB ', 144.646, 112.676, 118.593], ['A', ' HB ', 145.978, 112.869, 117.43]]
[['A', ' N ', 145.51, 116.384, 116.948], ['A', ' CA ', 146.492, 117.323, 116.46], ['A', ' C ', 147.692, 116.448, 116.39], ['A', ' O ', 147.716, 115.446, 117.095], ['A', ' CB ', 146.582, 118.379, 117.544], ['A', ' CG ', 145.266, 118.293, 118.22], ['A', ' CD ', 144.877, 116.838, 118.172], ['A', ' HA ', 146.21, 117.713, 115.474], ['A', ' HB ', 147.426, 118.16, 118.214], ['A', ' HB ', 146.772, 119.364, 117.095], ['A', ' HG ', 145.332, 118.679, 119.252], ['A', ' HG ', 144.552, 118.923, 117.687], ['A', ' HD ', 145.27, 116.304, 119.047], ['A', ' HD ', 143.798, 116.799, 118.096]]
[['A', ' N ', 148.656, 116.789, 115.564], ['A', ' CA ', 149.768, 115.894, 115.266], ['A', ' C ', 148.969, 115.154, 114.251], ['A', ' O ', 147.872, 115.622, 113.993], ['A', ' CB ', 150.236, 114.971, 116.409], ['A', ' CG ', 151.582, 114.274, 116.165], ['A', ' CD ', 152.714, 115.23, 116.206], ['A', ' OE1', 152.657, 116.134, 116.994], ['A', ' OE2', 153.616, 115.099, 115.42], ['A', ' H ', 148.561, 117.657, 115.058], ['A', ' HA ', 150.606, 116.408, 114.795], ['A', ' HB ', 150.284, 115.522, 117.352], ['A', ' HB ', 149.541, 114.14, 116.527], ['A', ' HG ', 151.729, 113.53, 116.951], ['A', ' HG ', 151.59, 113.751, 115.224]]
[['A', ' N ', 149.468, 114.145, 113.574], ['A', ' CA ', 148.7, 113.468, 112.52], ['A', ' C ', 148.459, 114.361, 111.306], ['A', ' O ', 148.991, 114.081, 110.236], ['A', ' CB ', 147.324, 112.954, 113.005], ['A', ' OG1', 147.499, 112.024, 114.071], ['A', ' CG2', 146.642, 112.257, 111.862], ['A', ' H ', 150.384, 113.79, 113.795], ['A', ' HA ', 149.277, 112.609, 112.183], ['A', ' HB ', 146.68, 113.753, 113.332], ['A', ' HG1', 147.88, 112.478, 114.831], ['A', ' HG2', 145.718, 111.904, 112.222], ['A', ' HG2', 146.461, 112.933, 111.03], ['A', ' HG2', 147.255, 111.422, 111.523]]
[['A', ' N ', 147.725, 115.462, 111.463], ['A', ' CA ', 147.435, 116.379, 110.379], ['A', ' C ', 148.687, 116.809, 109.642], ['A', ' O ', 148.735, 116.65, 108.431], ['A', ' CB ', 146.704, 117.628, 110.871], ['A', ' H ', 147.331, 115.623, 112.381], ['A', ' HA ', 146.786, 115.857, 109.68], ['A', ' HB ', 146.457, 118.257, 110.014], ['A', ' HB ', 145.801, 117.334, 111.374], ['A', ' HB ', 147.275, 118.21, 111.555]]
[['A', ' N ', 149.801, 117.199, 110.296], ['A', ' CA ', 151.004, 117.654, 109.649], ['A', ' C ', 151.609, 116.608, 108.75], ['A', ' O ', 152.473, 116.945, 107.951], ['A', ' CB ', 151.941, 117.932, 110.814], ['A', ' CG ', 151.051, 118.157, 111.953], ['A', ' CD ', 149.945, 117.201, 111.751], ['A', ' HA ', 150.801, 118.574, 109.088], ['A', ' HB ', 152.616, 117.076, 110.96], ['A', ' HB ', 152.582, 118.804, 110.582], ['A', ' HG ', 151.6, 117.999, 112.893], ['A', ' HG ', 150.703, 119.197, 111.945], ['A', ' HD ', 150.317, 116.239, 112.072], ['A', ' HD ', 149.095, 117.53, 112.31]]
[['A', ' N ', 151.225, 115.343, 108.935], ['A', ' CA ', 151.736, 114.252, 108.148], ['A', ' C ', 150.736, 113.919, 107.07], ['A', ' O ', 151.076, 113.806, 105.904], ['A', ' CB ', 151.961, 113.02, 109.038], ['A', ' CG1', 152.413, 111.833, 108.226], ['A', ' CG2', 152.961, 113.354, 110.062], ['A', ' H ', 150.49, 115.111, 109.597], ['A', ' HA ', 152.679, 114.549, 107.687], ['A', ' HB ', 151.023, 112.746, 109.521], ['A', ' HG1', 152.56, 110.979, 108.894], ['A', ' HG1', 151.661, 111.582, 107.491], ['A', ' HG1', 153.352, 112.066, 107.722], ['A', ' HG2', 153.119, 112.49, 110.709], ['A', ' HG2', 153.894, 113.624, 109.57], ['A', ' HG2', 152.604, 114.193, 110.655]]
[['A', ' N ', 149.473, 113.789, 107.426], ['A', ' CA ', 148.506, 113.36, 106.435], ['A', ' C ', 148.331, 114.369, 105.317], ['A', ' O ', 148.166, 113.994, 104.154], ['A', ' CB ', 147.173, 113.072, 107.105], ['A', ' CG ', 147.171, 111.852, 108.005], ['A', ' SD ', 147.495, 110.335, 107.1], ['A', ' CE ', 147.788, 109.167, 108.414], ['A', ' H ', 149.204, 113.952, 108.396], ['A', ' HA ', 148.873, 112.447, 105.989], ['A', ' HB ', 146.926, 113.921, 107.73], ['A', ' HB ', 146.387, 112.967, 106.359], ['A', ' HG ', 147.939, 111.971, 108.773], ['A', ' HG ', 146.2, 111.764, 108.499], ['A', ' HE ', 148.013, 108.195, 107.988], ['A', ' HE ', 148.636, 109.495, 109.021], ['A', ' HE ', 146.901, 109.088, 109.043]]
[['A', ' N ', 148.484, 115.644, 105.633], ['A', ' CA ', 148.327, 116.675, 104.625], ['A', ' C ', 149.524, 116.706, 103.693], ['A', ' O ', 149.471, 117.326, 102.638], ['A', ' CB ', 148.15, 118.061, 105.242], ['A', ' CG1', 146.92, 118.049, 106.152], ['A', ' CG2', 149.45, 118.489, 105.943], ['A', ' H ', 148.644, 115.894, 106.613], ['A', ' HA ', 147.432, 116.446, 104.048], ['A', ' HB ', 147.936, 118.781, 104.458], ['A', ' HG1', 146.771, 119.038, 106.567], ['A', ' HG1', 146.045, 117.769, 105.564], ['A', ' HG1', 147.039, 117.347, 106.952], ['A', ' HG2', 149.312, 119.466, 106.36], ['A', ' HG2', 149.711, 117.811, 106.714], ['A', ' HG2', 150.27, 118.529, 105.235]]
[['A', ' N ', 150.618, 116.052, 104.051], ['A', ' CA ', 151.795, 116.099, 103.225], ['A', ' C ', 151.607, 115.326, 101.966], ['A', ' O ', 152.391, 115.5, 101.04], ['A', ' CB ', 153.016, 115.599, 103.938], ['A', ' CG ', 153.42, 116.473, 104.978], ['A', ' CD ', 154.554, 115.948, 105.704], ['A', ' OE1', 154.772, 114.73, 105.748], ['A', ' NE2', 155.313, 116.837, 106.277], ['A', ' H ', 150.63, 115.472, 104.889], ['A', ' HA ', 151.974, 117.137, 102.951], ['A', ' HB ', 152.825, 114.61, 104.352], ['A', ' HB ', 153.842, 115.511, 103.242], ['A', ' HG ', 153.705, 117.418, 104.539], ['A', ' HG ', 152.586, 116.607, 105.64], ['A', ' HE2', 156.127, 116.541, 106.793], ['A', ' HE2', 155.098, 117.802, 106.23]]
[['A', ' N ', 150.613, 114.441, 101.916], ['A', ' CA ', 150.373, 113.761, 100.672], ['A', ' C ', 149.254, 114.364, 99.918], ['A', ' O ', 148.837, 113.765, 98.924], ['A', ' CB ', 150.178, 112.245, 100.735], ['A', ' CG ', 151.386, 111.476, 101.032], ['A', ' CD ', 152.36, 111.422, 99.906], ['A', ' NE ', 152.119, 110.469, 98.8], ['A', ' CZ ', 152.725, 109.261, 98.689], ['A', ' NH1', 153.566, 108.884, 99.594], ['A', ' NH2', 152.512, 108.509, 97.646], ['A', ' H ', 149.978, 114.288, 102.712], ['A', ' HA ', 151.237, 113.936, 100.052], ['A', ' HB ', 149.438, 112.003, 101.499], ['A', ' HB ', 149.808, 111.874, 99.788], ['A', ' HG ', 151.874, 111.868, 101.912], ['A', ' HG ', 151.07, 110.492, 101.148], ['A', ' HD ', 152.41, 112.356, 99.443], ['A', ' HD ', 153.306, 111.195, 100.348], ['A', ' HE ', 151.497, 110.748, 98.067], ['A', ' HH1', 153.758, 109.455, 100.384], ['A', ' HH1', 154.114, 108.021, 99.487], ['A', ' HH2', 151.894, 108.788, 96.921], ['A', ' HH2', 153.006, 107.625, 97.505]]
[['A', ' N ', 148.802, 115.563, 100.293], ['A', ' CA ', 147.809, 116.123, 99.409], ['A', ' C ', 148.484, 116.182, 98.042], ['A', ' O ', 147.921, 115.625, 97.106], ['A', ' CB ', 147.368, 117.56, 99.801], ['A', ' CG1', 146.59, 117.572, 101.104], ['A', ' CG2', 146.539, 118.192, 98.634], ['A', ' CD1', 146.418, 118.953, 101.74], ['A', ' H ', 149.147, 116.067, 101.114], ['A', ' HA ', 146.945, 115.469, 99.347], ['A', ' HB ', 148.229, 118.142, 99.971], ['A', ' HG1', 145.603, 117.162, 100.925], ['A', ' HG1', 147.103, 116.949, 101.805], ['A', ' HG2', 146.258, 119.201, 98.891], ['A', ' HG2', 147.126, 118.225, 97.712], ['A', ' HG2', 145.64, 117.603, 98.454], ['A', ' HD1', 145.859, 118.856, 102.673], ['A', ' HD1', 147.403, 119.37, 101.954], ['A', ' HD1', 145.885, 119.624, 101.079]]
[['A', ' N ', 149.742, 116.727, 97.954], ['A', ' CA ', 150.515, 116.816, 96.729], ['A', ' C ', 151.991, 116.717, 97.043], ['A', ' O ', 152.531, 117.48, 97.85], ['A', ' CB ', 150.196, 118.136, 95.997], ['A', ' SG ', 150.914, 118.297, 94.365], ['A', ' H ', 150.129, 117.128, 98.795], ['A', ' HA ', 150.276, 115.965, 96.096], ['A', ' HB ', 149.118, 118.261, 95.901], ['A', ' HB ', 150.539, 118.972, 96.595]]
[['A', ' N ', 152.678, 115.859, 96.313], ['A', ' CA ', 154.096, 115.609, 96.515], ['A', ' C ', 154.925, 116.617, 95.788], ['A', ' O ', 156.151, 116.609, 95.838], ['A', ' H ', 152.189, 115.318, 95.597], ['A', ' HA ', 154.332, 115.656, 97.576], ['A', ' HA ', 154.337, 114.619, 96.17]]
[['A', ' N ', 154.235, 117.513, 95.132], ['A', ' CA ', 154.849, 118.55, 94.388], ['A', ' C ', 154.584, 119.876, 95.123], ['A', ' O ', 155.046, 120.928, 94.686], ['A', ' CB ', 154.35, 118.451, 92.944], ['A', ' CG1', 154.857, 119.538, 92.113], ['A', ' CG2', 154.784, 117.088, 92.4], ['A', ' H ', 153.227, 117.45, 95.144], ['A', ' HA ', 155.925, 118.385, 94.372], ['A', ' HB ', 153.282, 118.519, 92.917], ['A', ' HG1', 154.477, 119.395, 91.1], ['A', ' HG1', 154.519, 120.485, 92.487], ['A', ' HG1', 155.949, 119.517, 92.101], ['A', ' HG2', 154.428, 116.975, 91.375], ['A', ' HG2', 155.87, 117.014, 92.417], ['A', ' HG2', 154.364, 116.287, 93.003]]
[['A', ' N ', 153.802, 119.82, 96.228], ['A', ' CA ', 153.578, 120.973, 97.088], ['A', ' C ', 153.557, 120.609, 98.593], ['A', ' O ', 152.805, 121.23, 99.358], ['A', ' CB ', 152.245, 121.626, 96.767], ['A', ' SG ', 152.135, 122.2, 95.138], ['A', ' H ', 153.424, 118.928, 96.551], ['A', ' HA ', 154.379, 121.695, 96.92], ['A', ' HB ', 151.462, 120.918, 96.923], ['A', ' HB ', 152.061, 122.462, 97.444], ['A', ' HG ', 153.198, 121.493, 94.702]]
[['A', ' N ', 154.433, 119.703, 99.063], ['A', ' CA ', 154.573, 119.299, 100.414], ['A', ' C ', 155.243, 120.489, 100.893], ['A', ' O ', 155.749, 121.199, 100.044], ['A', ' CB ', 155.503, 118.141, 100.351], ['A', ' CG ', 156.355, 118.473, 99.171], ['A', ' CD ', 155.446, 119.105, 98.23], ['A', ' HA ', 153.597, 119.109, 100.889], ['A', ' HB ', 156.078, 118.061, 101.279], ['A', ' HB ', 154.943, 117.198, 100.224], ['A', ' HG ', 157.209, 119.102, 99.464], ['A', ' HG ', 156.772, 117.565, 98.724], ['A', ' HD ', 155.978, 119.817, 97.627], ['A', ' HD ', 155.046, 118.296, 97.709]]
[['A', ' N ', 155.297, 120.7, 102.177], ['A', ' CA ', 155.962, 121.837, 102.784], ['A', ' C ', 154.871, 122.88, 102.997], ['A', ' O ', 154.391, 122.918, 104.116], ['A', ' CB ', 157.237, 122.285, 102.047], ['A', ' CG1', 158.22, 121.142, 102.089], ['A', ' CG2', 157.771, 123.477, 102.777], ['A', ' CD1', 159.263, 121.246, 101.107], ['A', ' H ', 154.854, 120.022, 102.777], ['A', ' HA ', 156.313, 121.541, 103.77], ['A', ' HB ', 157.121, 122.562, 101.058], ['A', ' HG1', 158.688, 121.114, 103.054], ['A', ' HG1', 157.713, 120.205, 101.917], ['A', ' HG2', 158.692, 123.811, 102.324], ['A', ' HG2', 157.059, 124.275, 102.74], ['A', ' HG2', 157.948, 123.203, 103.816], ['A', ' HD1', 159.893, 120.383, 101.183], ['A', ' HD1', 158.801, 121.246, 100.136], ['A', ' HD1', 159.84, 122.147, 101.243]]
[['A', ' N ', 154.334, 123.685, 102.044], ['A', ' CA ', 153.252, 124.562, 102.367], ['A', ' C ', 152.102, 123.821, 102.998], ['A', ' O ', 151.492, 124.324, 103.935], ['A', ' CB ', 152.812, 125.056, 101.019], ['A', ' CG ', 154.013, 124.995, 100.187], ['A', ' CD ', 154.742, 123.798, 100.647], ['A', ' HA ', 153.605, 125.356, 103.017], ['A', ' HB ', 151.971, 124.441, 100.638], ['A', ' HB ', 152.428, 126.066, 101.154], ['A', ' HG ', 153.705, 124.851, 99.151], ['A', ' HG ', 154.572, 125.904, 100.211], ['A', ' HD ', 154.382, 122.992, 100.05], ['A', ' HD ', 155.769, 124.008, 100.514]]
[['A', ' N ', 151.873, 122.569, 102.606], ['A', ' CA ', 150.75, 121.893, 103.21], ['A', ' C ', 150.97, 121.623, 104.685], ['A', ' O ', 150.019, 121.647, 105.469], ['A', ' CB ', 150.472, 120.56, 102.534], ['A', ' CG ', 150.05, 120.673, 101.134], ['A', ' ND1', 149.356, 121.74, 100.649], ['A', ' CD2', 150.226, 119.84, 100.094], ['A', ' CE1', 149.131, 121.569, 99.384], ['A', ' NE2', 149.632, 120.419, 99.008], ['A', ' H ', 152.351, 122.141, 101.799], ['A', ' HA ', 149.862, 122.518, 103.113], ['A', ' HB ', 151.363, 119.936, 102.573], ['A', ' HB ', 149.687, 120.038, 103.076], ['A', ' HD1', 149.09, 122.618, 101.11], ['A', ' HD2', 150.72, 118.871, 99.999], ['A', ' HE1', 148.615, 122.326, 98.849]]
[['A', ' N ', 152.208, 121.337, 105.079], ['A', ' CA ', 152.448, 120.987, 106.466], ['A', ' C ', 152.574, 122.262, 107.259], ['A', ' O ', 152.147, 122.342, 108.403], ['A', ' CB ', 153.692, 120.085, 106.638], ['A', ' OG1', 153.601, 119.403, 107.878], ['A', ' CG2', 154.997, 120.87, 106.659], ['A', ' H ', 152.985, 121.409, 104.435], ['A', ' HA ', 151.592, 120.436, 106.851], ['A', ' HB ', 153.72, 119.373, 105.832], ['A', ' HG1', 153.058, 118.58, 107.794], ['A', ' HG2', 155.823, 120.17, 106.792], ['A', ' HG2', 155.131, 121.393, 105.751], ['A', ' HG2', 155.003, 121.565, 107.482]]
[['A', ' N ', 153.137, 123.283, 106.64], ['A', ' CA ', 153.314, 124.544, 107.31], ['A', ' C ', 151.972, 125.207, 107.521], ['A', ' O ', 151.799, 125.941, 108.479], ['A', ' CB ', 154.234, 125.419, 106.477], ['A', ' CG ', 155.678, 124.975, 106.396], ['A', ' CD1', 156.328, 125.739, 105.373], ['A', ' CD2', 156.389, 125.245, 107.672], ['A', ' H ', 153.476, 123.165, 105.686], ['A', ' HA ', 153.751, 124.357, 108.285], ['A', ' HB ', 153.85, 125.424, 105.464], ['A', ' HB ', 154.205, 126.436, 106.867], ['A', ' HG ', 155.727, 123.916, 106.151], ['A', ' HD1', 157.37, 125.437, 105.3], ['A', ' HD1', 155.831, 125.561, 104.43], ['A', ' HD1', 156.28, 126.795, 105.626], ['A', ' HD2', 157.432, 124.935, 107.577], ['A', ' HD2', 156.345, 126.31, 107.876], ['A', ' HD2', 155.935, 124.709, 108.476]]
[['A', ' N ', 151.036, 124.993, 106.595], ['A', ' CA ', 149.688, 125.52, 106.701], ['A', ' C ', 148.797, 124.686, 107.649], ['A', ' O ', 147.917, 125.273, 108.288], ['A', ' CB ', 149.048, 125.61, 105.331], ['A', ' H ', 151.279, 124.462, 105.765], ['A', ' HA ', 149.759, 126.524, 107.118], ['A', ' HB ', 148.055, 126.044, 105.415], ['A', ' HB ', 149.642, 126.22, 104.668], ['A', ' HB ', 148.978, 124.614, 104.913]]
[['A', ' N ', 148.964, 123.333, 107.767], ['A', ' CA ', 148.102, 122.644, 108.751], ['A', ' C ', 148.644, 122.957, 110.15], ['A', ' O ', 147.882, 123.151, 111.104], ['A', ' CB ', 148.055, 121.153, 108.542], ['A', ' OG ', 149.243, 120.537, 108.91], ['A', ' H ', 149.6, 122.802, 107.168], ['A', ' HA ', 147.091, 123.038, 108.67], ['A', ' HB ', 147.229, 120.726, 109.106], ['A', ' HB ', 147.862, 120.965, 107.492], ['A', ' HG ', 149.188, 119.648, 108.541]]
[['A', ' N ', 149.958, 123.127, 110.241], ['A', ' CA ', 150.649, 123.593, 111.425], ['A', ' C ', 150.328, 125.037, 111.181], ['A', ' O ', 149.74, 125.293, 110.159], ['A', ' CB ', 152.146, 123.23, 111.416], ['A', ' CG1', 152.875, 123.823, 112.611], ['A', ' CG2', 152.26, 121.711, 111.454], ['A', ' H ', 150.533, 122.902, 109.426], ['A', ' HA ', 150.172, 123.244, 112.338], ['A', ' HB ', 152.607, 123.62, 110.512], ['A', ' HG1', 153.92, 123.535, 112.573], ['A', ' HG1', 152.817, 124.887, 112.605], ['A', ' HG1', 152.436, 123.467, 113.527], ['A', ' HG2', 153.295, 121.407, 111.431], ['A', ' HG2', 151.799, 121.349, 112.352], ['A', ' HG2', 151.748, 121.282, 110.593]]
[['A', ' N ', 150.441, 125.936, 112.11], ['A', ' CA ', 149.979, 127.322, 111.845], ['A', ' C ', 148.441, 127.366, 111.976], ['A', ' O ', 147.921, 128.022, 112.873], ['A', ' CB ', 150.392, 127.882, 110.46], ['A', ' CG ', 150.15, 129.377, 110.271], ['A', ' CD ', 151.075, 130.254, 111.017], ['A', ' OE1', 152.149, 129.825, 111.318], ['A', ' OE2', 150.711, 131.371, 111.282], ['A', ' H ', 150.932, 125.69, 112.982], ['A', ' HA ', 150.413, 127.992, 112.575], ['A', ' HB ', 151.442, 127.671, 110.269], ['A', ' HB ', 149.809, 127.465, 109.653], ['A', ' HG ', 150.199, 129.617, 109.209], ['A', ' HG ', 149.153, 129.601, 110.624]]
[['A', ' N ', 147.674, 126.608, 111.175], ['A', ' CA ', 146.228, 126.569, 111.429], ['A', ' C ', 145.999, 126.026, 112.832], ['A', ' O ', 145.138, 126.505, 113.575], ['A', ' CB ', 145.511, 125.729, 110.406], ['A', ' H ', 148.091, 126.078, 110.389], ['A', ' HA ', 145.843, 127.587, 111.386], ['A', ' HB ', 144.441, 125.734, 110.614], ['A', ' HB ', 145.697, 126.149, 109.426], ['A', ' HB ', 145.882, 124.711, 110.438]]
[['A', ' N ', 146.813, 125.048, 113.213], ['A', ' CA ', 146.793, 124.49, 114.545], ['A', ' C ', 147.524, 125.437, 115.509], ['A', ' O ', 147.092, 125.597, 116.639], ['A', ' CB ', 147.303, 123.049, 114.612], ['A', ' CG1', 146.304, 122.143, 113.848], ['A', ' CG2', 147.403, 122.634, 116.075], ['A', ' CD1', 146.775, 120.726, 113.583], ['A', ' H ', 147.43, 124.633, 112.507], ['A', ' HA ', 145.757, 124.443, 114.864], ['A', ' HB ', 148.277, 122.965, 114.125], ['A', ' HG1', 145.377, 122.093, 114.416], ['A', ' HG1', 146.09, 122.61, 112.886], ['A', ' HG2', 147.735, 121.621, 116.166], ['A', ' HG2', 148.11, 123.275, 116.596], ['A', ' HG2', 146.42, 122.728, 116.541], ['A', ' HD1', 146.002, 120.188, 113.033], ['A', ' HD1', 147.691, 120.758, 112.983], ['A', ' HD1', 146.97, 120.209, 114.513]]
[['A', ' N ', 148.631, 126.097, 115.083], ['A', ' CA ', 149.368, 126.993, 116.011], ['A', ' C ', 148.394, 128.102, 116.433], ['A', ' O ', 148.555, 128.762, 117.458], ['A', ' CB ', 150.539, 127.816, 115.404], ['A', ' CG ', 151.748, 127.066, 114.75], ['A', ' OD1', 151.694, 125.871, 114.622], ['A', ' OD2', 152.685, 127.731, 114.305], ['A', ' H ', 148.966, 125.946, 114.143], ['A', ' HA ', 149.688, 126.436, 116.878], ['A', ' HB ', 150.128, 128.535, 114.699], ['A', ' HB ', 150.959, 128.415, 116.218]]
[['A', ' N ', 147.426, 128.398, 115.568], ['A', ' CA ', 146.383, 129.352, 115.865], ['A', ' C ', 145.228, 128.709, 116.671], ['A', ' O ', 144.767, 129.291, 117.646], ['A', ' CB ', 145.877, 129.978, 114.56], ['A', ' CG ', 144.929, 131.166, 114.761], ['A', ' OD1', 145.126, 131.877, 115.713], ['A', ' OD2', 144.034, 131.388, 113.948], ['A', ' H ', 147.436, 127.963, 114.65], ['A', ' HA ', 146.814, 130.144, 116.478], ['A', ' HB ', 146.737, 130.312, 113.969], ['A', ' HB ', 145.381, 129.213, 113.965]]
[['A', ' N ', 144.751, 127.495, 116.302], ['A', ' CA ', 143.604, 126.93, 117.032], ['A', ' C ', 143.954, 126.637, 118.486], ['A', ' O ', 143.1, 126.72, 119.372], ['A', ' CB ', 143.137, 125.638, 116.408], ['A', ' OG ', 144.031, 124.605, 116.666], ['A', ' H ', 145.11, 127.006, 115.481], ['A', ' HA ', 142.799, 127.654, 116.999], ['A', ' HB ', 142.154, 125.379, 116.785], ['A', ' HB ', 143.051, 125.777, 115.331], ['A', ' HG ', 143.694, 123.838, 116.203]]
[['A', ' N ', 145.208, 126.324, 118.726], ['A', ' CA ', 145.76, 126.125, 120.04], ['A', ' C ', 146.592, 127.352, 120.191], ['A', ' O ', 147.294, 127.677, 119.263], ['A', ' CB ', 146.666, 124.901, 120.049], ['A', ' CG ', 146.045, 123.577, 119.698], ['A', ' CD1', 147.14, 122.538, 119.611], ['A', ' CD2', 145.051, 123.21, 120.75], ['A', ' H ', 145.834, 126.203, 117.925], ['A', ' HA ', 144.988, 126.105, 120.804], ['A', ' HB ', 147.434, 125.081, 119.305], ['A', ' HB ', 147.142, 124.815, 121.028], ['A', ' HG ', 145.544, 123.638, 118.731], ['A', ' HD1', 146.71, 121.565, 119.368], ['A', ' HD1', 147.841, 122.82, 118.847], ['A', ' HD1', 147.657, 122.489, 120.548], ['A', ' HD2', 144.611, 122.259, 120.509], ['A', ' HD2', 145.539, 123.145, 121.726], ['A', ' HD2', 144.281, 123.96, 120.784]]
[['A', ' N ', 146.662, 127.992, 121.325], ['A', ' CA ', 147.487, 129.195, 121.304], ['A', ' C ', 148.961, 128.887, 121.503], ['A', ' O ', 149.466, 128.863, 122.627], ['A', ' CB ', 146.973, 130.172, 122.355], ['A', ' CG ', 145.606, 130.725, 121.955], ['A', ' OD1', 145.471, 131.221, 120.857], ['A', ' OD2', 144.654, 130.617, 122.708], ['A', ' H ', 146.118, 127.72, 122.13], ['A', ' HA ', 147.378, 129.669, 120.325], ['A', ' HB ', 146.893, 129.671, 123.32], ['A', ' HB ', 147.677, 130.997, 122.465]]
[['A', ' N ', 149.651, 128.636, 120.392], ['A', ' CA ', 151.045, 128.229, 120.431], ['A', ' C ', 151.982, 129.308, 119.924], ['A', ' O ', 151.896, 129.726, 118.771], ['A', ' CB ', 151.235, 126.967, 119.584], ['A', ' CG1', 150.356, 125.862, 120.151], ['A', ' CG2', 152.668, 126.544, 119.556], ['A', ' CD1', 150.264, 124.598, 119.33], ['A', ' H ', 149.15, 128.672, 119.482], ['A', ' HA ', 151.312, 128.004, 121.463], ['A', ' HB ', 150.911, 127.176, 118.581], ['A', ' HG1', 150.724, 125.623, 121.11], ['A', ' HG1', 149.355, 126.245, 120.262], ['A', ' HG2', 152.782, 125.667, 118.942], ['A', ' HG2', 153.296, 127.33, 119.14], ['A', ' HG2', 152.971, 126.326, 120.572], ['A', ' HD1', 149.624, 123.908, 119.847], ['A', ' HD1', 149.852, 124.804, 118.355], ['A', ' HD1', 151.233, 124.14, 119.212]]
[['A', ' N ', 152.904, 129.74, 120.774], ['A', ' CA ', 153.852, 130.76, 120.366], ['A', ' C ', 155.182, 130.154, 119.978], ['A', ' O ', 155.906, 129.607, 120.81], ['A', ' CB ', 154.087, 131.785, 121.466], ['A', ' CG ', 155.067, 132.888, 121.056], ['A', ' CD ', 155.294, 133.915, 122.112], ['A', ' OE1', 154.677, 133.835, 123.144], ['A', ' OE2', 156.093, 134.792, 121.884], ['A', ' H ', 152.929, 129.365, 121.714], ['A', ' HA ', 153.45, 131.28, 119.496], ['A', ' HB ', 153.14, 132.25, 121.742], ['A', ' HB ', 154.485, 131.291, 122.351], ['A', ' HG ', 156.032, 132.442, 120.808], ['A', ' HG ', 154.687, 133.375, 120.162]]
[['A', ' N ', 155.511, 130.275, 118.712], ['A', ' CA ', 156.723, 129.701, 118.18], ['A', ' C ', 157.826, 130.772, 118.169], ['A', ' O ', 157.599, 131.833, 117.597], ['A', ' CB ', 156.447, 129.191, 116.769], ['A', ' CG1', 157.694, 128.617, 116.191], ['A', ' CG2', 155.318, 128.156, 116.827], ['A', ' H ', 154.865, 130.751, 118.097], ['A', ' HA ', 156.982, 128.853, 118.799], ['A', ' HB ', 156.147, 130.024, 116.136], ['A', ' HG1', 157.505, 128.273, 115.179], ['A', ' HG1', 158.464, 129.373, 116.171], ['A', ' HG1', 158.034, 127.772, 116.797], ['A', ' HG2', 155.096, 127.783, 115.828], ['A', ' HG2', 155.618, 127.332, 117.459], ['A', ' HG2', 154.414, 128.603, 117.236]]
[['A', ' N ', 158.987, 130.547, 118.808], ['A', ' CA ', 160.111, 131.469, 118.935], ['A', ' C ', 160.864, 131.634, 117.633], ['A', ' O ', 160.797, 130.754, 116.775], ['A', ' CB ', 160.984, 130.786, 119.988], ['A', ' CG ', 160.69, 129.326, 119.837], ['A', ' CD ', 159.225, 129.247, 119.472], ['A', ' HA ', 159.739, 132.441, 119.296], ['A', ' HB ', 162.05, 131.008, 119.795], ['A', ' HB ', 160.748, 131.172, 120.989], ['A', ' HG ', 161.339, 128.891, 119.058], ['A', ' HG ', 160.926, 128.784, 120.768], ['A', ' HD ', 159.113, 128.404, 118.777], ['A', ' HD ', 158.598, 129.139, 120.378]]
[['A', ' N ', 161.651, 132.696, 117.493], ['A', ' CA ', 162.424, 132.789, 116.268], ['A', ' C ', 163.611, 131.858, 116.279], ['A', ' O ', 164.567, 131.987, 117.038], ['A', ' CB ', 162.865, 134.21, 115.984], ['A', ' CG ', 161.733, 135.122, 115.598], ['A', ' CD ', 162.241, 136.51, 115.266], ['A', ' CE ', 161.109, 137.428, 114.83], ['A', ' NZ ', 161.599, 138.798, 114.503], ['A', ' H ', 161.708, 133.412, 118.206], ['A', ' HA ', 161.793, 132.481, 115.441], ['A', ' HB ', 163.352, 134.623, 116.866], ['A', ' HB ', 163.595, 134.21, 115.18], ['A', ' HG ', 161.23, 134.709, 114.72], ['A', ' HG ', 161.013, 135.18, 116.413], ['A', ' HD ', 162.726, 136.939, 116.144], ['A', ' HD ', 162.974, 136.45, 114.463], ['A', ' HE ', 160.628, 137.005, 113.948], ['A', ' HE ', 160.375, 137.497, 115.633], ['A', ' HZ ', 160.823, 139.379, 114.217], ['A', ' HZ ', 162.038, 139.204, 115.319], ['A', ' HZ ', 162.272, 138.746, 113.752]]
[['A', ' N ', 163.463, 130.914, 115.389], ['A', ' CA ', 164.251, 129.762, 115.035], ['A', ' C ', 163.184, 128.855, 114.489], ['A', ' O ', 163.036, 128.665, 113.286], ['A', ' CB ', 165.0, 129.154, 116.207], ['A', ' H ', 162.608, 131.005, 114.866], ['A', ' HA ', 164.952, 130.011, 114.241], ['A', ' HB ', 165.523, 128.256, 115.874], ['A', ' HB ', 165.73, 129.867, 116.579], ['A', ' HB ', 164.317, 128.892, 117.015]]
[['A', ' N ', 162.264, 128.497, 115.366], ['A', ' CA ', 161.081, 127.747, 114.979], ['A', ' C ', 160.247, 128.559, 114.009], ['A', ' O ', 159.674, 128.026, 113.079], ['A', ' H ', 162.413, 128.707, 116.345], ['A', ' HA ', 161.368, 126.809, 114.511], ['A', ' HA ', 160.497, 127.498, 115.864]]
[['A', ' N ', 160.246, 129.879, 114.175], ['A', ' CA ', 159.501, 130.791, 113.315], ['A', ' C ', 160.371, 131.328, 112.173], ['A', ' O ', 159.956, 132.227, 111.455], ['A', ' CB ', 158.964, 131.972, 114.139], ['A', ' CG ', 157.949, 132.926, 113.449], ['A', ' CD ', 157.61, 134.096, 114.293], ['A', ' NE ', 156.813, 133.757, 115.462], ['A', ' CZ ', 156.565, 134.598, 116.495], ['A', ' NH1', 157.064, 135.817, 116.501], ['A', ' NH2', 155.811, 134.207, 117.502], ['A', ' H ', 160.693, 130.233, 115.018], ['A', ' HA ', 158.656, 130.252, 112.891], ['A', ' HB ', 158.5, 131.594, 115.047], ['A', ' HB ', 159.79, 132.589, 114.445], ['A', ' HG ', 158.312, 133.353, 112.536], ['A', ' HG ', 157.032, 132.377, 113.247], ['A', ' HD ', 158.541, 134.549, 114.633], ['A', ' HD ', 157.052, 134.815, 113.696], ['A', ' HE ', 156.408, 132.83, 115.504], ['A', ' HH1', 157.637, 136.131, 115.739], ['A', ' HH1', 156.872, 136.436, 117.277], ['A', ' HH2', 155.418, 133.28, 117.5], ['A', ' HH2', 155.622, 134.842, 118.265]]
[['A', ' N ', 161.607, 130.857, 112.035], ['A', ' CA ', 162.445, 131.333, 110.938], ['A', ' C ', 162.54, 130.252, 109.919], ['A', ' O ', 162.319, 130.474, 108.747], ['A', ' CB ', 163.849, 131.689, 111.4], ['A', ' CG ', 163.974, 132.793, 112.421], ['A', ' CD1', 165.425, 132.915, 112.811], ['A', ' CD2', 163.464, 134.099, 111.864], ['A', ' H ', 161.933, 130.093, 112.619], ['A', ' HA ', 161.978, 132.188, 110.456], ['A', ' HB ', 164.304, 130.795, 111.819], ['A', ' HB ', 164.422, 131.98, 110.527], ['A', ' HG ', 163.403, 132.544, 113.288], ['A', ' HD1', 165.534, 133.696, 113.562], ['A', ' HD1', 165.776, 131.975, 113.222], ['A', ' HD1', 166.016, 133.171, 111.931], ['A', ' HD2', 163.575, 134.877, 112.615], ['A', ' HD2', 164.036, 134.373, 110.976], ['A', ' HD2', 162.411, 134.017, 111.602]]
[['A', ' N ', 162.612, 129.022, 110.381], ['A', ' CA ', 162.804, 127.839, 109.562], ['A', ' C ', 161.461, 127.293, 109.05], ['A', ' O ', 161.256, 126.089, 108.899], ['A', ' CB ', 163.451, 126.794, 110.469], ['A', ' CG ', 164.796, 127.165, 111.126], ['A', ' CD1', 165.221, 126.042, 112.073], ['A', ' CD2', 165.802, 127.407, 110.1], ['A', ' H ', 162.688, 128.894, 111.385], ['A', ' HA ', 163.426, 128.088, 108.704], ['A', ' HB ', 162.748, 126.557, 111.279], ['A', ' HB ', 163.608, 125.924, 109.9], ['A', ' HG ', 164.692, 128.065, 111.71], ['A', ' HD1', 166.16, 126.308, 112.551], ['A', ' HD1', 164.455, 125.903, 112.843], ['A', ' HD1', 165.345, 125.113, 111.521], ['A', ' HD2', 166.718, 127.643, 110.568], ['A', ' HD2', 165.932, 126.539, 109.518], ['A', ' HD2', 165.508, 128.232, 109.468]]
[['A', ' N ', 160.532, 128.208, 108.824], ['A', ' CA ', 159.193, 127.96, 108.331], ['A', ' C ', 159.24, 128.645, 107.007], ['A', ' O ', 158.484, 128.344, 106.092], ['A', ' CB ', 158.149, 128.569, 109.234], ['A', ' CG ', 158.219, 128.072, 110.629], ['A', ' CD ', 157.688, 126.686, 110.885], ['A', ' NE ', 156.231, 126.637, 110.746], ['A', ' CZ ', 155.341, 126.976, 111.721], ['A', ' NH1', 155.719, 127.376, 112.894], ['A', ' NH2', 154.056, 126.926, 111.531], ['A', ' H ', 160.867, 129.168, 108.855], ['A', ' HA ', 159.022, 126.895, 108.187], ['A', ' HB ', 158.271, 129.652, 109.251], ['A', ' HB ', 157.165, 128.348, 108.858], ['A', ' HG ', 159.264, 128.049, 110.85], ['A', ' HG ', 157.72, 128.769, 111.289], ['A', ' HD ', 158.124, 125.981, 110.175], ['A', ' HD ', 157.958, 126.371, 111.895], ['A', ' HE ', 155.855, 126.343, 109.859], ['A', ' HH1', 156.703, 127.456, 113.114], ['A', ' HH1', 154.966, 127.609, 113.579], ['A', ' HH2', 153.654, 126.634, 110.642], ['A', ' HH2', 153.452, 127.216, 112.33]]
[['A', ' N ', 160.144, 129.617, 106.958], ['A', ' CA ', 160.499, 130.322, 105.757], ['A', ' C ', 161.885, 129.716, 105.664], ['A', ' O ', 162.157, 128.862, 106.501], ['A', ' CB ', 160.353, 131.842, 105.808], ['A', ' CG ', 161.059, 132.582, 106.858], ['A', ' CD ', 160.862, 134.06, 106.678], ['A', ' OE1', 160.611, 134.463, 105.569], ['A', ' OE2', 160.959, 134.791, 107.625], ['A', ' H ', 160.713, 129.818, 107.783], ['A', ' HA ', 159.909, 129.97, 104.912], ['A', ' HB ', 160.672, 132.253, 104.85], ['A', ' HB ', 159.301, 132.084, 105.915], ['A', ' HG ', 160.656, 132.288, 107.832], ['A', ' HG ', 162.108, 132.335, 106.842]]
[['A', ' N ', 162.718, 130.007, 104.661], ['A', ' CA ', 163.974, 129.227, 104.42], ['A', ' C ', 163.511, 127.903, 103.808], ['A', ' O ', 163.81, 127.586, 102.664], ['A', ' CB ', 164.855, 128.949, 105.641], ['A', ' CG ', 166.12, 128.107, 105.354], ['A', ' CD1', 167.031, 128.813, 104.382], ['A', ' CD2', 166.825, 127.847, 106.642], ['A', ' H ', 162.464, 130.745, 104.028], ['A', ' HA ', 164.559, 129.764, 103.684], ['A', ' HB ', 165.149, 129.88, 106.048], ['A', ' HB ', 164.335, 128.394, 106.392], ['A', ' HG ', 165.832, 127.155, 104.916], ['A', ' HD1', 167.911, 128.2, 104.206], ['A', ' HD1', 166.537, 128.965, 103.444], ['A', ' HD1', 167.327, 129.768, 104.789], ['A', ' HD2', 167.701, 127.235, 106.45], ['A', ' HD2', 167.129, 128.787, 107.103], ['A', ' HD2', 166.15, 127.317, 107.294]]
[['A', ' N ', 162.735, 127.186, 104.601], ['A', ' CA ', 161.873, 126.104, 104.243], ['A', ' C ', 160.92, 126.926, 103.368], ['A', ' O ', 160.792, 128.119, 103.601], ['A', ' CB ', 161.136, 125.573, 105.494], ['A', ' OG1', 162.069, 125.162, 106.502], ['A', ' CG2', 160.327, 124.414, 105.139], ['A', ' H ', 162.676, 127.494, 105.562], ['A', ' HA ', 162.383, 125.333, 103.667], ['A', ' HB ', 160.507, 126.37, 105.896], ['A', ' HG1', 161.647, 125.249, 107.412], ['A', ' HG2', 159.811, 124.057, 106.027], ['A', ' HG2', 159.613, 124.708, 104.405], ['A', ' HG2', 160.97, 123.627, 104.742]]
[['A', ' N ', 160.378, 126.394, 102.3], ['A', ' CA ', 159.51, 127.157, 101.365], ['A', ' C ', 160.29, 128.045, 100.456], ['A', ' O ', 160.09, 128.036, 99.251], ['A', ' CB ', 158.497, 128.117, 101.978], ['A', ' CG ', 157.426, 127.576, 102.688], ['A', ' CD1', 156.742, 128.676, 103.333], ['A', ' CD2', 156.473, 126.891, 101.75], ['A', ' H ', 160.587, 125.416, 102.13], ['A', ' HA ', 158.966, 126.454, 100.768], ['A', ' HB ', 158.958, 128.877, 102.575], ['A', ' HB ', 158.049, 128.648, 101.137], ['A', ' HG ', 157.798, 126.895, 103.433], ['A', ' HD1', 155.918, 128.292, 103.905], ['A', ' HD1', 157.448, 129.17, 103.992], ['A', ' HD1', 156.381, 129.373, 102.586], ['A', ' HD2', 155.644, 126.511, 102.315], ['A', ' HD2', 156.111, 127.612, 101.016], ['A', ' HD2', 156.937, 126.07, 101.238]]
[['A', ' N ', 161.133, 128.894, 100.994], ['A', ' CA ', 161.9, 129.701, 100.075], ['A', ' C ', 162.709, 128.7, 99.223], ['A', ' O ', 162.709, 128.723, 97.979], ['A', ' CB ', 162.729, 130.682, 100.856], ['A', ' H ', 161.228, 128.91, 102.009], ['A', ' HA ', 161.222, 130.245, 99.416], ['A', ' HB ', 163.307, 131.266, 100.191], ['A', ' HB ', 162.071, 131.328, 101.433], ['A', ' HB ', 163.378, 130.137, 101.521]]
[['A', ' N ', 163.269, 127.712, 99.91], ['A', ' CA ', 163.868, 126.573, 99.289], ['A', ' C ', 162.696, 125.629, 99.241], ['A', ' O ', 162.163, 125.24, 100.271], ['A', ' CB ', 165.046, 126.047, 100.063], ['A', ' H ', 163.281, 127.743, 100.927], ['A', ' HA ', 164.167, 126.815, 98.275], ['A', ' HB ', 165.424, 125.148, 99.582], ['A', ' HB ', 165.821, 126.814, 100.086], ['A', ' HB ', 164.733, 125.812, 101.075]]
[['A', ' N ', 162.223, 125.388, 98.055], ['A', ' CA ', 161.008, 124.663, 97.735], ['A', ' C ', 160.324, 125.438, 96.65], ['A', ' O ', 160.038, 124.883, 95.593], ['A', ' CB ', 160.062, 124.451, 98.874], ['A', ' CG ', 158.869, 123.857, 98.419], ['A', ' ND1', 158.835, 122.607, 97.897], ['A', ' CD2', 157.617, 124.321, 98.379], ['A', ' CE1', 157.62, 122.32, 97.544], ['A', ' NE2', 156.845, 123.344, 97.826], ['A', ' H ', 162.757, 125.782, 97.303], ['A', ' HA ', 161.251, 123.685, 97.362], ['A', ' HB ', 160.481, 123.784, 99.619], ['A', ' HB ', 159.845, 125.36, 99.293], ['A', ' HD1', 159.603, 121.979, 97.786], ['A', ' HD2', 157.175, 125.267, 98.683], ['A', ' HE1', 157.407, 121.368, 97.087]]
[['A', ' N ', 160.138, 126.743, 96.839], ['A', ' CA ', 159.6, 127.519, 95.755], ['A', ' C ', 160.582, 127.411, 94.634], ['A', ' O ', 160.227, 127.003, 93.535], ['A', ' CB ', 159.461, 128.997, 96.101], ['A', ' CG ', 158.377, 129.348, 96.995], ['A', ' ND1', 158.098, 130.64, 97.297], ['A', ' CD2', 157.491, 128.608, 97.673], ['A', ' CE1', 157.069, 130.692, 98.091], ['A', ' NE2', 156.675, 129.481, 98.343], ['A', ' H ', 160.301, 127.19, 97.738], ['A', ' HA ', 158.648, 127.121, 95.431], ['A', ' HB ', 160.38, 129.324, 96.58], ['A', ' HB ', 159.348, 129.585, 95.187], ['A', ' HD2', 157.437, 127.527, 97.673], ['A', ' HE1', 156.612, 131.595, 98.479], ['A', ' HE2', 155.872, 129.279, 98.947]]
[['A', ' N ', 161.867, 127.524, 94.935], ['A', ' CA ', 162.836, 127.401, 93.857], ['A', ' C ', 162.709, 126.015, 93.215], ['A', ' O ', 162.772, 125.884, 91.993], ['A', ' CB ', 164.279, 127.62, 94.376], ['A', ' CG1', 165.322, 127.291, 93.275], ['A', ' CG2', 164.444, 129.074, 94.828], ['A', ' H ', 162.135, 127.838, 95.877], ['A', ' HA ', 162.618, 128.156, 93.105], ['A', ' HB ', 164.465, 126.948, 95.215], ['A', ' HG1', 166.331, 127.446, 93.667], ['A', ' HG1', 165.238, 126.249, 92.949], ['A', ' HG1', 165.168, 127.945, 92.421], ['A', ' HG2', 165.454, 129.218, 95.202], ['A', ' HG2', 164.269, 129.747, 93.984], ['A', ' HG2', 163.734, 129.305, 95.623]]
[['A', ' N ', 162.528, 124.998, 94.047], ['A', ' CA ', 162.435, 123.61, 93.616], ['A', ' C ', 161.131, 123.286, 92.896], ['A', ' O ', 161.064, 122.284, 92.187], ['A', ' CB ', 162.495, 122.673, 94.797], ['A', ' CG ', 163.773, 122.734, 95.53], ['A', ' OD1', 164.733, 123.313, 95.046], ['A', ' ND2', 163.8, 122.15, 96.701], ['A', ' H ', 162.484, 125.217, 95.025], ['A', ' HA ', 163.257, 123.411, 92.932], ['A', ' HB ', 161.675, 122.864, 95.443], ['A', ' HB ', 162.366, 121.653, 94.437], ['A', ' HD2', 164.641, 122.149, 97.266], ['A', ' HD2', 162.989, 121.687, 97.044]]
[['A', ' N ', 160.08, 124.071, 93.145], ['A', ' CA ', 158.775, 123.856, 92.553], ['A', ' C ', 158.655, 124.612, 91.258], ['A', ' O ', 157.889, 124.215, 90.374], ['A', ' CB ', 157.707, 124.316, 93.49], ['A', ' OG ', 157.712, 123.557, 94.647], ['A', ' H ', 160.179, 124.874, 93.761], ['A', ' HA ', 158.651, 122.792, 92.348], ['A', ' HB ', 157.886, 125.358, 93.738], ['A', ' HB ', 156.737, 124.248, 93.004], ['A', ' HG ', 158.495, 123.873, 95.145]]
[['A', ' N ', 159.395, 125.71, 91.136], ['A', ' CA ', 159.397, 126.432, 89.889], ['A', ' C ', 160.306, 125.601, 88.983], ['A', ' O ', 160.004, 125.371, 87.812], ['A', ' CB ', 159.836, 127.848, 90.093], ['A', ' CG ', 158.864, 128.62, 90.915], ['A', ' ND1', 157.528, 128.681, 90.607], ['A', ' CD2', 159.029, 129.377, 92.017], ['A', ' CE1', 156.915, 129.439, 91.492], ['A', ' NE2', 157.802, 129.867, 92.351], ['A', ' H ', 159.928, 126.046, 91.936], ['A', ' HA ', 158.401, 126.449, 89.453], ['A', ' HB ', 160.77, 127.813, 90.619], ['A', ' HB ', 159.975, 128.347, 89.138], ['A', ' HD2', 159.964, 129.57, 92.544], ['A', ' HE1', 155.849, 129.679, 91.514], ['A', ' HE2', 157.586, 130.492, 93.143]]
[['A', ' N ', 161.358, 125.03, 89.567], ['A', ' CA ', 162.128, 124.018, 88.883], ['A', ' C ', 161.061, 122.935, 88.824], ['A', ' O ', 160.06, 123.102, 89.477], ['A', ' CB ', 163.387, 123.619, 89.626], ['A', ' H ', 161.649, 125.321, 90.5], ['A', ' HA ', 162.377, 124.343, 87.873], ['A', ' HB ', 163.887, 122.812, 89.11], ['A', ' HB ', 164.057, 124.479, 89.692], ['A', ' HB ', 163.124, 123.297, 90.619]]
[['A', ' N ', 161.137, 121.939, 87.985], ['A', ' CA ', 160.001, 120.998, 87.828], ['A', ' C ', 158.958, 121.713, 86.953], ['A', ' O ', 158.727, 121.302, 85.826], ['A', ' CB ', 159.331, 120.465, 89.129], ['A', ' CG1', 160.365, 119.72, 90.032], ['A', ' CG2', 158.169, 119.532, 88.729], ['A', ' CD1', 161.05, 118.493, 89.422], ['A', ' H ', 161.984, 121.829, 87.45], ['A', ' HA ', 160.34, 120.122, 87.302], ['A', ' HB ', 158.877, 121.243, 89.719], ['A', ' HG1', 161.121, 120.436, 90.323], ['A', ' HG1', 159.843, 119.397, 90.933], ['A', ' HG2', 157.687, 119.149, 89.628], ['A', ' HG2', 157.432, 120.076, 88.144], ['A', ' HG2', 158.536, 118.708, 88.137], ['A', ' HD1', 161.721, 118.065, 90.155], ['A', ' HD1', 160.325, 117.767, 89.167], ['A', ' HD1', 161.613, 118.766, 88.541]]
[['A', ' N ', 158.399, 122.841, 87.356], ['A', ' CA ', 157.518, 123.528, 86.409], ['A', ' C ', 158.297, 123.837, 85.127], ['A', ' O ', 157.83, 123.582, 84.017], ['A', ' CB ', 156.943, 124.795, 86.982], ['A', ' CG ', 156.172, 125.576, 86.037], ['A', ' ND1', 154.978, 125.175, 85.538], ['A', ' CD2', 156.413, 126.778, 85.533], ['A', ' CE1', 154.484, 126.12, 84.774], ['A', ' NE2', 155.326, 127.135, 84.768], ['A', ' H ', 158.556, 123.2, 88.316], ['A', ' HA ', 156.683, 122.881, 86.149], ['A', ' HB ', 156.302, 124.548, 87.832], ['A', ' HB ', 157.715, 125.423, 87.348], ['A', ' HD1', 154.469, 124.309, 85.777], ['A', ' HD2', 157.245, 127.471, 85.666], ['A', ' HE1', 153.513, 125.985, 84.29]]
[['A', ' N ', 159.543, 124.281, 85.274], ['A', ' CA ', 160.409, 124.628, 84.153], ['A', ' C ', 161.169, 123.396, 83.634], ['A', ' O ', 162.201, 123.512, 82.982], ['A', ' CB ', 161.418, 125.721, 84.54], ['A', ' CG ', 160.809, 127.061, 84.866], ['A', ' ND1', 160.224, 127.863, 83.916], ['A', ' CD2', 160.733, 127.742, 86.026], ['A', ' CE1', 159.791, 128.972, 84.484], ['A', ' NE2', 160.079, 128.915, 85.769], ['A', ' H ', 159.853, 124.49, 86.225], ['A', ' HA ', 159.801, 125.011, 83.335], ['A', ' HB ', 161.984, 125.393, 85.414], ['A', ' HB ', 162.128, 125.866, 83.729], ['A', ' HD1', 160.161, 127.668, 82.938], ['A', ' HD2', 161.071, 127.522, 87.028], ['A', ' HE1', 159.28, 129.742, 83.89]]
[['A', ' N ', 160.656, 122.217, 83.961], ['A', ' CA ', 161.094, 120.91, 83.488], ['A', ' C ', 159.967, 120.36, 82.63], ['A', ' O ', 160.18, 119.907, 81.511], ['A', ' CB ', 161.355, 119.976, 84.651], ['A', ' CG ', 161.687, 118.614, 84.329], ['A', ' CD1', 162.857, 118.257, 83.721], ['A', ' CD2', 160.776, 117.629, 84.676], ['A', ' CE1', 163.098, 116.936, 83.447], ['A', ' CE2', 161.026, 116.326, 84.41], ['A', ' CZ ', 162.185, 115.978, 83.792], ['A', ' H ', 159.839, 122.219, 84.558], ['A', ' HA ', 161.992, 121.021, 82.879], ['A', ' HB ', 162.116, 120.381, 85.299], ['A', ' HB ', 160.472, 119.911, 85.193], ['A', ' HD1', 163.585, 119.023, 83.445], ['A', ' HD2', 159.843, 117.911, 85.168], ['A', ' HE1', 164.013, 116.641, 82.951], ['A', ' HE2', 160.301, 115.561, 84.684], ['A', ' HZ ', 162.385, 114.941, 83.572]]
[['A', ' N ', 158.759, 120.426, 83.19], ['A', ' CA ', 157.514, 119.989, 82.586], ['A', ' C ', 157.068, 120.877, 81.445], ['A', ' O ', 156.522, 120.401, 80.458], ['A', ' CB ', 156.42, 120.035, 83.645], ['A', ' CG ', 156.48, 119.028, 84.763], ['A', ' CD1', 155.473, 119.429, 85.804], ['A', ' CD2', 156.131, 117.667, 84.226], ['A', ' H ', 158.702, 120.781, 84.131], ['A', ' HA ', 157.648, 118.984, 82.207], ['A', ' HB ', 156.443, 121.026, 84.103], ['A', ' HB ', 155.458, 119.921, 83.147], ['A', ' HG ', 157.472, 119.015, 85.212], ['A', ' HD1', 155.482, 118.713, 86.626], ['A', ' HD1', 155.716, 120.423, 86.188], ['A', ' HD1', 154.48, 119.449, 85.353], ['A', ' HD2', 156.127, 116.945, 85.007], ['A', ' HD2', 155.138, 117.702, 83.803], ['A', ' HD2', 156.834, 117.348, 83.467]]
[['A', ' N ', 157.31, 122.17, 81.535], ['A', ' CA ', 156.856, 123.065, 80.488], ['A', ' C ', 157.981, 123.304, 79.502], ['A', ' O ', 157.755, 123.655, 78.337], ['A', ' CB ', 156.332, 124.396, 81.046], ['A', ' CG1', 154.941, 124.288, 81.614], ['A', ' CG2', 156.222, 125.385, 79.925], ['A', ' CD1', 154.653, 123.202, 82.633], ['A', ' H ', 157.735, 122.561, 82.38], ['A', ' HA ', 156.038, 122.588, 79.947], ['A', ' HB ', 156.988, 124.77, 81.828], ['A', ' HG1', 154.73, 125.24, 82.087], ['A', ' HG1', 154.285, 124.176, 80.793], ['A', ' HG2', 155.814, 126.299, 80.306], ['A', ' HG2', 157.182, 125.585, 79.507], ['A', ' HG2', 155.551, 124.996, 79.149], ['A', ' HD1', 153.627, 123.298, 82.95], ['A', ' HD1', 154.785, 122.223, 82.206], ['A', ' HD1', 155.305, 123.316, 83.493]]
[['A', ' N ', 159.201, 123.081, 79.941], ['A', ' CA ', 160.336, 123.316, 79.093], ['A', ' C ', 160.203, 122.703, 77.694], ['A', ' O ', 160.493, 123.415, 76.75], ['A', ' CB ', 161.591, 122.816, 79.763], ['A', ' H ', 159.354, 122.787, 80.899], ['A', ' HA ', 160.432, 124.393, 78.965], ['A', ' HB ', 162.446, 123.038, 79.15], ['A', ' HB ', 161.691, 123.315, 80.699], ['A', ' HB ', 161.558, 121.76, 79.935]]
[['A', ' N ', 159.685, 121.482, 77.439], ['A', ' CA ', 159.596, 120.929, 76.101], ['A', ' C ', 158.758, 121.8, 75.15], ['A', ' O ', 158.832, 121.624, 73.935], ['A', ' CB ', 158.947, 119.57, 76.331], ['A', ' CG ', 159.274, 119.24, 77.756], ['A', ' CD ', 159.232, 120.556, 78.467], ['A', ' HA ', 160.615, 120.811, 75.703], ['A', ' HB ', 157.879, 119.637, 76.125], ['A', ' HB ', 159.362, 118.837, 75.621], ['A', ' HG ', 158.548, 118.521, 78.16], ['A', ' HG ', 160.25, 118.759, 77.822], ['A', ' HD ', 158.206, 120.749, 78.736], ['A', ' HD ', 159.882, 120.531, 79.3]]
[['A', ' N ', 157.928, 122.706, 75.685], ['A', ' CA ', 157.125, 123.554, 74.825], ['A', ' C ', 157.873, 124.826, 74.445], ['A', ' O ', 157.614, 125.402, 73.386], ['A', ' CB ', 155.833, 123.963, 75.513], ['A', ' CG ', 154.955, 122.794, 75.822], ['A', ' OD1', 154.805, 121.908, 75.002], ['A', ' OD2', 154.435, 122.772, 76.912], ['A', ' H ', 157.868, 122.852, 76.69], ['A', ' HA ', 156.887, 123.005, 73.915], ['A', ' HB ', 156.076, 124.479, 76.447], ['A', ' HB ', 155.302, 124.668, 74.889]]
[['A', ' N ', 158.771, 125.297, 75.316], ['A', ' CA ', 159.469, 126.556, 75.006], ['A', ' C ', 160.961, 126.436, 74.723], ['A', ' O ', 161.559, 127.339, 74.137], ['A', ' CB ', 159.243, 127.593, 76.095], ['A', ' CG ', 157.824, 127.985, 76.203], ['A', ' CD1', 157.106, 127.651, 77.293], ['A', ' CD2', 157.194, 128.678, 75.175], ['A', ' CE1', 155.785, 127.99, 77.399], ['A', ' CE2', 155.871, 129.024, 75.271], ['A', ' CZ ', 155.166, 128.677, 76.392], ['A', ' H ', 158.95, 124.762, 76.179], ['A', ' HA ', 159.021, 126.957, 74.099], ['A', ' HB ', 159.566, 127.192, 77.055], ['A', ' HB ', 159.835, 128.48, 75.891], ['A', ' HD1', 157.596, 127.112, 78.09], ['A', ' HD2', 157.755, 128.953, 74.273], ['A', ' HE1', 155.225, 127.71, 78.29], ['A', ' HE2', 155.387, 129.567, 74.456], ['A', ' HZ ', 154.119, 128.942, 76.482]]
[['A', ' N ', 161.559, 125.349, 75.145], ['A', ' CA ', 162.97, 125.11, 74.984], ['A', ' C ', 163.175, 124.252, 73.736], ['A', ' O ', 162.604, 123.171, 73.654], ['A', ' CB ', 163.518, 124.378, 76.218], ['A', ' CG1', 164.967, 124.05, 76.046], ['A', ' CG2', 163.351, 125.233, 77.444], ['A', ' H ', 161.013, 124.642, 75.619], ['A', ' HA ', 163.475, 126.061, 74.922], ['A', ' HB ', 162.971, 123.465, 76.339], ['A', ' HG1', 165.325, 123.523, 76.915], ['A', ' HG1', 165.103, 123.417, 75.183], ['A', ' HG1', 165.529, 124.969, 75.921], ['A', ' HG2', 163.726, 124.704, 78.313], ['A', ' HG2', 163.905, 126.134, 77.329], ['A', ' HG2', 162.301, 125.465, 77.587]]
[['A', ' N ', 163.967, 124.682, 72.75], ['A', ' CA ', 164.247, 123.938, 71.543], ['A', ' C ', 164.812, 122.618, 71.979], ['A', ' O ', 165.543, 122.579, 72.963], ['A', ' CB ', 165.295, 124.795, 70.84], ['A', ' CG ', 165.05, 126.189, 71.363], ['A', ' CD ', 164.595, 126.005, 72.796], ['A', ' HA ', 163.327, 123.812, 70.948], ['A', ' HB ', 166.298, 124.414, 71.067], ['A', ' HB ', 165.167, 124.724, 69.75], ['A', ' HG ', 165.966, 126.794, 71.284], ['A', ' HG ', 164.287, 126.692, 70.747], ['A', ' HD ', 165.431, 126.011, 73.491], ['A', ' HD ', 163.859, 126.801, 72.996]]
[['A', ' N ', 164.592, 121.55, 71.229], ['A', ' CA ', 165.081, 120.253, 71.683], ['A', ' C ', 166.59, 120.221, 71.87], ['A', ' O ', 167.092, 119.518, 72.746], ['A', ' CB ', 164.635, 119.142, 70.72], ['A', ' CG ', 165.14, 119.239, 69.26], ['A', ' CD ', 164.273, 120.104, 68.371], ['A', ' OE1', 163.616, 120.988, 68.884], ['A', ' OE2', 164.266, 119.881, 67.187], ['A', ' H ', 164.021, 121.606, 70.379], ['A', ' HA ', 164.615, 120.043, 72.641], ['A', ' HB ', 164.967, 118.18, 71.111], ['A', ' HB ', 163.546, 119.116, 70.687], ['A', ' HG ', 166.157, 119.611, 69.229], ['A', ' HG ', 165.156, 118.232, 68.847]]
[['A', ' N ', 167.306, 121.077, 71.158], ['A', ' CA ', 168.751, 121.149, 71.23], ['A', ' C ', 169.237, 121.634, 72.584], ['A', ' O ', 170.398, 121.436, 72.941], ['A', ' CB ', 169.256, 122.081, 70.163], ['A', ' CG ', 169.119, 121.508, 68.813], ['A', ' OD1', 169.04, 120.289, 68.626], ['A', ' ND2', 169.074, 122.368, 67.837], ['A', ' H ', 166.831, 121.646, 70.471], ['A', ' HA ', 169.157, 120.149, 71.071], ['A', ' HB ', 168.698, 123.018, 70.209], ['A', ' HB ', 170.304, 122.314, 70.347], ['A', ' HD2', 168.977, 122.047, 66.894], ['A', ' HD2', 169.139, 123.348, 68.026]]
[['A', ' N ', 168.373, 122.332, 73.309], ['A', ' CA ', 168.7, 122.895, 74.598], ['A', ' C ', 168.137, 122.08, 75.743], ['A', ' O ', 168.331, 122.456, 76.901], ['A', ' CB ', 168.148, 124.317, 74.729], ['A', ' CG ', 168.981, 125.479, 74.18], ['A', ' CD1', 169.031, 125.42, 72.65], ['A', ' CD2', 168.351, 126.798, 74.673], ['A', ' H ', 167.414, 122.443, 72.976], ['A', ' HA ', 169.784, 122.923, 74.699], ['A', ' HB ', 167.195, 124.338, 74.203], ['A', ' HB ', 167.966, 124.518, 75.781], ['A', ' HG ', 170.004, 125.406, 74.553], ['A', ' HD1', 169.622, 126.256, 72.279], ['A', ' HD1', 169.491, 124.503, 72.324], ['A', ' HD1', 168.029, 125.486, 72.253], ['A', ' HD2', 168.936, 127.641, 74.307], ['A', ' HD2', 167.339, 126.886, 74.311], ['A', ' HD2', 168.345, 126.812, 75.762]]
[['A', ' N ', 167.408, 120.998, 75.466], ['A', ' CA ', 166.802, 120.279, 76.573], ['A', ' C ', 167.795, 119.628, 77.496], ['A', ' O ', 167.559, 119.555, 78.694], ['A', ' CB ', 165.792, 119.262, 76.084], ['A', ' CG ', 164.485, 119.865, 75.599], ['A', ' SD ', 163.602, 120.79, 76.881], ['A', ' CE ', 163.181, 119.551, 78.072], ['A', ' H ', 167.29, 120.665, 74.503], ['A', ' HA ', 166.256, 121.007, 77.165], ['A', ' HB ', 166.221, 118.73, 75.233], ['A', ' HB ', 165.598, 118.523, 76.856], ['A', ' HG ', 164.714, 120.571, 74.804], ['A', ' HG ', 163.825, 119.096, 75.202], ['A', ' HE ', 162.623, 119.997, 78.886], ['A', ' HE ', 162.577, 118.785, 77.598], ['A', ' HE ', 164.082, 119.107, 78.469]]
[['A', ' N ', 168.927, 119.145, 77.0], ['A', ' CA ', 169.843, 118.526, 77.946], ['A', ' C ', 170.324, 119.566, 78.939], ['A', ' O ', 170.435, 119.291, 80.133], ['A', ' CB ', 171.025, 117.912, 77.236], ['A', ' H ', 169.132, 119.192, 76.011], ['A', ' HA ', 169.304, 117.752, 78.493], ['A', ' HB ', 171.687, 117.452, 77.971], ['A', ' HB ', 170.678, 117.155, 76.534], ['A', ' HB ', 171.568, 118.69, 76.697]]
[['A', ' N ', 170.555, 120.782, 78.453], ['A', ' CA ', 171.043, 121.836, 79.31], ['A', ' C ', 169.945, 122.362, 80.201], ['A', ' O ', 170.197, 122.71, 81.357], ['A', ' CB ', 171.583, 122.983, 78.473], ['A', ' CG ', 172.87, 122.658, 77.738], ['A', ' OD1', 173.557, 121.731, 78.094], ['A', ' OD2', 173.157, 123.36, 76.807], ['A', ' H ', 170.452, 120.946, 77.46], ['A', ' HA ', 171.842, 121.438, 79.933], ['A', ' HB ', 170.827, 123.272, 77.735], ['A', ' HB ', 171.757, 123.847, 79.114]]
[['A', ' N ', 168.725, 122.46, 79.673], ['A', ' CA ', 167.629, 122.964, 80.47], ['A', ' C ', 167.338, 122.01, 81.603], ['A', ' O ', 167.1, 122.443, 82.733], ['A', ' CB ', 166.393, 123.158, 79.619], ['A', ' H ', 168.57, 122.21, 78.696], ['A', ' HA ', 167.926, 123.922, 80.893], ['A', ' HB ', 165.581, 123.552, 80.23], ['A', ' HB ', 166.625, 123.857, 78.82], ['A', ' HB ', 166.096, 122.202, 79.195]]
[['A', ' N ', 167.424, 120.709, 81.323], ['A', ' CA ', 167.175, 119.72, 82.339], ['A', ' C ', 168.284, 119.746, 83.346], ['A', ' O ', 168.032, 119.711, 84.55], ['A', ' CB ', 167.042, 118.31, 81.789], ['A', ' CG1', 165.787, 118.218, 80.935], ['A', ' CG2', 166.969, 117.351, 82.976], ['A', ' CD1', 165.704, 116.957, 80.102], ['A', ' H ', 167.617, 120.4, 80.365], ['A', ' HA ', 166.239, 119.959, 82.824], ['A', ' HB ', 167.898, 118.068, 81.149], ['A', ' HG1', 164.924, 118.274, 81.572], ['A', ' HG1', 165.761, 119.07, 80.266], ['A', ' HG2', 166.854, 116.348, 82.631], ['A', ' HG2', 167.868, 117.394, 83.586], ['A', ' HG2', 166.119, 117.631, 83.587], ['A', ' HD1', 164.788, 116.977, 79.514], ['A', ' HD1', 166.564, 116.915, 79.427], ['A', ' HD1', 165.696, 116.076, 80.73]]
[['A', ' N ', 169.523, 119.794, 82.883], ['A', ' CA ', 170.603, 119.793, 83.824], ['A', ' C ', 170.565, 121.055, 84.667], ['A', ' O ', 170.909, 121.009, 85.851], ['A', ' CB ', 171.913, 119.668, 83.095], ['A', ' CG ', 172.112, 118.304, 82.533], ['A', ' OD1', 171.509, 117.326, 82.978], ['A', ' ND2', 172.956, 118.206, 81.547], ['A', ' H ', 169.725, 119.781, 81.878], ['A', ' HA ', 170.484, 118.942, 84.493], ['A', ' HB ', 171.939, 120.393, 82.279], ['A', ' HB ', 172.734, 119.9, 83.77], ['A', ' HD2', 173.127, 117.318, 81.125], ['A', ' HD2', 173.417, 119.019, 81.197]]
[['A', ' N ', 170.106, 122.171, 84.092], ['A', ' CA ', 170.034, 123.405, 84.844], ['A', ' C ', 168.997, 123.305, 85.938], ['A', ' O ', 169.302, 123.664, 87.074], ['A', ' CB ', 169.695, 124.562, 83.932], ['A', ' OG ', 170.728, 124.8, 83.015], ['A', ' H ', 169.878, 122.178, 83.098], ['A', ' HA ', 171.005, 123.588, 85.302], ['A', ' HB ', 168.773, 124.348, 83.398], ['A', ' HB ', 169.525, 125.454, 84.534], ['A', ' HG ', 170.675, 124.069, 82.364]]
[['A', ' N ', 167.814, 122.736, 85.647], ['A', ' CA ', 166.809, 122.624, 86.7], ['A', ' C ', 167.243, 121.628, 87.749], ['A', ' O ', 166.867, 121.766, 88.908], ['A', ' CB ', 165.388, 122.283, 86.195], ['A', ' CG1', 164.87, 123.399, 85.348], ['A', ' CG2', 165.389, 121.027, 85.41], ['A', ' H ', 167.617, 122.463, 84.677], ['A', ' HA ', 166.716, 123.594, 87.17], ['A', ' HB ', 164.732, 122.179, 87.04], ['A', ' HG1', 163.861, 123.171, 85.009], ['A', ' HG1', 164.854, 124.311, 85.942], ['A', ' HG1', 165.517, 123.535, 84.483], ['A', ' HG2', 164.393, 120.815, 85.059], ['A', ' HG2', 166.025, 121.18, 84.586], ['A', ' HG2', 165.743, 120.186, 85.989]]
[['A', ' N ', 167.998, 120.6, 87.363], ['A', ' CA ', 168.486, 119.661, 88.346], ['A', ' C ', 169.497, 120.34, 89.249], ['A', ' O ', 169.394, 120.282, 90.471], ['A', ' CB ', 169.162, 118.502, 87.655], ['A', ' OG ', 168.251, 117.741, 86.928], ['A', ' H ', 168.208, 120.457, 86.368], ['A', ' HA ', 167.648, 119.309, 88.943], ['A', ' HB ', 169.915, 118.891, 86.981], ['A', ' HB ', 169.677, 117.883, 88.374], ['A', ' HG ', 168.788, 117.173, 86.355]]
[['A', ' N ', 170.4, 121.126, 88.693], ['A', ' CA ', 171.411, 121.74, 89.537], ['A', ' C ', 170.803, 122.71, 90.521], ['A', ' O ', 171.198, 122.747, 91.696], ['A', ' CB ', 172.446, 122.469, 88.683], ['A', ' CG ', 173.584, 123.15, 89.468], ['A', ' CD ', 174.454, 122.184, 90.235], ['A', ' OE1', 174.433, 121.012, 89.936], ['A', ' OE2', 175.152, 122.628, 91.117], ['A', ' H ', 170.464, 121.206, 87.673], ['A', ' HA ', 171.911, 120.95, 90.099], ['A', ' HB ', 172.89, 121.766, 87.977], ['A', ' HB ', 171.94, 123.238, 88.094], ['A', ' HG ', 174.207, 123.694, 88.761], ['A', ' HG ', 173.159, 123.879, 90.159]]
[['A', ' N ', 169.789, 123.451, 90.083], ['A', ' CA ', 169.241, 124.463, 90.957], ['A', ' C ', 168.09, 123.943, 91.777], ['A', ' O ', 167.374, 124.725, 92.393], ['A', ' CB ', 168.784, 125.716, 90.182], ['A', ' CG1', 167.612, 125.399, 89.296], ['A', ' CG2', 169.975, 126.248, 89.311], ['A', ' CD1', 166.969, 126.572, 88.663], ['A', ' H ', 169.481, 123.368, 89.107], ['A', ' HA ', 170.018, 124.746, 91.652], ['A', ' HB ', 168.47, 126.46, 90.894], ['A', ' HG1', 167.93, 124.757, 88.55], ['A', ' HG1', 166.843, 124.894, 89.877], ['A', ' HG2', 169.703, 127.145, 88.774], ['A', ' HG2', 170.817, 126.475, 89.929], ['A', ' HG2', 170.271, 125.485, 88.595], ['A', ' HD1', 166.135, 126.222, 88.055], ['A', ' HD1', 166.615, 127.232, 89.439], ['A', ' HD1', 167.661, 127.099, 88.033]]
[['A', ' N ', 167.882, 122.636, 91.746], ['A', ' CA ', 166.885, 122.005, 92.568], ['A', ' C ', 167.636, 121.175, 93.59], ['A', ' O ', 167.228, 121.107, 94.742], ['A', ' CB ', 165.934, 121.187, 91.731], ['A', ' CG ', 164.783, 120.574, 92.477], ['A', ' CD ', 163.786, 119.944, 91.583], ['A', ' NE ', 164.304, 118.763, 90.88], ['A', ' CZ ', 164.644, 118.707, 89.572], ['A', ' NH1', 164.558, 119.759, 88.804], ['A', ' NH2', 165.074, 117.581, 89.056], ['A', ' H ', 168.47, 122.044, 91.165], ['A', ' HA ', 166.316, 122.769, 93.091], ['A', ' HB ', 165.496, 121.84, 90.988], ['A', ' HB ', 166.486, 120.432, 91.2], ['A', ' HG ', 165.138, 119.843, 93.175], ['A', ' HG ', 164.292, 121.346, 93.014], ['A', ' HD ', 162.937, 119.627, 92.191], ['A', ' HD ', 163.44, 120.672, 90.863], ['A', ' HE ', 164.357, 117.891, 91.41], ['A', ' HH1', 164.253, 120.642, 89.182], ['A', ' HH1', 164.836, 119.688, 87.829], ['A', ' HH2', 165.175, 116.739, 89.639], ['A', ' HH2', 165.32, 117.546, 88.078]]
[['A', ' N ', 168.771, 120.577, 93.184], ['A', ' CA ', 169.619, 119.816, 94.09], ['A', ' C ', 170.11, 120.797, 95.142], ['A', ' O ', 169.955, 120.599, 96.352], ['A', ' CB ', 170.767, 119.19, 93.307], ['A', ' CG ', 171.711, 118.337, 94.103], ['A', ' CD ', 172.712, 117.578, 93.201], ['A', ' CE ', 173.757, 118.504, 92.556], ['A', ' NZ ', 174.834, 117.73, 91.836], ['A', ' H ', 169.037, 120.615, 92.207], ['A', ' HA ', 169.038, 119.042, 94.577], ['A', ' HB ', 170.375, 118.606, 92.494], ['A', ' HB ', 171.345, 119.996, 92.855], ['A', ' HG ', 172.271, 118.98, 94.756], ['A', ' HG ', 171.148, 117.628, 94.711], ['A', ' HD ', 173.232, 116.828, 93.798], ['A', ' HD ', 172.174, 117.065, 92.406], ['A', ' HE ', 173.271, 119.162, 91.835], ['A', ' HE ', 174.22, 119.112, 93.334], ['A', ' HZ ', 175.501, 118.369, 91.431], ['A', ' HZ ', 175.309, 117.12, 92.478], ['A', ' HZ ', 174.443, 117.145, 91.071]]
[['A', ' N ', 170.607, 121.934, 94.693], ['A', ' CA ', 170.941, 122.958, 95.642], ['A', ' C ', 169.626, 123.618, 95.924], ['A', ' O ', 168.972, 124.116, 95.024], ['A', ' CB ', 172.026, 123.867, 95.151], ['A', ' CG ', 173.315, 123.167, 95.171], ['A', ' OD1', 173.629, 122.583, 96.227], ['A', ' ND2', 174.049, 123.19, 94.094], ['A', ' H ', 170.748, 122.087, 93.69], ['A', ' HA ', 171.283, 122.506, 96.566], ['A', ' HB ', 171.803, 124.167, 94.135], ['A', ' HB ', 172.09, 124.758, 95.773], ['A', ' HD2', 174.931, 122.72, 94.065], ['A', ' HD2', 173.739, 123.691, 93.278]]
[['A', ' N ', 169.235, 123.542, 97.189], ['A', ' CA ', 167.93, 123.922, 97.747], ['A', ' C ', 167.128, 122.654, 98.067], ['A', ' O ', 166.155, 122.7, 98.831], ['A', ' CB ', 167.11, 124.809, 96.807], ['A', ' H ', 169.928, 123.155, 97.809], ['A', ' HA ', 168.107, 124.471, 98.666], ['A', ' HB ', 166.172, 125.068, 97.282], ['A', ' HB ', 167.66, 125.721, 96.578], ['A', ' HB ', 166.878, 124.283, 95.885]]
[['A', ' N ', 167.574, 121.494, 97.563], ['A', ' CA ', 167.005, 120.233, 98.018], ['A', ' C ', 167.55, 120.048, 99.38], ['A', ' O ', 166.833, 119.692, 100.306], ['A', ' CB ', 167.458, 119.019, 97.203], ['A', ' CG ', 166.808, 117.708, 97.6], ['A', ' CD ', 165.366, 117.707, 97.326], ['A', ' OE1', 165.017, 117.957, 96.172], ['A', ' NE2', 164.519, 117.414, 98.316], ['A', ' H ', 168.373, 121.467, 96.929], ['A', ' HA ', 165.919, 120.299, 98.057], ['A', ' HB ', 167.252, 119.18, 96.163], ['A', ' HB ', 168.528, 118.88, 97.31], ['A', ' HG ', 167.263, 116.9, 97.036], ['A', ' HG ', 166.951, 117.536, 98.667], ['A', ' HE2', 163.534, 117.391, 98.131], ['A', ' HE2', 164.865, 117.185, 99.27]]
[['A', ' N ', 168.828, 120.411, 99.507], ['A', ' CA ', 169.556, 120.253, 100.747], ['A', ' C ', 169.009, 121.185, 101.776], ['A', ' O ', 168.941, 120.849, 102.944], ['A', ' CB ', 171.026, 120.588, 100.571], ['A', ' CG ', 171.753, 119.658, 99.714], ['A', ' CD1', 172.121, 120.062, 98.469], ['A', ' CD2', 172.06, 118.4, 100.153], ['A', ' CE1', 172.795, 119.226, 97.645], ['A', ' CE2', 172.744, 117.545, 99.323], ['A', ' CZ ', 173.113, 117.961, 98.066], ['A', ' OH ', 173.793, 117.105, 97.226], ['A', ' H ', 169.305, 120.687, 98.645], ['A', ' HA ', 169.442, 119.23, 101.101], ['A', ' HB ', 171.127, 121.59, 100.155], ['A', ' HB ', 171.51, 120.591, 101.548], ['A', ' HD1', 171.878, 121.057, 98.131], ['A', ' HD2', 171.765, 118.077, 101.153], ['A', ' HE1', 173.083, 119.571, 96.662], ['A', ' HE2', 172.991, 116.538, 99.662], ['A', ' HH ', 173.818, 116.231, 97.616]]
[['A', ' N ', 168.572, 122.354, 101.371], ['A', ' CA ', 168.064, 123.239, 102.386], ['A', ' C ', 166.856, 122.652, 102.985], ['A', ' O ', 166.749, 122.639, 104.207], ['A', ' CB ', 167.709, 124.609, 101.849], ['A', ' CG1', 166.973, 125.437, 102.914], ['A', ' CG2', 168.925, 125.316, 101.474], ['A', ' H ', 168.629, 122.603, 100.4], ['A', ' HA ', 168.793, 123.344, 103.175], ['A', ' HB ', 167.076, 124.489, 100.997], ['A', ' HG1', 166.731, 126.417, 102.504], ['A', ' HG1', 166.04, 124.956, 103.218], ['A', ' HG1', 167.61, 125.561, 103.788], ['A', ' HG2', 168.635, 126.265, 101.102], ['A', ' HG2', 169.547, 125.448, 102.342], ['A', ' HG2', 169.471, 124.769, 100.716]]
[['A', ' N ', 165.941, 122.146, 102.174], ['A', ' CA ', 164.789, 121.622, 102.841], ['A', ' C ', 165.168, 120.347, 103.566], ['A', ' O ', 164.87, 120.188, 104.743], ['A', ' CB ', 163.635, 121.322, 101.932], ['A', ' CG1', 162.545, 120.695, 102.781], ['A', ' CG2', 163.177, 122.567, 101.286], ['A', ' H ', 166.041, 122.179, 101.151], ['A', ' HA ', 164.432, 122.365, 103.532], ['A', ' HB ', 163.938, 120.595, 101.174], ['A', ' HG1', 161.734, 120.463, 102.166], ['A', ' HG1', 162.88, 119.788, 103.267], ['A', ' HG1', 162.233, 121.404, 103.546], ['A', ' HG2', 162.33, 122.356, 100.641], ['A', ' HG2', 162.878, 123.28, 102.053], ['A', ' HG2', 163.984, 122.994, 100.693]]
[['A', ' N ', 165.899, 119.446, 102.913], ['A', ' CA ', 166.191, 118.184, 103.561], ['A', ' C ', 166.902, 118.371, 104.879], ['A', ' O ', 166.66, 117.583, 105.785], ['A', ' CB ', 167.079, 117.254, 102.706], ['A', ' CG ', 166.415, 116.589, 101.441], ['A', ' OD1', 165.23, 116.7, 101.252], ['A', ' OD2', 167.091, 115.889, 100.728], ['A', ' H ', 166.178, 119.6, 101.949], ['A', ' HA ', 165.242, 117.688, 103.762], ['A', ' HB ', 167.931, 117.838, 102.359], ['A', ' HB ', 167.477, 116.474, 103.34]]
[['A', ' N ', 167.79, 119.364, 104.988], ['A', ' CA ', 168.506, 119.644, 106.22], ['A', ' C ', 167.672, 120.377, 107.268], ['A', ' O ', 167.907, 120.191, 108.454], ['A', ' CB ', 169.733, 120.503, 105.932], ['A', ' CG ', 170.852, 119.856, 105.134], ['A', ' SD ', 171.593, 118.549, 105.952], ['A', ' CE ', 172.501, 117.732, 104.631], ['A', ' H ', 167.991, 119.943, 104.176], ['A', ' HA ', 168.814, 118.694, 106.647], ['A', ' HB ', 169.4, 121.355, 105.355], ['A', ' HB ', 170.147, 120.887, 106.868], ['A', ' HG ', 170.471, 119.486, 104.191], ['A', ' HG ', 171.618, 120.59, 104.934], ['A', ' HE ', 173.037, 116.867, 105.039], ['A', ' HE ', 171.805, 117.398, 103.862], ['A', ' HE ', 173.219, 118.428, 104.193]]
[['A', ' N ', 166.731, 121.231, 106.864], ['A', ' CA ', 165.947, 121.98, 107.848], ['A', ' C ', 164.713, 121.243, 108.311], ['A', ' O ', 164.301, 121.36, 109.456], ['A', ' CB ', 165.56, 123.375, 107.319], ['A', ' CG1', 164.523, 123.345, 106.266], ['A', ' CG2', 165.024, 124.183, 108.417], ['A', ' H ', 166.582, 121.388, 105.861], ['A', ' HA ', 166.583, 122.138, 108.719], ['A', ' HB ', 166.452, 123.816, 106.881], ['A', ' HG1', 164.346, 124.356, 105.912], ['A', ' HG1', 164.865, 122.767, 105.505], ['A', ' HG1', 163.591, 122.942, 106.629], ['A', ' HG2', 164.782, 125.172, 108.035], ['A', ' HG2', 164.129, 123.724, 108.804], ['A', ' HG2', 165.75, 124.253, 109.21]]
[['A', ' N ', 164.079, 120.551, 107.401], ['A', ' CA ', 162.852, 119.856, 107.645], ['A', ' C ', 163.028, 118.507, 107.011], ['A', ' O ', 162.704, 118.303, 105.842], ['A', ' CB ', 161.677, 120.633, 107.096], ['A', ' H ', 164.478, 120.495, 106.468], ['A', ' HA ', 162.738, 119.727, 108.711], ['A', ' HB ', 160.764, 120.108, 107.301], ['A', ' HB ', 161.64, 121.602, 107.578], ['A', ' HB ', 161.801, 120.765, 106.024]]
[['A', ' N ', 163.604, 117.619, 107.802], ['A', ' CA ', 164.126, 116.346, 107.355], ['A', ' C ', 163.303, 115.643, 106.317], ['A', ' O ', 162.151, 115.287, 106.548], ['A', ' H ', 163.781, 117.909, 108.753], ['A', ' HA ', 165.133, 116.469, 106.996], ['A', ' HA ', 164.213, 115.695, 108.223]]
[['A', ' N ', 163.975, 115.362, 105.196], ['A', ' CA ', 163.401, 114.663, 104.034], ['A', ' C ', 162.382, 115.54, 103.334], ['A', ' O ', 161.183, 115.377, 103.54], ['A', ' CB ', 162.727, 113.34, 104.431], ['A', ' CG ', 163.637, 112.444, 105.179], ['A', ' CD ', 163.194, 111.046, 105.336], ['A', ' OE1', 162.126, 110.708, 104.911], ['A', ' OE2', 163.973, 110.293, 105.886], ['A', ' H ', 164.919, 115.76, 105.163], ['A', ' HA ', 164.206, 114.454, 103.326], ['A', ' HB ', 161.823, 113.506, 105.009], ['A', ' HB ', 162.429, 112.812, 103.527], ['A', ' HG ', 164.548, 112.465, 104.688], ['A', ' HG ', 163.794, 112.858, 106.169]]
[['A', ' N ', 162.845, 116.423, 102.466], ['A', ' CA ', 162.018, 117.437, 101.861], ['A', ' C ', 160.826, 117.006, 101.027], ['A', ' O ', 159.912, 117.804, 100.848], ['A', ' H ', 163.839, 116.46, 102.241], ['A', ' HA ', 161.635, 118.047, 102.672], ['A', ' HA ', 162.661, 118.084, 101.265]]
[['A', ' N ', 160.761, 115.784, 100.514], ['A', ' CA ', 159.559, 115.499, 99.749], ['A', ' C ', 158.361, 115.484, 100.711], ['A', ' O ', 157.318, 116.01, 100.383], ['A', ' CB ', 159.63, 114.205, 98.953], ['A', ' CG1', 160.701, 114.311, 97.893], ['A', ' CG2', 158.272, 114.053, 98.219], ['A', ' CD1', 161.045, 112.998, 97.258], ['A', ' H ', 161.505, 115.114, 100.63], ['A', ' HA ', 159.4, 116.307, 99.035], ['A', ' HB ', 159.834, 113.366, 99.599], ['A', ' HG1', 160.362, 114.991, 97.11], ['A', ' HG1', 161.611, 114.722, 98.332], ['A', ' HG2', 158.235, 113.166, 97.605], ['A', ' HG2', 157.49, 114.003, 98.918], ['A', ' HG2', 158.11, 114.925, 97.58], ['A', ' HD1', 161.814, 113.153, 96.508], ['A', ' HD1', 161.41, 112.32, 98.014], ['A', ' HD1', 160.184, 112.573, 96.789]]
[['A', ' N ', 158.47, 114.845, 101.868], ['A', ' CA ', 157.372, 114.845, 102.84], ['A', ' C ', 157.987, 115.033, 104.215], ['A', ' O ', 158.146, 114.054, 104.934], ['A', ' CB ', 156.517, 113.576, 102.802], ['A', ' CG ', 155.922, 113.343, 101.486], ['A', ' ND1', 154.934, 114.135, 100.944], ['A', ' CD2', 156.139, 112.38, 100.612], ['A', ' CE1', 154.629, 113.687, 99.779], ['A', ' NE2', 155.34, 112.613, 99.549], ['A', ' H ', 159.356, 114.418, 102.11], ['A', ' HA ', 156.692, 115.667, 102.642], ['A', ' HB ', 157.131, 112.711, 103.061], ['A', ' HB ', 155.715, 113.646, 103.534], ['A', ' HD1', 154.422, 114.926, 101.323], ['A', ' HD2', 156.783, 111.536, 100.618], ['A', ' HE1', 153.869, 114.193, 99.198]]
[['A', ' N ', 158.354, 116.261, 104.6], ['A', ' CA ', 159.181, 116.567, 105.749], ['A', ' C ', 158.715, 115.957, 107.056], ['A', ' O ', 157.554, 116.073, 107.44], ['A', ' CB ', 159.041, 118.071, 105.828], ['A', ' CG ', 158.776, 118.504, 104.441], ['A', ' CD ', 157.921, 117.441, 103.849], ['A', ' HA ', 160.221, 116.289, 105.538], ['A', ' HB ', 158.268, 118.354, 106.564], ['A', ' HB ', 159.98, 118.456, 106.181], ['A', ' HG ', 158.269, 119.462, 104.48], ['A', ' HG ', 159.717, 118.653, 103.897], ['A', ' HD ', 156.861, 117.645, 104.009], ['A', ' HD ', 158.179, 117.372, 102.784]]
[['A', ' N ', 159.64, 115.37, 107.789], ['A', ' CA ', 159.321, 114.742, 109.05], ['A', ' C ', 159.367, 115.702, 110.225], ['A', ' O ', 158.741, 115.451, 111.259], ['A', ' CB ', 160.271, 113.612, 109.251], ['A', ' OG ', 161.576, 114.091, 109.383], ['A', ' H ', 160.594, 115.3, 107.43], ['A', ' HA ', 158.313, 114.334, 108.975], ['A', ' HB ', 159.979, 113.064, 110.136], ['A', ' HB ', 160.21, 112.932, 108.4], ['A', ' HG ', 162.145, 113.333, 109.214]]
[['A', ' N ', 160.092, 116.807, 110.068], ['A', ' CA ', 160.15, 117.835, 111.092], ['A', ' C ', 158.995, 118.771, 110.759], ['A', ' O ', 158.29, 118.52, 109.791], ['A', ' CB ', 161.52, 118.523, 111.17], ['A', ' CG ', 161.82, 119.189, 112.578], ['A', ' OD1', 160.863, 119.576, 113.199], ['A', ' OD2', 162.948, 119.31, 112.997], ['A', ' H ', 160.627, 116.916, 109.219], ['A', ' HA ', 159.947, 117.398, 112.061], ['A', ' HB ', 162.308, 117.813, 110.922], ['A', ' HB ', 161.536, 119.31, 110.439]]
[['A', ' N ', 158.836, 119.809, 111.561], ['A', ' CA ', 157.747, 120.779, 111.533], ['A', ' C ', 156.57, 120.071, 112.164], ['A', ' O ', 155.669, 119.61, 111.47], ['A', ' CB ', 157.35, 121.271, 110.124], ['A', ' CG1', 156.245, 122.328, 110.25], ['A', ' CG2', 158.537, 121.867, 109.422], ['A', ' H ', 159.515, 119.863, 112.302], ['A', ' HA ', 158.006, 121.643, 112.138], ['A', ' HB ', 156.943, 120.443, 109.545], ['A', ' HG1', 155.966, 122.646, 109.267], ['A', ' HG1', 155.381, 121.919, 110.735], ['A', ' HG1', 156.61, 123.178, 110.82], ['A', ' HG2', 158.242, 122.216, 108.433], ['A', ' HG2', 158.888, 122.693, 110.008], ['A', ' HG2', 159.325, 121.129, 109.316]]
[['A', ' N ', 156.572, 119.958, 113.484], ['A', ' CA ', 155.515, 119.224, 114.139], ['A', ' C ', 154.765, 119.991, 115.213], ['A', ' O ', 155.171, 119.972, 116.375], ['A', ' CB ', 156.089, 117.974, 114.783], ['A', ' CG ', 156.764, 117.013, 113.837], ['A', ' CD ', 157.083, 115.723, 114.505], ['A', ' NE ', 158.077, 115.823, 115.526], ['A', ' CZ ', 159.399, 115.759, 115.314], ['A', ' NH1', 159.888, 115.602, 114.098], ['A', ' NH2', 160.223, 115.845, 116.346], ['A', ' H ', 157.33, 120.349, 114.021], ['A', ' HA ', 154.79, 118.915, 113.383], ['A', ' HB ', 156.816, 118.254, 115.543], ['A', ' HB ', 155.284, 117.424, 115.284], ['A', ' HG ', 156.117, 116.827, 112.985], ['A', ' HG ', 157.696, 117.45, 113.483], ['A', ' HD ', 156.175, 115.338, 114.97], ['A', ' HD ', 157.429, 115.011, 113.764], ['A', ' HE ', 157.754, 115.937, 116.48], ['A', ' HH1', 159.267, 115.525, 113.268], ['A', ' HH1', 160.886, 115.544, 113.967], ['A', ' HH2', 159.853, 115.956, 117.281], ['A', ' HH2', 161.223, 115.795, 116.204]]
[['A', ' N ', 153.692, 120.683, 114.824], ['A', ' CA ', 152.75, 121.429, 115.695], ['A', ' C ', 153.29, 122.596, 116.52], ['A', ' O ', 152.646, 123.627, 116.618], ['A', ' CB ', 151.992, 120.478, 116.631], ['A', ' CG1', 151.242, 119.38, 115.807], ['A', ' CG2', 150.96, 121.289, 117.461], ['A', ' CD1', 150.164, 119.862, 114.817], ['A', ' H ', 153.489, 120.649, 113.832], ['A', ' HA ', 152.004, 121.869, 115.044], ['A', ' HB ', 152.686, 119.972, 117.304], ['A', ' HG1', 151.99, 118.816, 115.252], ['A', ' HG1', 150.77, 118.694, 116.517], ['A', ' HG2', 150.413, 120.614, 118.113], ['A', ' HG2', 151.452, 122.032, 118.067], ['A', ' HG2', 150.263, 121.8, 116.81], ['A', ' HD1', 149.73, 119.015, 114.321], ['A', ' HD1', 149.392, 120.381, 115.339], ['A', ' HD1', 150.58, 120.511, 114.076]]
[['A', ' N ', 154.414, 122.402, 117.179], ['A', ' CA ', 155.024, 123.4, 118.038], ['A', ' C ', 155.95, 124.319, 117.269], ['A', ' O ', 156.65, 125.133, 117.86], ['A', ' H ', 154.857, 121.507, 117.054], ['A', ' HA ', 154.24, 123.983, 118.508], ['A', ' HA ', 155.565, 122.909, 118.84]]
[['A', ' N ', 155.996, 124.16, 115.957], ['A', ' CA ', 156.846, 125.007, 115.142], ['A', ' C ', 158.281, 124.563, 114.933], ['A', ' O ', 159.186, 125.356, 115.139], ['A', ' H ', 155.399, 123.463, 115.542], ['A', ' HA ', 156.373, 125.1, 114.167], ['A', ' HA ', 156.849, 126.001, 115.568]]
[['A', ' N ', 158.472, 123.323, 114.483], ['A', ' CA ', 159.793, 122.737, 114.194], ['A', ' C ', 160.43, 122.229, 115.468], ['A', ' O ', 160.363, 122.875, 116.5], ['A', ' CB ', 160.714, 123.783, 113.537], ['A', ' CG ', 161.987, 123.266, 112.937], ['A', ' SD ', 161.709, 122.305, 111.484], ['A', ' CE ', 161.488, 123.544, 110.271], ['A', ' H ', 157.648, 122.764, 114.363], ['A', ' HA ', 159.686, 121.884, 113.534], ['A', ' HB ', 160.165, 124.355, 112.798], ['A', ' HB ', 161.07, 124.465, 114.261], ['A', ' HG ', 162.629, 124.104, 112.675], ['A', ' HG ', 162.529, 122.65, 113.657], ['A', ' HE ', 161.319, 123.089, 109.305], ['A', ' HE ', 160.647, 124.182, 110.524], ['A', ' HE ', 162.371, 124.129, 110.224]]
[['A', ' N ', 161.004, 121.033, 115.428], ['A', ' CA ', 161.648, 120.471, 116.59], ['A', ' C ', 163.114, 120.858, 116.705], ['A', ' O ', 163.566, 121.32, 117.756], ['A', ' CB ', 161.519, 118.964, 116.553], ['A', ' H ', 161.026, 120.497, 114.566], ['A', ' HA ', 161.143, 120.832, 117.463], ['A', ' HB ', 161.97, 118.537, 117.445], ['A', ' HB ', 160.468, 118.698, 116.506], ['A', ' HB ', 162.035, 118.582, 115.666]]
[['A', ' N ', 163.862, 120.697, 115.624], ['A', ' CA ', 165.297, 120.931, 115.685], ['A', ' C ', 165.837, 122.195, 115.031], ['A', ' O ', 165.227, 122.765, 114.132], ['A', ' CB ', 165.974, 119.728, 115.091], ['A', ' CG ', 165.904, 118.517, 115.974], ['A', ' OD1', 166.522, 118.536, 117.028], ['A', ' OD2', 165.26, 117.554, 115.617], ['A', ' H ', 163.454, 120.32, 114.749], ['A', ' HA ', 165.572, 120.977, 116.737], ['A', ' HB ', 165.48, 119.487, 114.142], ['A', ' HB ', 167.015, 119.969, 114.888]]
[['A', ' N ', 167.027, 122.611, 115.475], ['A', ' CA ', 167.754, 123.714, 114.846], ['A', ' C ', 168.652, 123.2, 113.763], ['A', ' O ', 169.115, 122.062, 113.811], ['A', ' CB ', 168.669, 124.466, 115.805], ['A', ' CG ', 168.02, 125.368, 116.738], ['A', ' OD1', 167.404, 126.342, 116.292], ['A', ' ND2', 168.132, 125.08, 118.012], ['A', ' H ', 167.446, 122.114, 116.251], ['A', ' HA ', 167.039, 124.403, 114.395], ['A', ' HB ', 169.247, 123.743, 116.379], ['A', ' HB ', 169.392, 125.05, 115.226], ['A', ' HD2', 167.69, 125.656, 118.729], ['A', ' HD2', 168.653, 124.276, 118.294]]
[['A', ' N ', 168.959, 124.047, 112.815], ['A', ' CA ', 169.995, 123.697, 111.871], ['A', ' C ', 171.248, 123.936, 112.677], ['A', ' O ', 171.369, 125.016, 113.246], ['A', ' CB ', 169.972, 124.616, 110.628], ['A', ' CG1', 168.672, 124.442, 109.846], ['A', ' CG2', 171.121, 124.359, 109.778], ['A', ' CD1', 168.488, 125.451, 108.708], ['A', ' H ', 168.513, 124.956, 112.806], ['A', ' HA ', 169.934, 122.646, 111.586], ['A', ' HB ', 170.021, 125.648, 110.963], ['A', ' HG1', 168.64, 123.433, 109.431], ['A', ' HG1', 167.836, 124.556, 110.535], ['A', ' HG2', 171.146, 125.014, 108.932], ['A', ' HG2', 172.022, 124.507, 110.353], ['A', ' HG2', 171.048, 123.339, 109.44], ['A', ' HD1', 167.564, 125.283, 108.217], ['A', ' HD1', 168.491, 126.445, 109.097], ['A', ' HD1', 169.267, 125.362, 107.971]]
[['A', ' N ', 172.172, 122.986, 112.752], ['A', ' CA ', 173.342, 123.268, 113.587], ['A', ' C ', 174.385, 124.11, 112.88], ['A', ' O ', 174.312, 124.361, 111.667], ['A', ' CB ', 174.028, 122.005, 114.081], ['A', ' OG1', 174.973, 122.376, 115.097], ['A', ' CG2', 174.76, 121.344, 112.934], ['A', ' H ', 172.023, 122.08, 112.286], ['A', ' HA ', 173.005, 123.82, 114.465], ['A', ' HB ', 173.286, 121.319, 114.494], ['A', ' HG1', 175.282, 121.588, 115.558], ['A', ' HG2', 175.255, 120.442, 113.278], ['A', ' HG2', 174.045, 121.096, 112.161], ['A', ' HG2', 175.498, 121.994, 112.527]]
[['A', ' N ', 175.427, 124.509, 113.605], ['A', ' CA ', 176.441, 125.363, 112.987], ['A', ' C ', 177.503, 124.544, 112.248], ['A', ' O ', 178.669, 124.465, 112.625], ['A', ' CB ', 177.09, 126.276, 114.02], ['A', ' CG ', 177.958, 127.368, 113.406], ['A', ' CD ', 178.621, 128.26, 114.413], ['A', ' OE1', 178.683, 127.901, 115.563], ['A', ' OE2', 179.034, 129.336, 114.03], ['A', ' H ', 175.483, 124.225, 114.582], ['A', ' HA ', 175.948, 126.001, 112.257], ['A', ' HB ', 176.315, 126.758, 114.618], ['A', ' HB ', 177.708, 125.685, 114.696], ['A', ' HG ', 178.731, 126.921, 112.793], ['A', ' HG ', 177.329, 127.975, 112.756]]
[['A', ' N ', 177.038, 123.964, 111.181], ['A', ' CA ', 177.723, 123.124, 110.225], ['A', ' C ', 176.806, 123.117, 109.058], ['A', ' O ', 177.151, 123.577, 107.972], ['A', ' CB ', 177.95, 121.693, 110.742], ['A', ' CG ', 178.607, 120.67, 109.754], ['A', ' CD1', 180.003, 121.123, 109.335], ['A', ' CD2', 178.655, 119.296, 110.441], ['A', ' H ', 176.045, 124.131, 111.058], ['A', ' HA ', 178.667, 123.588, 109.947], ['A', ' HB ', 178.572, 121.744, 111.635], ['A', ' HB ', 177.002, 121.262, 111.02], ['A', ' HG ', 177.993, 120.585, 108.853], ['A', ' HD1', 180.431, 120.388, 108.655], ['A', ' HD1', 179.951, 122.083, 108.827], ['A', ' HD1', 180.638, 121.212, 110.215], ['A', ' HD2', 179.086, 118.562, 109.758], ['A', ' HD2', 179.262, 119.35, 111.345], ['A', ' HD2', 177.645, 118.989, 110.706]]
[['A', ' N ', 175.601, 122.636, 109.311], ['A', ' CA ', 174.578, 122.602, 108.311], ['A', ' C ', 174.233, 124.019, 107.865], ['A', ' O ', 174.078, 124.263, 106.676], ['A', ' CB ', 173.361, 121.909, 108.877], ['A', ' H ', 175.406, 122.253, 110.228], ['A', ' HA ', 174.949, 122.052, 107.447], ['A', ' HB ', 172.569, 121.869, 108.131], ['A', ' HB ', 173.599, 120.929, 109.189], ['A', ' HB ', 173.038, 122.452, 109.74]]
[['A', ' N ', 174.192, 124.977, 108.797], ['A', ' CA ', 173.866, 126.349, 108.435], ['A', ' C ', 174.878, 126.902, 107.466], ['A', ' O ', 174.517, 127.539, 106.478], ['A', ' CB ', 173.839, 127.222, 109.676], ['A', ' CG ', 173.566, 128.719, 109.477], ['A', ' CD ', 173.604, 129.39, 110.799], ['A', ' NE ', 173.483, 130.833, 110.766], ['A', ' CZ ', 174.493, 131.69, 110.477], ['A', ' NH1', 175.694, 131.252, 110.132], ['A', ' NH2', 174.256, 132.976, 110.549], ['A', ' H ', 174.323, 124.737, 109.779], ['A', ' HA ', 172.885, 126.363, 107.963], ['A', ' HB ', 173.076, 126.845, 110.359], ['A', ' HB ', 174.794, 127.132, 110.194], ['A', ' HG ', 174.309, 129.166, 108.818], ['A', ' HG ', 172.574, 128.869, 109.059], ['A', ' HD ', 172.739, 129.028, 111.339], ['A', ' HD ', 174.508, 129.125, 111.343], ['A', ' HE ', 172.569, 131.274, 111.086], ['A', ' HH1', 175.878, 130.267, 110.078], ['A', ' HH1', 176.423, 131.916, 109.921], ['A', ' HH2', 173.309, 133.276, 110.82], ['A', ' HH2', 174.961, 133.656, 110.335]]
[['A', ' N ', 176.15, 126.669, 107.753], ['A', ' CA ', 177.216, 127.17, 106.915], ['A', ' C ', 177.267, 126.47, 105.574], ['A', ' O ', 177.476, 127.12, 104.545], ['A', ' CB ', 178.542, 127.046, 107.642], ['A', ' CG ', 178.683, 128.02, 108.796], ['A', ' CD ', 179.998, 127.842, 109.533], ['A', ' CE ', 180.149, 128.883, 110.637], ['A', ' NZ ', 181.383, 128.673, 111.448], ['A', ' H ', 176.367, 126.148, 108.59], ['A', ' HA ', 177.029, 128.227, 106.727], ['A', ' HB ', 178.644, 126.03, 108.036], ['A', ' HB ', 179.361, 127.214, 106.944], ['A', ' HG ', 178.622, 129.039, 108.412], ['A', ' HG ', 177.862, 127.868, 109.497], ['A', ' HD ', 180.03, 126.846, 109.984], ['A', ' HD ', 180.829, 127.938, 108.836], ['A', ' HE ', 180.192, 129.871, 110.186], ['A', ' HE ', 179.286, 128.837, 111.291], ['A', ' HZ ', 181.43, 129.39, 112.167], ['A', ' HZ ', 181.343, 127.763, 111.889], ['A', ' HZ ', 182.199, 128.729, 110.858]]
[['A', ' N ', 177.045, 125.159, 105.555], ['A', ' CA ', 177.081, 124.467, 104.288], ['A', ' C ', 175.945, 124.906, 103.411], ['A', ' O ', 176.138, 125.162, 102.22], ['A', ' CB ', 176.974, 122.972, 104.477], ['A', ' CG ', 178.181, 122.339, 105.035], ['A', ' CD ', 178.033, 120.874, 105.183], ['A', ' NE ', 179.219, 120.329, 105.758], ['A', ' CZ ', 180.345, 120.061, 105.07], ['A', ' NH1', 180.405, 120.266, 103.771], ['A', ' NH2', 181.399, 119.599, 105.694], ['A', ' H ', 176.901, 124.639, 106.424], ['A', ' HA ', 178.023, 124.698, 103.792], ['A', ' HB ', 176.148, 122.756, 105.157], ['A', ' HB ', 176.749, 122.495, 103.523], ['A', ' HG ', 179.015, 122.551, 104.376], ['A', ' HG ', 178.394, 122.754, 106.012], ['A', ' HD ', 177.204, 120.661, 105.866], ['A', ' HD ', 177.843, 120.39, 104.224], ['A', ' HE ', 179.213, 120.137, 106.754], ['A', ' HH1', 179.603, 120.609, 103.27], ['A', ' HH1', 181.254, 120.053, 103.268], ['A', ' HH2', 181.365, 119.418, 106.686], ['A', ' HH2', 182.249, 119.395, 105.178]]
[['A', ' N ', 174.763, 125.054, 103.991], ['A', ' CA ', 173.639, 125.447, 103.191], ['A', ' C ', 173.808, 126.846, 102.704], ['A', ' O ', 173.446, 127.147, 101.566], ['A', ' CB ', 172.356, 125.383, 103.982], ['A', ' CG ', 171.853, 124.037, 104.413], ['A', ' CD1', 170.621, 124.303, 105.28], ['A', ' CD2', 171.593, 123.151, 103.195], ['A', ' H ', 174.631, 124.84, 104.984], ['A', ' HA ', 173.588, 124.807, 102.319], ['A', ' HB ', 172.505, 125.971, 104.893], ['A', ' HB ', 171.581, 125.855, 103.399], ['A', ' HG ', 172.572, 123.535, 105.033], ['A', ' HD1', 170.222, 123.38, 105.647], ['A', ' HD1', 170.913, 124.925, 106.125], ['A', ' HD1', 169.863, 124.818, 104.704], ['A', ' HD2', 171.203, 122.21, 103.514], ['A', ' HD2', 170.9, 123.614, 102.549], ['A', ' HD2', 172.507, 122.974, 102.651]]
[['A', ' N ', 174.371, 127.701, 103.543], ['A', ' CA ', 174.567, 129.063, 103.167], ['A', ' C ', 175.434, 129.126, 101.952], ['A', ' O ', 175.105, 129.806, 100.976], ['A', ' CB ', 175.236, 129.827, 104.277], ['A', ' CG ', 175.415, 131.18, 103.912], ['A', ' CD1', 174.358, 131.976, 104.042], ['A', ' CD2', 176.604, 131.651, 103.418], ['A', ' CE1', 174.422, 133.237, 103.712], ['A', ' CE2', 176.687, 132.963, 103.067], ['A', ' CZ ', 175.584, 133.765, 103.223], ['A', ' OH ', 175.616, 135.091, 102.885], ['A', ' H ', 174.621, 127.421, 104.495], ['A', ' HA ', 173.606, 129.511, 102.925], ['A', ' HB ', 174.632, 129.783, 105.182], ['A', ' HB ', 176.205, 129.392, 104.501], ['A', ' HD1', 173.448, 131.584, 104.415], ['A', ' HD2', 177.466, 130.993, 103.307], ['A', ' HE1', 173.533, 133.849, 103.831], ['A', ' HE2', 177.614, 133.369, 102.673], ['A', ' HH ', 174.887, 135.55, 103.381]]
[['A', ' N ', 176.557, 128.414, 101.997], ['A', ' CA ', 177.462, 128.437, 100.883], ['A', ' C ', 176.8, 127.908, 99.642], ['A', ' O ', 176.973, 128.481, 98.569], ['A', ' CB ', 178.677, 127.605, 101.192], ['A', ' H ', 176.793, 127.875, 102.837], ['A', ' HA ', 177.756, 129.47, 100.705], ['A', ' HB ', 179.365, 127.639, 100.35], ['A', ' HB ', 179.164, 127.997, 102.085], ['A', ' HB ', 178.365, 126.574, 101.372]]
[['A', ' N ', 175.993, 126.859, 99.769], ['A', ' CA ', 175.363, 126.321, 98.588], ['A', ' C ', 174.41, 127.301, 97.956], ['A', ' O ', 174.409, 127.443, 96.736], ['A', ' CB ', 174.573, 125.073, 98.917], ['A', ' CG ', 175.375, 123.852, 99.221], ['A', ' CD ', 174.49, 122.718, 99.577], ['A', ' NE ', 175.238, 121.546, 99.926], ['A', ' CZ ', 175.745, 120.657, 99.052], ['A', ' NH1', 175.586, 120.793, 97.736], ['A', ' NH2', 176.414, 119.617, 99.509], ['A', ' H ', 175.891, 126.393, 100.676], ['A', ' HA ', 176.143, 126.073, 97.867], ['A', ' HB ', 173.942, 125.27, 99.781], ['A', ' HB ', 173.914, 124.834, 98.083], ['A', ' HG ', 175.945, 123.582, 98.334], ['A', ' HG ', 176.057, 124.043, 100.037], ['A', ' HD ', 173.891, 122.998, 100.442], ['A', ' HD ', 173.831, 122.483, 98.757], ['A', ' HE ', 175.393, 121.37, 100.911], ['A', ' HH1', 175.046, 121.566, 97.326], ['A', ' HH1', 175.975, 120.095, 97.12], ['A', ' HH2', 176.555, 119.472, 100.525], ['A', ' HH2', 176.783, 118.944, 98.86]]
[['A', ' N ', 173.619, 128.003, 98.761], ['A', ' CA ', 172.656, 128.908, 98.174], ['A', ' C ', 173.322, 130.15, 97.622], ['A', ' O ', 172.899, 130.698, 96.599], ['A', ' CB ', 171.623, 129.344, 99.189], ['A', ' CG ', 170.675, 128.298, 99.757], ['A', ' CD1', 169.824, 129.041, 100.76], ['A', ' CD2', 169.836, 127.594, 98.647], ['A', ' H ', 173.644, 127.833, 99.773], ['A', ' HA ', 172.162, 128.395, 97.364], ['A', ' HB ', 172.165, 129.771, 100.038], ['A', ' HB ', 171.023, 130.12, 98.747], ['A', ' HG ', 171.247, 127.541, 100.296], ['A', ' HD1', 169.137, 128.384, 101.26], ['A', ' HD1', 170.466, 129.499, 101.484], ['A', ' HD1', 169.269, 129.813, 100.244], ['A', ' HD2', 169.167, 126.88, 99.076], ['A', ' HD2', 169.261, 128.31, 98.119], ['A', ' HD2', 170.487, 127.073, 97.954]]
[['A', ' N ', 174.363, 130.623, 98.287], ['A', ' CA ', 175.039, 131.803, 97.804], ['A', ' C ', 175.696, 131.489, 96.463], ['A', ' O ', 175.681, 132.314, 95.549], ['A', ' CB ', 176.04, 132.3, 98.836], ['A', ' CG ', 176.736, 133.595, 98.468], ['A', ' CD ', 177.632, 134.068, 99.604], ['A', ' CE ', 178.38, 135.338, 99.24], ['A', ' NZ ', 179.305, 135.781, 100.331], ['A', ' H ', 174.674, 130.18, 99.159], ['A', ' HA ', 174.3, 132.585, 97.64], ['A', ' HB ', 175.526, 132.448, 99.79], ['A', ' HB ', 176.8, 131.531, 98.997], ['A', ' HG ', 177.341, 133.442, 97.571], ['A', ' HG ', 175.988, 134.358, 98.255], ['A', ' HD ', 177.01, 134.278, 100.472], ['A', ' HD ', 178.342, 133.285, 99.866], ['A', ' HE ', 178.96, 135.161, 98.336], ['A', ' HE ', 177.659, 136.132, 99.046], ['A', ' HZ ', 179.781, 136.624, 100.041], ['A', ' HZ ', 178.793, 135.967, 101.184], ['A', ' HZ ', 179.986, 135.056, 100.506]]
[['A', ' N ', 176.279, 130.291, 96.352], ['A', ' CA ', 176.918, 129.821, 95.133], ['A', ' C ', 175.885, 129.535, 94.048], ['A', ' O ', 176.176, 129.688, 92.864], ['A', ' CB ', 177.727, 128.577, 95.435], ['A', ' CG ', 178.949, 128.829, 96.291], ['A', ' CD ', 179.546, 127.539, 96.769], ['A', ' OE1', 178.929, 126.482, 96.599], ['A', ' NE2', 180.731, 127.601, 97.365], ['A', ' H ', 176.304, 129.669, 97.166], ['A', ' HA ', 177.585, 130.6, 94.77], ['A', ' HB ', 177.089, 127.862, 95.956], ['A', ' HB ', 178.048, 128.114, 94.504], ['A', ' HG ', 179.692, 129.341, 95.683], ['A', ' HG ', 178.688, 129.445, 97.145], ['A', ' HE2', 181.167, 126.764, 97.699], ['A', ' HE2', 181.193, 128.481, 97.479]]
[['A', ' N ', 174.696, 129.091, 94.462], ['A', ' CA ', 173.569, 128.798, 93.592], ['A', ' C ', 172.984, 130.015, 92.922], ['A', ' O ', 172.678, 129.978, 91.731], ['A', ' CB ', 172.445, 128.149, 94.404], ['A', ' CG ', 171.162, 127.862, 93.696], ['A', ' CD1', 171.39, 126.978, 92.583], ['A', ' CD2', 170.155, 127.246, 94.669], ['A', ' H ', 174.585, 128.884, 95.454], ['A', ' HA ', 173.927, 128.114, 92.827], ['A', ' HB ', 172.812, 127.223, 94.837], ['A', ' HB ', 172.195, 128.817, 95.191], ['A', ' HG ', 170.753, 128.783, 93.32], ['A', ' HD1', 170.444, 126.838, 92.138], ['A', ' HD1', 172.061, 127.407, 91.866], ['A', ' HD1', 171.79, 126.036, 92.92], ['A', ' HD2', 169.208, 127.047, 94.154], ['A', ' HD2', 170.537, 126.324, 95.062], ['A', ' HD2', 169.981, 127.936, 95.487]]
[['A', ' N ', 172.823, 131.094, 93.669], ['A', ' CA ', 172.219, 132.308, 93.15], ['A', ' C ', 172.514, 132.614, 91.674], ['A', ' O ', 171.547, 132.794, 90.932], ['A', ' CB ', 172.52, 133.468, 94.086], ['A', ' CG ', 171.896, 134.768, 93.682], ['A', ' CD ', 172.16, 135.824, 94.735], ['A', ' CE ', 171.566, 137.157, 94.339], ['A', ' NZ ', 171.798, 138.19, 95.378], ['A', ' H ', 173.055, 131.035, 94.668], ['A', ' HA ', 171.155, 132.179, 93.185], ['A', ' HB ', 172.118, 133.216, 95.07], ['A', ' HB ', 173.582, 133.601, 94.224], ['A', ' HG ', 172.314, 135.099, 92.729], ['A', ' HG ', 170.819, 134.634, 93.562], ['A', ' HD ', 171.723, 135.506, 95.685], ['A', ' HD ', 173.236, 135.939, 94.87], ['A', ' HE ', 172.019, 137.486, 93.405], ['A', ' HE ', 170.491, 137.042, 94.19], ['A', ' HZ ', 171.389, 139.066, 95.085], ['A', ' HZ ', 171.366, 137.891, 96.239], ['A', ' HZ ', 172.79, 138.314, 95.521]]
[['A', ' N ', 173.765, 132.732, 91.188], ['A', ' CA ', 174.057, 133.009, 89.798], ['A', ' C ', 173.577, 131.941, 88.815], ['A', ' O ', 173.381, 132.258, 87.647], ['A', ' CB ', 175.58, 133.136, 89.79], ['A', ' CG ', 176.034, 132.431, 91.026], ['A', ' CD ', 174.963, 132.704, 92.037], ['A', ' HA ', 173.61, 133.979, 89.544], ['A', ' HB ', 175.986, 132.674, 88.875], ['A', ' HB ', 175.868, 134.196, 89.769], ['A', ' HG ', 176.157, 131.352, 90.834], ['A', ' HG ', 177.017, 132.805, 91.347], ['A', ' HD ', 174.985, 131.925, 92.766], ['A', ' HD ', 175.13, 133.684, 92.495]]
[['A', ' N ', 173.373, 130.695, 89.253], ['A', ' CA ', 172.92, 129.663, 88.336], ['A', ' C ', 171.437, 129.8, 88.185], ['A', ' O ', 170.884, 129.552, 87.11], ['A', ' CB ', 173.263, 128.265, 88.844], ['A', ' CG ', 174.762, 127.941, 88.953], ['A', ' CD ', 175.492, 128.016, 87.592], ['A', ' CE ', 175.089, 126.884, 86.635], ['A', ' NZ ', 175.761, 127.03, 85.312], ['A', ' H ', 173.512, 130.432, 90.223], ['A', ' HA ', 173.359, 129.831, 87.355], ['A', ' HB ', 172.859, 128.162, 89.843], ['A', ' HB ', 172.769, 127.519, 88.232], ['A', ' HG ', 175.224, 128.654, 89.644], ['A', ' HG ', 174.881, 126.938, 89.366], ['A', ' HD ', 175.338, 128.974, 87.102], ['A', ' HD ', 176.56, 127.921, 87.779], ['A', ' HE ', 175.371, 125.928, 87.075], ['A', ' HE ', 174.017, 126.897, 86.469], ['A', ' HZ ', 175.481, 126.282, 84.699], ['A', ' HZ ', 175.46, 127.941, 84.9], ['A', ' HZ ', 176.76, 127.02, 85.42]]
[['A', ' N ', 170.79, 130.227, 89.26], ['A', ' CA ', 169.368, 130.453, 89.191], ['A', ' C ', 169.168, 131.613, 88.275], ['A', ' O ', 168.25, 131.584, 87.464], ['A', ' CB ', 168.714, 130.686, 90.55], ['A', ' CG1', 167.238, 131.133, 90.393], ['A', ' CG2', 168.75, 129.395, 91.258], ['A', ' H ', 171.33, 130.381, 90.119], ['A', ' HA ', 168.896, 129.578, 88.748], ['A', ' HB ', 169.261, 131.452, 91.105], ['A', ' HG1', 166.791, 131.26, 91.38], ['A', ' HG1', 167.18, 132.083, 89.855], ['A', ' HG1', 166.684, 130.375, 89.839], ['A', ' HG2', 168.301, 129.473, 92.225], ['A', ' HG2', 168.204, 128.676, 90.674], ['A', ' HG2', 169.773, 129.085, 91.348]]
[['A', ' N ', 170.013, 132.635, 88.396], ['A', ' CA ', 169.873, 133.773, 87.527], ['A', ' C ', 170.073, 133.36, 86.065], ['A', ' O ', 169.302, 133.78, 85.209], ['A', ' CB ', 170.868, 134.839, 87.886], ['A', ' CG ', 170.565, 135.517, 89.167], ['A', ' OD1', 169.459, 135.459, 89.702], ['A', ' ND2', 171.547, 136.193, 89.685], ['A', ' H ', 170.728, 132.615, 89.129], ['A', ' HA ', 168.876, 134.181, 87.642], ['A', ' HB ', 171.858, 134.401, 87.944], ['A', ' HB ', 170.892, 135.587, 87.095], ['A', ' HD2', 171.411, 136.693, 90.538], ['A', ' HD2', 172.432, 136.227, 89.223]]
[['A', ' N ', 171.034, 132.475, 85.76], ['A', ' CA ', 171.193, 132.067, 84.364], ['A', ' C ', 169.958, 131.341, 83.866], ['A', ' O ', 169.496, 131.57, 82.741], ['A', ' CB ', 172.38, 131.114, 84.197], ['A', ' CG ', 173.762, 131.716, 84.351], ['A', ' CD ', 174.861, 130.644, 84.372], ['A', ' OE1', 174.53, 129.47, 84.35], ['A', ' OE2', 176.012, 130.992, 84.427], ['A', ' H ', 171.703, 132.161, 86.47], ['A', ' HA ', 171.347, 132.957, 83.755], ['A', ' HB ', 172.294, 130.317, 84.937], ['A', ' HB ', 172.33, 130.646, 83.215], ['A', ' HG ', 173.943, 132.387, 83.514], ['A', ' HG ', 173.804, 132.303, 85.254]]
[['A', ' N ', 169.408, 130.484, 84.717], ['A', ' CA ', 168.235, 129.71, 84.389], ['A', ' C ', 167.032, 130.56, 84.118], ['A', ' O ', 166.35, 130.38, 83.104], ['A', ' CB ', 167.903, 128.75, 85.513], ['A', ' CG ', 166.642, 128.06, 85.308], ['A', ' ND1', 166.456, 127.116, 84.34], ['A', ' CD2', 165.472, 128.182, 85.95], ['A', ' CE1', 165.221, 126.681, 84.398], ['A', ' NE2', 164.609, 127.308, 85.379], ['A', ' H ', 169.87, 130.322, 85.618], ['A', ' HA ', 168.435, 129.126, 83.493], ['A', ' HB ', 168.699, 128.01, 85.615], ['A', ' HB ', 167.844, 129.292, 86.451], ['A', ' HD1', 167.131, 126.803, 83.675], ['A', ' HD2', 165.152, 128.809, 86.779], ['A', ' HE1', 164.865, 125.919, 83.701]]
[['A', ' N ', 166.756, 131.501, 85.0], ['A', ' CA ', 165.577, 132.287, 84.784], ['A', ' C ', 165.77, 133.208, 83.613], ['A', ' O ', 164.859, 133.36, 82.817], ['A', ' CB ', 165.172, 133.063, 86.043], ['A', ' CG1', 164.898, 132.058, 87.164], ['A', ' CG2', 166.19, 134.015, 86.43], ['A', ' H ', 167.354, 131.619, 85.822], ['A', ' HA ', 164.757, 131.607, 84.553], ['A', ' HB ', 164.296, 133.62, 85.858], ['A', ' HG1', 164.596, 132.584, 88.06], ['A', ' HG1', 164.103, 131.382, 86.856], ['A', ' HG1', 165.788, 131.483, 87.377], ['A', ' HG2', 165.856, 134.504, 87.303], ['A', ' HG2', 167.079, 133.498, 86.628], ['A', ' HG2', 166.366, 134.757, 85.668]]
[['A', ' N ', 166.96, 133.75, 83.393], ['A', ' CA ', 167.059, 134.645, 82.265], ['A', ' C ', 166.868, 133.857, 80.972], ['A', ' O ', 166.268, 134.369, 80.017], ['A', ' CB ', 168.366, 135.416, 82.306], ['A', ' CG ', 168.457, 136.409, 83.507], ['A', ' CD ', 167.35, 137.428, 83.561], ['A', ' OE1', 166.976, 137.91, 82.524], ['A', ' OE2', 166.884, 137.75, 84.659], ['A', ' H ', 167.755, 133.618, 84.026], ['A', ' HA ', 166.251, 135.371, 82.332], ['A', ' HB ', 169.197, 134.711, 82.393], ['A', ' HB ', 168.496, 135.975, 81.381], ['A', ' HG ', 168.423, 135.855, 84.429], ['A', ' HG ', 169.414, 136.922, 83.465]]
[['A', ' N ', 167.33, 132.603, 80.924], ['A', ' CA ', 167.08, 131.802, 79.742], ['A', ' C ', 165.604, 131.547, 79.557], ['A', ' O ', 165.071, 131.756, 78.466], ['A', ' CB ', 167.756, 130.43, 79.833], ['A', ' CG ', 167.43, 129.421, 78.659], ['A', ' CD1', 167.894, 129.984, 77.315], ['A', ' CD2', 168.077, 128.065, 78.96], ['A', ' H ', 167.9, 132.226, 81.691], ['A', ' HA ', 167.458, 132.349, 78.883], ['A', ' HB ', 168.834, 130.58, 79.868], ['A', ' HB ', 167.453, 129.961, 80.771], ['A', ' HG ', 166.352, 129.276, 78.599], ['A', ' HD1', 167.646, 129.277, 76.525], ['A', ' HD1', 167.396, 130.927, 77.105], ['A', ' HD1', 168.971, 130.138, 77.336], ['A', ' HD2', 167.831, 127.356, 78.167], ['A', ' HD2', 169.161, 128.181, 79.021], ['A', ' HD2', 167.699, 127.689, 79.912]]
[['A', ' N ', 164.922, 131.119, 80.621], ['A', ' CA ', 163.514, 130.806, 80.475], ['A', ' C ', 162.679, 132.031, 80.204], ['A', ' O ', 161.658, 131.924, 79.558], ['A', ' CB ', 162.972, 130.075, 81.701], ['A', ' CG ', 163.47, 128.641, 81.873], ['A', ' SD ', 163.147, 127.567, 80.427], ['A', ' CE ', 161.34, 127.416, 80.344], ['A', ' H ', 165.4, 130.975, 81.516], ['A', ' HA ', 163.406, 130.153, 79.615], ['A', ' HB ', 163.28, 130.624, 82.596], ['A', ' HB ', 161.882, 130.079, 81.684], ['A', ' HG ', 164.546, 128.669, 82.049], ['A', ' HG ', 162.999, 128.197, 82.75], ['A', ' HE ', 161.067, 126.791, 79.496], ['A', ' HE ', 160.969, 126.957, 81.257], ['A', ' HE ', 160.888, 128.405, 80.218]]
[['A', ' N ', 163.092, 133.185, 80.705], ['A', ' CA ', 162.377, 134.427, 80.491], ['A', ' C ', 162.56, 134.9, 79.055], ['A', ' O ', 161.62, 135.428, 78.472], ['A', ' CB ', 162.781, 135.507, 81.506], ['A', ' CG1', 162.32, 135.052, 82.923], ['A', ' CG2', 162.128, 136.854, 81.119], ['A', ' CD1', 162.903, 135.869, 84.08], ['A', ' H ', 163.919, 133.192, 81.296], ['A', ' HA ', 161.316, 134.233, 80.638], ['A', ' HB ', 163.87, 135.608, 81.523], ['A', ' HG1', 161.253, 135.092, 82.967], ['A', ' HG1', 162.604, 134.02, 83.062], ['A', ' HG2', 162.402, 137.62, 81.833], ['A', ' HG2', 162.465, 137.169, 80.134], ['A', ' HG2', 161.044, 136.743, 81.102], ['A', ' HD1', 162.541, 135.483, 85.028], ['A', ' HD1', 163.996, 135.799, 84.056], ['A', ' HD1', 162.608, 136.906, 83.993]]
[['A', ' N ', 163.786, 134.813, 78.502], ['A', ' CA ', 163.996, 135.187, 77.1], ['A', ' C ', 163.144, 134.275, 76.202], ['A', ' O ', 162.48, 134.74, 75.26], ['A', ' H ', 164.581, 134.481, 79.055], ['A', ' HA ', 163.721, 136.23, 76.952], ['A', ' HA ', 165.051, 135.079, 76.852]]
[['A', ' N ', 163.122, 132.986, 76.545], ['A', ' CA ', 162.287, 132.009, 75.876], ['A', ' C ', 160.912, 132.37, 76.356], ['A', ' O ', 160.776, 133.311, 77.116], ['A', ' CB ', 162.628, 130.573, 76.273], ['A', ' CG ', 164.023, 130.045, 75.933], ['A', ' CD1', 164.172, 128.707, 76.57], ['A', ' CD2', 164.188, 129.913, 74.438], ['A', ' H ', 163.727, 132.664, 77.31], ['A', ' HA ', 162.334, 132.133, 74.8], ['A', ' HB ', 162.505, 130.493, 77.353], ['A', ' HB ', 161.912, 129.902, 75.805], ['A', ' HG ', 164.783, 130.709, 76.324], ['A', ' HD1', 165.156, 128.296, 76.348], ['A', ' HD1', 164.057, 128.798, 77.648], ['A', ' HD1', 163.403, 128.054, 76.175], ['A', ' HD2', 165.178, 129.515, 74.22], ['A', ' HD2', 163.427, 129.232, 74.044], ['A', ' HD2', 164.083, 130.885, 73.965]]
[['A', ' N ', 159.877, 131.755, 75.831], ['A', ' CA ', 158.486, 132.024, 76.229], ['A', ' C ', 158.007, 133.245, 75.496], ['A', ' O ', 156.985, 133.186, 74.833], ['A', ' CB ', 158.276, 132.324, 77.731], ['A', ' CG1', 158.739, 131.173, 78.546], ['A', ' CG2', 156.738, 132.547, 77.968], ['A', ' CD1', 158.795, 131.505, 80.019], ['A', ' H ', 160.052, 131.042, 75.133], ['A', ' HA ', 157.862, 131.189, 75.944], ['A', ' HB ', 158.762, 133.229, 78.063], ['A', ' HG1', 158.128, 130.333, 78.341], ['A', ' HG1', 159.742, 130.912, 78.259], ['A', ' HG2', 156.527, 132.756, 79.007], ['A', ' HG2', 156.388, 133.39, 77.385], ['A', ' HG2', 156.191, 131.651, 77.667], ['A', ' HD1', 159.182, 130.653, 80.572], ['A', ' HD1', 159.445, 132.353, 80.178], ['A', ' HD1', 157.83, 131.757, 80.403]]
[['A', ' N ', 158.679, 134.376, 75.666], ['A', ' CA ', 158.315, 135.517, 74.849], ['A', ' C ', 158.825, 135.246, 73.428], ['A', ' O ', 158.116, 135.453, 72.437], ['A', ' CB ', 158.874, 136.815, 75.419], ['A', ' CG ', 158.21, 137.248, 76.733], ['A', ' CD ', 158.729, 138.564, 77.262], ['A', ' OE1', 159.688, 139.062, 76.724], ['A', ' OE2', 158.15, 139.078, 78.193], ['A', ' H ', 159.467, 134.382, 76.326], ['A', ' HA ', 157.23, 135.598, 74.816], ['A', ' HB ', 159.945, 136.688, 75.614], ['A', ' HB ', 158.762, 137.617, 74.691], ['A', ' HG ', 157.133, 137.324, 76.579], ['A', ' HG ', 158.384, 136.469, 77.481]]
[['A', ' N ', 160.038, 134.69, 73.335], ['A', ' CA ', 160.637, 134.305, 72.069], ['A', ' C ', 159.969, 133.009, 71.65], ['A', ' O ', 159.959, 132.048, 72.419], ['A', ' CB ', 162.151, 134.107, 72.163], ['A', ' CG ', 162.807, 133.875, 70.78], ['A', ' OD1', 162.079, 133.82, 69.797], ['A', ' OD2', 164.006, 133.75, 70.703], ['A', ' H ', 160.613, 134.574, 74.175], ['A', ' HA ', 160.427, 135.07, 71.321], ['A', ' HB ', 162.605, 134.981, 72.635], ['A', ' HB ', 162.363, 133.256, 72.792]]
[['A', ' N ', 159.34, 133.001, 70.479], ['A', ' CA ', 158.557, 131.853, 70.012], ['A', ' C ', 157.432, 131.626, 70.993], ['A', ' O ', 157.121, 130.498, 71.384], ['A', ' CB ', 159.416, 130.584, 69.909], ['A', ' CG ', 160.719, 130.761, 69.138], ['A', ' CD ', 160.527, 130.996, 67.646], ['A', ' CE ', 161.884, 131.255, 66.975], ['A', ' NZ ', 162.353, 132.695, 67.167], ['A', ' H ', 159.427, 133.825, 69.9], ['A', ' HA ', 158.116, 132.085, 69.044], ['A', ' HB ', 159.648, 130.195, 70.898], ['A', ' HB ', 158.842, 129.814, 69.398], ['A', ' HG ', 161.28, 131.573, 69.561], ['A', ' HG ', 161.308, 129.857, 69.266], ['A', ' HD ', 160.057, 130.126, 67.189], ['A', ' HD ', 159.894, 131.863, 67.484], ['A', ' HE ', 162.619, 130.59, 67.425], ['A', ' HE ', 161.817, 131.041, 65.91], ['A', ' HZ ', 163.251, 132.821, 66.73], ['A', ' HZ ', 161.689, 133.317, 66.741], ['A', ' HZ ', 162.433, 132.961, 68.174]]
[['A', ' N ', 156.816, 132.734, 71.363], ['A', ' CA ', 155.73, 132.75, 72.298], ['A', ' C ', 154.363, 132.558, 71.694], ['A', ' O ', 154.193, 132.126, 70.55], ['A', ' H ', 157.158, 133.614, 71.0], ['A', ' HA ', 155.899, 131.977, 73.046], ['A', ' HA ', 155.748, 133.705, 72.824]]
[['A', ' N ', 153.383, 132.852, 72.519], ['A', ' CA ', 151.99, 132.661, 72.226], ['A', ' C ', 151.349, 134.028, 71.958], ['A', ' O ', 151.953, 135.037, 72.311], ['A', ' CB ', 151.414, 131.926, 73.429], ['A', ' CG ', 152.179, 130.601, 73.814], ['A', ' CD1', 151.597, 130.038, 75.061], ['A', ' CD2', 152.082, 129.575, 72.71], ['A', ' H ', 153.639, 133.23, 73.421], ['A', ' HA ', 151.923, 132.045, 71.342], ['A', ' HB ', 151.4, 132.594, 74.291], ['A', ' HB ', 150.418, 131.634, 73.201], ['A', ' HG ', 153.228, 130.826, 74.001], ['A', ' HD1', 152.131, 129.128, 75.328], ['A', ' HD1', 151.695, 130.755, 75.862], ['A', ' HD1', 150.548, 129.805, 74.901], ['A', ' HD2', 152.617, 128.672, 73.013], ['A', ' HD2', 151.05, 129.331, 72.54], ['A', ' HD2', 152.526, 129.952, 71.793]]
[['A', ' N ', 150.174, 134.108, 71.3], ['A', ' CA ', 149.45, 135.331, 70.971], ['A', ' C ', 149.127, 136.212, 72.159], ['A', ' O ', 148.792, 135.73, 73.246], ['A', ' CB ', 148.146, 134.785, 70.395], ['A', ' CG ', 148.495, 133.449, 69.846], ['A', ' CD ', 149.514, 132.894, 70.794], ['A', ' HA ', 150.015, 135.898, 70.217], ['A', ' HB ', 147.401, 134.726, 71.195], ['A', ' HB ', 147.753, 135.48, 69.637], ['A', ' HG ', 147.589, 132.823, 69.798], ['A', ' HG ', 148.871, 133.535, 68.817], ['A', ' HD ', 149.018, 132.351, 71.587], ['A', ' HD ', 150.18, 132.269, 70.202]]
[['A', ' N ', 149.203, 137.51, 71.933], ['A', ' CA ', 148.92, 138.473, 72.967], ['A', ' C ', 147.475, 138.36, 73.391], ['A', ' O ', 146.58, 138.218, 72.559], ['A', ' CB ', 149.206, 139.879, 72.453], ['A', ' CG ', 150.662, 140.105, 72.075], ['A', ' CD ', 150.979, 139.664, 70.662], ['A', ' OE1', 150.106, 139.111, 70.019], ['A', ' OE2', 152.081, 139.872, 70.229], ['A', ' H ', 149.483, 137.856, 71.009], ['A', ' HA ', 149.557, 138.265, 73.826], ['A', ' HB ', 148.588, 140.082, 71.578], ['A', ' HB ', 148.939, 140.607, 73.217], ['A', ' HG ', 150.895, 141.165, 72.175], ['A', ' HG ', 151.294, 139.553, 72.769]]
[['A', ' N ', 147.238, 138.435, 74.691], ['A', ' CA ', 145.885, 138.343, 75.207], ['A', ' C ', 145.533, 136.905, 75.562], ['A', ' O ', 144.452, 136.625, 76.098], ['A', ' H ', 148.01, 138.554, 75.333], ['A', ' HA ', 145.786, 138.977, 76.084], ['A', ' HA ', 145.185, 138.719, 74.462]]
[['A', ' N ', 146.42, 135.967, 75.247], ['A', ' CA ', 146.101, 134.608, 75.577], ['A', ' C ', 146.202, 134.453, 77.066], ['A', ' O ', 147.233, 134.766, 77.672], ['A', ' CB ', 147.042, 133.652, 74.849], ['A', ' CG ', 146.844, 132.165, 75.114], ['A', ' CD1', 145.497, 131.692, 74.593], ['A', ' CD2', 147.934, 131.416, 74.448], ['A', ' H ', 147.29, 136.177, 74.747], ['A', ' HA ', 145.082, 134.407, 75.276], ['A', ' HB ', 146.921, 133.817, 73.776], ['A', ' HB ', 148.068, 133.912, 75.107], ['A', ' HG ', 146.893, 131.995, 76.175], ['A', ' HD1', 145.374, 130.635, 74.788], ['A', ' HD1', 144.684, 132.219, 75.071], ['A', ' HD1', 145.463, 131.864, 73.525], ['A', ' HD2', 147.843, 130.359, 74.659], ['A', ' HD2', 147.884, 131.583, 73.383], ['A', ' HD2', 148.866, 131.768, 74.826]]
[['A', ' N ', 145.103, 134.007, 77.658], ['A', ' CA ', 144.992, 133.849, 79.091], ['A', ' C ', 144.642, 135.155, 79.808], ['A', ' O ', 144.813, 135.239, 81.019], ['A', ' H ', 144.303, 133.776, 77.077], ['A', ' HA ', 144.219, 133.107, 79.298], ['A', ' HA ', 145.918, 133.457, 79.493]]
[['A', ' N ', 144.2, 136.194, 79.091], ['A', ' CA ', 143.864, 137.449, 79.759], ['A', ' C ', 142.357, 137.61, 79.792], ['A', ' O ', 141.731, 137.787, 78.747], ['A', ' CB ', 144.477, 138.628, 78.999], ['A', ' CG1', 144.134, 139.921, 79.673], ['A', ' CG2', 145.94, 138.45, 78.941], ['A', ' H ', 144.079, 136.125, 78.076], ['A', ' HA ', 144.243, 137.43, 80.781], ['A', ' HB ', 144.067, 138.658, 77.989], ['A', ' HG1', 144.576, 140.747, 79.12], ['A', ' HG1', 143.054, 140.057, 79.709], ['A', ' HG1', 144.53, 139.903, 80.673], ['A', ' HG2', 146.403, 139.274, 78.408], ['A', ' HG2', 146.293, 138.428, 79.941], ['A', ' HG2', 146.182, 137.516, 78.439]]
[['A', ' N ', 141.767, 137.579, 80.987], ['A', ' CA ', 140.311, 137.593, 81.096], ['A', ' C ', 139.949, 137.64, 82.547], ['A', ' O ', 138.823, 137.939, 82.948], ['A', ' CB ', 139.744, 136.279, 80.565], ['A', ' CG ', 140.099, 135.169, 81.497], ['A', ' ND1', 141.397, 134.865, 81.799], ['A', ' CD2', 139.336, 134.287, 82.186], ['A', ' CE1', 141.429, 133.865, 82.636], ['A', ' NE2', 140.191, 133.48, 82.886], ['A', ' H ', 142.321, 137.474, 81.839], ['A', ' HA ', 139.88, 138.449, 80.578], ['A', ' HB ', 138.661, 136.342, 80.49], ['A', ' HB ', 140.135, 136.048, 79.576], ['A', ' HD2', 138.252, 134.232, 82.174], ['A', ' HE1', 142.329, 133.416, 83.045], ['A', ' HE2', 139.943, 132.679, 83.505]]
[['A', ' N ', 140.926, 137.232, 83.305], ['A', ' CA ', 140.841, 136.921, 84.695], ['A', ' C ', 140.528, 138.02, 85.645], ['A', ' O ', 140.961, 139.162, 85.493], ['A', ' CB ', 142.158, 136.356, 85.096], ['A', ' CG ', 143.192, 137.323, 84.736], ['A', ' OD1', 143.327, 137.708, 83.544], ['A', ' ND2', 143.924, 137.784, 85.701], ['A', ' H ', 141.824, 137.085, 82.852], ['A', ' HA ', 140.068, 136.16, 84.811], ['A', ' HB ', 142.168, 136.216, 86.168], ['A', ' HB ', 142.362, 135.409, 84.637], ['A', ' HD2', 144.635, 138.443, 85.505], ['A', ' HD2', 143.778, 137.465, 86.641]]
[['A', ' N ', 139.798, 137.621, 86.666], ['A', ' CA ', 139.493, 138.448, 87.791], ['A', ' C ', 140.613, 138.344, 88.826], ['A', ' O ', 140.968, 137.233, 89.229], ['A', ' CB ', 138.196, 137.983, 88.418], ['A', ' CG ', 137.855, 138.635, 89.743], ['A', ' CD ', 137.506, 140.071, 89.675], ['A', ' OE1', 136.562, 140.466, 88.979], ['A', ' NE2', 138.239, 140.894, 90.408], ['A', ' H ', 139.454, 136.671, 86.662], ['A', ' HA ', 139.356, 139.451, 87.42], ['A', ' HB ', 137.374, 138.18, 87.732], ['A', ' HB ', 138.237, 136.915, 88.558], ['A', ' HG ', 137.02, 138.1, 90.158], ['A', ' HG ', 138.696, 138.536, 90.414], ['A', ' HE2', 138.046, 141.878, 90.418], ['A', ' HE2', 139.034, 140.529, 90.955]]
[['A', ' N ', 141.278, 139.439, 89.174], ['A', ' CA ', 142.303, 139.503, 90.181], ['A', ' C ', 141.711, 139.504, 91.581], ['A', ' O ', 140.57, 139.938, 91.749], ['A', ' CB ', 142.976, 140.849, 89.855], ['A', ' CG ', 141.897, 141.688, 89.258], ['A', ' CD ', 141.058, 140.729, 88.463], ['A', ' HA ', 142.986, 138.658, 90.031], ['A', ' HB ', 143.369, 141.309, 90.772], ['A', ' HB ', 143.826, 140.696, 89.174], ['A', ' HG ', 141.324, 142.186, 90.056], ['A', ' HG ', 142.332, 142.483, 88.634], ['A', ' HD ', 140.04, 141.086, 88.53], ['A', ' HD ', 141.414, 140.672, 87.422]]
[['A', ' N ', 142.448, 139.081, 92.606], ['A', ' CA ', 143.728, 138.367, 92.618], ['A', ' C ', 143.876, 138.018, 94.08], ['A', ' O ', 143.489, 138.82, 94.934], ['A', ' CB ', 144.97, 139.17, 92.154], ['A', ' OG1', 146.071, 138.302, 92.127], ['A', ' CG2', 145.283, 140.322, 93.094], ['A', ' H ', 142.039, 139.213, 93.522], ['A', ' HA ', 143.657, 137.441, 92.045], ['A', ' HB ', 144.832, 139.543, 91.183], ['A', ' HG1', 145.95, 137.68, 91.395], ['A', ' HG2', 146.166, 140.848, 92.735], ['A', ' HG2', 144.44, 141.011, 93.122], ['A', ' HG2', 145.486, 139.963, 94.099]]
[['A', ' N ', 144.467, 136.896, 94.396], ['A', ' CA ', 144.665, 136.562, 95.789], ['A', ' C ', 146.109, 136.389, 96.234], ['A', ' O ', 146.846, 135.586, 95.668], ['A', ' CB ', 143.867, 135.296, 96.063], ['A', ' CG ', 143.993, 134.663, 97.412], ['A', ' CD1', 143.443, 135.56, 98.462], ['A', ' CD2', 143.236, 133.364, 97.398], ['A', ' H ', 144.713, 136.238, 93.658], ['A', ' HA ', 144.242, 137.368, 96.381], ['A', ' HB ', 142.831, 135.546, 95.94], ['A', ' HB ', 144.12, 134.561, 95.306], ['A', ' HG ', 145.045, 134.468, 97.639], ['A', ' HD1', 143.566, 135.048, 99.384], ['A', ' HD1', 143.98, 136.499, 98.504], ['A', ' HD1', 142.385, 135.756, 98.275], ['A', ' HD2', 143.316, 132.878, 98.37], ['A', ' HD2', 142.186, 133.558, 97.177], ['A', ' HD2', 143.645, 132.704, 96.637]]
[['A', ' N ', 146.489, 137.11, 97.289], ['A', ' CA ', 147.814, 136.989, 97.893], ['A', ' C ', 147.793, 137.534, 99.332], ['A', ' O ', 146.978, 138.407, 99.63], ['A', ' CB ', 148.819, 137.716, 97.046], ['A', ' H ', 145.82, 137.759, 97.684], ['A', ' HA ', 148.079, 135.929, 97.936], ['A', ' HB ', 149.782, 137.573, 97.487], ['A', ' HB ', 148.804, 137.295, 96.051], ['A', ' HB ', 148.573, 138.776, 97.001]]
[['A', ' N ', 148.702, 137.071, 100.202], ['A', ' CA ', 148.828, 137.622, 101.572], ['A', ' C ', 150.254, 138.107, 101.901], ['A', ' O ', 150.434, 139.025, 102.703], ['A', ' CB ', 148.486, 136.571, 102.606], ['A', ' OG ', 149.469, 135.572, 102.645], ['A', ' H ', 149.306, 136.323, 99.901], ['A', ' HA ', 148.15, 138.467, 101.669], ['A', ' HB ', 148.401, 137.033, 103.587], ['A', ' HB ', 147.52, 136.125, 102.367], ['A', ' HG ', 149.551, 135.219, 101.734]]
[['A', ' N ', 151.255, 137.537, 101.241], ['A', ' CA ', 152.662, 137.909, 101.45], ['A', ' C ', 153.385, 137.579, 100.17], ['A', ' O ', 152.767, 137.079, 99.245], ['A', ' CB ', 153.315, 137.14, 102.593], ['A', ' CG ', 154.562, 137.771, 103.143], ['A', ' ND1', 155.772, 137.801, 102.456], ['A', ' CD2', 154.786, 138.371, 104.329], ['A', ' CE1', 156.682, 138.398, 103.216], ['A', ' NE2', 156.105, 138.755, 104.35], ['A', ' H ', 151.026, 136.759, 100.625], ['A', ' HA ', 152.761, 138.976, 101.636], ['A', ' HB ', 152.605, 137.037, 103.413], ['A', ' HB ', 153.583, 136.14, 102.254], ['A', ' HD2', 154.055, 138.517, 105.125], ['A', ' HE1', 157.726, 138.567, 102.953], ['A', ' HE2', 156.557, 139.227, 105.12]]
[['A', ' N ', 154.679, 137.836, 100.086], ['A', ' CA ', 155.408, 137.505, 98.877], ['A', ' C ', 155.925, 136.074, 98.953], ['A', ' O ', 156.002, 135.38, 97.94], ['A', ' CB ', 156.579, 138.461, 98.656], ['A', ' CG ', 157.315, 138.226, 97.333], ['A', ' CD ', 156.44, 138.506, 96.156], ['A', ' OE1', 156.001, 139.632, 95.972], ['A', ' NE2', 156.143, 137.483, 95.383], ['A', ' H ', 155.158, 138.2, 100.894], ['A', ' HA ', 154.73, 137.585, 98.033], ['A', ' HB ', 156.214, 139.486, 98.665], ['A', ' HB ', 157.293, 138.353, 99.472], ['A', ' HG ', 158.166, 138.898, 97.288], ['A', ' HG ', 157.652, 137.196, 97.263], ['A', ' HE2', 155.482, 137.617, 94.607], ['A', ' HE2', 156.5, 136.566, 95.603]]
[['A', ' N ', 156.424, 135.697, 100.129], ['A', ' CA ', 156.97, 134.356, 100.383], ['A', ' C ', 156.453, 133.977, 101.748], ['A', ' O ', 156.609, 134.796, 102.631], ['A', ' CB ', 158.53, 134.351, 100.449], ['A', ' CG1', 159.183, 134.887, 99.127], ['A', ' CG2', 159.075, 132.922, 100.794], ['A', ' CD1', 159.039, 134.016, 97.89], ['A', ' H ', 156.326, 136.357, 100.918], ['A', ' HA ', 156.598, 133.651, 99.645], ['A', ' HB ', 158.842, 135.031, 101.242], ['A', ' HG1', 158.751, 135.85, 98.911], ['A', ' HG1', 160.249, 135.028, 99.309], ['A', ' HG2', 160.16, 132.966, 100.866], ['A', ' HG2', 158.675, 132.588, 101.748], ['A', ' HG2', 158.793, 132.207, 100.027], ['A', ' HD1', 159.528, 134.503, 97.046], ['A', ' HD1', 159.5, 133.048, 98.048], ['A', ' HD1', 157.989, 133.873, 97.648]]
[['A', ' N ', 155.927, 132.769, 101.983], ['A', ' CA ', 155.525, 132.451, 103.374], ['A', ' C ', 154.424, 133.393, 103.862], ['A', ' O ', 154.668, 134.446, 104.451], ['A', ' CB ', 156.726, 132.433, 104.334], ['A', ' CG ', 156.377, 132.088, 105.763], ['A', ' CD1', 156.048, 130.806, 106.112], ['A', ' CD2', 156.422, 133.056, 106.724], ['A', ' CE1', 155.761, 130.483, 107.391], ['A', ' CE2', 156.133, 132.737, 108.025], ['A', ' CZ ', 155.806, 131.446, 108.356], ['A', ' OH ', 155.513, 131.114, 109.652], ['A', ' H ', 155.794, 132.086, 101.217], ['A', ' HA ', 155.105, 131.447, 103.38], ['A', ' HB ', 157.454, 131.702, 103.984], ['A', ' HB ', 157.233, 133.385, 104.358], ['A', ' HD1', 156.006, 130.049, 105.385], ['A', ' HD2', 156.688, 134.08, 106.453], ['A', ' HE1', 155.495, 129.456, 107.646], ['A', ' HE2', 156.168, 133.508, 108.795], ['A', ' HH ', 155.474, 131.91, 110.187]]
[['A', ' N ', 153.199, 132.96, 103.674], ['A', ' CA ', 152.037, 133.78, 103.952], ['A', ' C ', 151.704, 133.98, 105.391], ['A', ' O ', 152.417, 133.556, 106.301], ['A', ' H ', 153.069, 132.058, 103.253], ['A', ' HA ', 152.153, 134.746, 103.477], ['A', ' HA ', 151.169, 133.318, 103.481]]
[['A', ' N ', 150.603, 134.68, 105.585], ['A', ' CA ', 150.17, 135.045, 106.911], ['A', ' C ', 148.676, 134.858, 107.086], ['A', ' O ', 147.958, 134.535, 106.14], ['A', ' CB ', 150.516, 136.528, 107.115], ['A', ' CG ', 150.651, 136.983, 108.551], ['A', ' OD1', 150.413, 136.18, 109.43], ['A', ' OD2', 150.941, 138.154, 108.765], ['A', ' H ', 150.065, 134.979, 104.769], ['A', ' HA ', 150.693, 134.424, 107.64], ['A', ' HB ', 151.446, 136.751, 106.59], ['A', ' HB ', 149.73, 137.126, 106.652]]
[['A', ' N ', 148.216, 135.152, 108.281], ['A', ' CA ', 146.807, 135.157, 108.611], ['A', ' C ', 146.434, 136.61, 108.515], ['A', ' O ', 147.333, 137.446, 108.438], ['A', ' CB ', 146.539, 134.572, 109.979], ['A', ' CG ', 147.136, 135.334, 111.119], ['A', ' CD ', 146.862, 134.669, 112.389], ['A', ' NE ', 147.44, 135.397, 113.499], ['A', ' CZ ', 147.304, 135.052, 114.795], ['A', ' NH1', 146.592, 133.999, 115.117], ['A', ' NH2', 147.89, 135.78, 115.736], ['A', ' H ', 148.913, 135.401, 108.988], ['A', ' HA ', 146.244, 134.597, 107.865], ['A', ' HB ', 145.466, 134.508, 110.146], ['A', ' HB ', 146.932, 133.553, 110.02], ['A', ' HG ', 148.217, 135.396, 110.991], ['A', ' HG ', 146.722, 136.338, 111.162], ['A', ' HD ', 145.784, 134.603, 112.537], ['A', ' HD ', 147.293, 133.664, 112.37], ['A', ' HE ', 147.999, 136.216, 113.281], ['A', ' HH1', 146.129, 133.447, 114.399], ['A', ' HH1', 146.469, 133.719, 116.086], ['A', ' HH2', 148.438, 136.591, 115.482], ['A', ' HH2', 147.788, 135.523, 116.707]]
[['A', ' N ', 145.148, 136.939, 108.503], ['A', ' CA ', 144.79, 138.334, 108.284], ['A', ' C ', 145.279, 138.577, 106.871], ['A', ' O ', 145.823, 137.652, 106.267], ['A', ' CB ', 145.301, 139.353, 109.352], ['A', ' OG1', 146.711, 139.348, 109.467], ['A', ' CG2', 144.713, 139.038, 110.7], ['A', ' H ', 144.432, 136.233, 108.588], ['A', ' HA ', 143.704, 138.428, 108.268], ['A', ' HB ', 144.985, 140.35, 109.056], ['A', ' HG1', 147.107, 139.097, 108.626], ['A', ' HG2', 145.06, 139.772, 111.427], ['A', ' HG2', 143.629, 139.071, 110.64], ['A', ' HG2', 145.029, 138.047, 111.009]]
[['A', ' N ', 144.966, 139.721, 106.267], ['A', ' CA ', 145.168, 139.922, 104.818], ['A', ' C ', 144.109, 139.041, 104.146], ['A', ' O ', 143.103, 139.534, 103.628], ['A', ' CB ', 146.575, 139.565, 104.283], ['A', ' CG ', 147.727, 140.509, 104.642], ['A', ' CD ', 148.331, 140.184, 106.033], ['A', ' CE ', 149.682, 140.903, 106.239], ['A', ' NZ ', 150.264, 140.705, 107.644], ['A', ' H ', 144.546, 140.459, 106.811], ['A', ' HA ', 144.954, 140.962, 104.561], ['A', ' HB ', 146.885, 138.579, 104.523], ['A', ' HB ', 146.52, 139.588, 103.196], ['A', ' HG ', 148.51, 140.414, 103.883], ['A', ' HG ', 147.366, 141.535, 104.641], ['A', ' HD ', 147.648, 140.506, 106.816], ['A', ' HD ', 148.473, 139.105, 106.13], ['A', ' HE ', 150.395, 140.522, 105.505], ['A', ' HE ', 149.535, 141.967, 106.068], ['A', ' HZ ', 151.135, 141.201, 107.719], ['A', ' HZ ', 149.618, 141.064, 108.331], ['A', ' HZ ', 150.446, 139.702, 107.871]]
[['A', ' N ', 144.286, 137.723, 104.214], ['A', ' CA ', 143.254, 136.835, 103.743], ['A', ' C ', 142.172, 136.85, 104.776], ['A', ' O ', 142.125, 136.072, 105.738], ['A', ' CB ', 143.733, 135.417, 103.547], ['A', ' CG ', 142.652, 134.554, 102.994], ['A', ' CD1', 142.186, 134.761, 101.739], ['A', ' CD2', 142.108, 133.541, 103.719], ['A', ' CE1', 141.207, 133.981, 101.2], ['A', ' CE2', 141.124, 132.768, 103.178], ['A', ' CZ ', 140.674, 132.983, 101.929], ['A', ' H ', 145.127, 137.369, 104.657], ['A', ' HA ', 142.847, 137.219, 102.809], ['A', ' HB ', 144.577, 135.405, 102.863], ['A', ' HB ', 144.067, 135.002, 104.497], ['A', ' HD1', 142.601, 135.571, 101.167], ['A', ' HD2', 142.464, 133.353, 104.735], ['A', ' HE1', 140.858, 134.171, 100.184], ['A', ' HE2', 140.705, 131.973, 103.742], ['A', ' HZ ', 139.887, 132.353, 101.519]]
[['A', ' N ', 141.275, 137.769, 104.568], ['A', ' CA ', 140.243, 137.977, 105.522], ['A', ' C ', 139.148, 136.988, 105.216], ['A', ' O ', 138.247, 137.252, 104.409], ['A', ' CB ', 139.735, 139.406, 105.426], ['A', ' CG ', 138.767, 139.769, 106.49], ['A', ' OD1', 138.55, 138.961, 107.364], ['A', ' OD2', 138.235, 140.853, 106.432], ['A', ' H ', 141.405, 138.395, 103.769], ['A', ' HA ', 140.628, 137.791, 106.525], ['A', ' HB ', 140.583, 140.092, 105.468], ['A', ' HB ', 139.27, 139.542, 104.479]]
[['A', ' N ', 139.18, 135.865, 105.918], ['A', ' CA ', 138.274, 134.74, 105.702], ['A', ' C ', 136.941, 134.986, 106.392], ['A', ' O ', 136.521, 134.29, 107.313], ['A', ' CB ', 138.996, 133.465, 106.203], ['A', ' CG ', 138.333, 132.041, 106.078], ['A', ' CD1', 137.794, 131.815, 104.755], ['A', ' CD2', 139.413, 130.99, 106.312], ['A', ' H ', 139.976, 135.768, 106.55], ['A', ' HA ', 138.104, 134.651, 104.631], ['A', ' HB ', 139.968, 133.425, 105.736], ['A', ' HB ', 139.157, 133.617, 107.26], ['A', ' HG ', 137.535, 131.934, 106.816], ['A', ' HD1', 137.357, 130.817, 104.703], ['A', ' HD1', 137.05, 132.535, 104.641], ['A', ' HD1', 138.537, 131.914, 103.991], ['A', ' HD2', 138.975, 129.996, 106.232], ['A', ' HD2', 140.196, 131.081, 105.593], ['A', ' HD2', 139.828, 131.119, 107.276]]
[['A', ' N ', 136.286, 136.01, 105.847], ['A', ' CA ', 135.008, 136.584, 106.209], ['A', ' C ', 134.414, 136.963, 104.867], ['A', ' O ', 133.203, 136.999, 104.66], ['A', ' CB ', 135.185, 137.816, 107.101], ['A', ' CG ', 133.888, 138.284, 107.799], ['A', ' OD1', 133.342, 137.514, 108.556], ['A', ' OD2', 133.466, 139.399, 107.577], ['A', ' H ', 136.775, 136.476, 105.09], ['A', ' HA ', 134.38, 135.841, 106.698], ['A', ' HB ', 135.938, 137.603, 107.864], ['A', ' HB ', 135.578, 138.644, 106.502]]
[['A', ' N ', 135.331, 137.22, 103.93], ['A', ' CA ', 135.036, 137.645, 102.566], ['A', ' C ', 134.988, 136.456, 101.636], ['A', ' O ', 134.903, 136.595, 100.423], ['A', ' CB ', 136.089, 138.612, 102.068], ['A', ' CG ', 136.084, 139.967, 102.697], ['A', ' CD ', 137.32, 140.734, 102.37], ['A', ' NE ', 137.521, 140.984, 100.944], ['A', ' CZ ', 138.645, 141.549, 100.429], ['A', ' NH1', 139.626, 141.939, 101.229], ['A', ' NH2', 138.77, 141.704, 99.125], ['A', ' H ', 136.32, 137.152, 104.192], ['A', ' HA ', 134.066, 138.142, 102.554], ['A', ' HB ', 137.057, 138.192, 102.265], ['A', ' HB ', 136.001, 138.734, 100.991], ['A', ' HG ', 135.227, 140.528, 102.334], ['A', ' HG ', 136.025, 139.863, 103.783], ['A', ' HD ', 137.288, 141.691, 102.887], ['A', ' HD ', 138.162, 140.169, 102.716], ['A', ' HE ', 136.778, 140.688, 100.272], ['A', ' HH1', 139.549, 141.818, 102.229], ['A', ' HH1', 140.462, 142.352, 100.84], ['A', ' HH2', 138.022, 141.365, 98.502], ['A', ' HH2', 139.597, 142.113, 98.734]]
[['A', ' N ', 135.091, 135.28, 102.201], ['A', ' CA ', 135.131, 134.06, 101.435], ['A', ' C ', 133.874, 133.199, 101.446], ['A', ' O ', 133.295, 132.939, 102.502], ['A', ' CB ', 136.229, 133.229, 101.988], ['A', ' CG ', 136.244, 131.967, 101.427], ['A', ' CD1', 136.718, 131.795, 100.2], ['A', ' CD2', 135.729, 130.905, 102.12], ['A', ' CE1', 136.693, 130.602, 99.646], ['A', ' CE2', 135.697, 129.693, 101.568], ['A', ' CZ ', 136.176, 129.535, 100.322], ['A', ' H ', 135.132, 135.232, 103.209], ['A', ' HA ', 135.347, 134.317, 100.399], ['A', ' HB ', 137.197, 133.697, 101.868], ['A', ' HB ', 136.017, 133.14, 103.005], ['A', ' HD1', 137.109, 132.637, 99.652], ['A', ' HD2', 135.327, 131.056, 103.125], ['A', ' HE1', 137.078, 130.489, 98.663], ['A', ' HE2', 135.283, 128.842, 102.108], ['A', ' HZ ', 136.143, 128.547, 99.871]]
[['A', ' N ', 133.51, 132.691, 100.263], ['A', ' CA ', 132.404, 131.759, 100.092], ['A', ' C ', 132.853, 130.395, 99.545], ['A', ' O ', 133.663, 130.306, 98.623], ['A', ' CB ', 131.338, 132.359, 99.157], ['A', ' OG1', 130.832, 133.561, 99.731], ['A', ' CG2', 130.191, 131.394, 98.956], ['A', ' H ', 133.999, 132.993, 99.418], ['A', ' HA ', 131.948, 131.592, 101.067], ['A', ' HB ', 131.792, 132.591, 98.191], ['A', ' HG1', 131.534, 134.218, 99.73], ['A', ' HG2', 129.456, 131.854, 98.301], ['A', ' HG2', 130.541, 130.478, 98.503], ['A', ' HG2', 129.729, 131.169, 99.914]]
[['A', ' N ', 132.341, 129.317, 100.133], ['A', ' CA ', 132.643, 127.97, 99.642], ['A', ' C ', 131.541, 127.468, 98.71], ['A', ' O ', 130.387, 127.339, 99.126], ['A', ' CB ', 132.786, 126.995, 100.809], ['A', ' CG ', 133.098, 125.542, 100.419], ['A', ' CD ', 134.486, 125.335, 99.905], ['A', ' OE1', 135.321, 126.133, 100.21], ['A', ' OE2', 134.714, 124.359, 99.229], ['A', ' H ', 131.705, 129.436, 100.91], ['A', ' HA ', 133.58, 127.997, 99.083], ['A', ' HB ', 133.576, 127.335, 101.471], ['A', ' HB ', 131.862, 126.989, 101.384], ['A', ' HG ', 132.956, 124.912, 101.296], ['A', ' HG ', 132.39, 125.214, 99.664]]
[['A', ' N ', 131.881, 127.178, 97.461], ['A', ' CA ', 130.907, 126.718, 96.488], ['A', ' C ', 131.05, 125.281, 96.022], ['A', ' O ', 132.118, 124.799, 95.643], ['A', ' CB ', 130.9, 127.664, 95.279], ['A', ' CG1', 130.501, 129.071, 95.697], ['A', ' CG2', 130.075, 127.16, 94.141], ['A', ' CD1', 129.116, 129.245, 96.307], ['A', ' H ', 132.842, 127.316, 97.135], ['A', ' HA ', 129.931, 126.763, 96.954], ['A', ' HB ', 131.915, 127.764, 94.923], ['A', ' HG1', 131.247, 129.454, 96.395], ['A', ' HG1', 130.518, 129.664, 94.822], ['A', ' HG2', 130.148, 127.867, 93.346], ['A', ' HG2', 130.446, 126.204, 93.791], ['A', ' HG2', 129.038, 127.052, 94.437], ['A', ' HD1', 128.96, 130.299, 96.514], ['A', ' HD1', 128.352, 128.912, 95.612], ['A', ' HD1', 129.02, 128.696, 97.236]]
[['A', ' N ', 129.933, 124.583, 96.03], ['A', ' CA ', 129.909, 123.224, 95.542], ['A', ' C ', 129.923, 123.354, 94.037], ['A', ' O ', 129.107, 124.116, 93.505], ['A', ' CB ', 128.693, 122.501, 96.073], ['A', ' CG ', 128.691, 122.383, 97.565], ['A', ' SD ', 130.065, 121.386, 98.169], ['A', ' CE ', 131.235, 122.608, 98.801], ['A', ' H ', 129.091, 125.027, 96.377], ['A', ' HA ', 130.807, 122.721, 95.874], ['A', ' HB ', 127.792, 123.037, 95.775], ['A', ' HB ', 128.622, 121.498, 95.655], ['A', ' HG ', 128.753, 123.371, 98.02], ['A', ' HG ', 127.76, 121.915, 97.887], ['A', ' HE ', 132.101, 122.103, 99.217], ['A', ' HE ', 131.563, 123.271, 98.015], ['A', ' HE ', 130.758, 123.194, 99.586]]
[['A', ' N ', 130.721, 122.539, 93.331], ['A', ' CA ', 130.993, 122.629, 91.917], ['A', ' C ', 129.776, 122.531, 91.055], ['A', ' O ', 129.745, 123.103, 89.978], ['A', ' CB ', 131.897, 121.426, 91.664], ['A', ' CG ', 131.585, 120.465, 92.768], ['A', ' CD ', 131.261, 121.321, 93.961], ['A', ' HA ', 131.53, 123.563, 91.719], ['A', ' HB ', 131.68, 120.993, 90.679], ['A', ' HB ', 132.956, 121.743, 91.655], ['A', ' HG ', 130.744, 119.805, 92.476], ['A', ' HG ', 132.454, 119.805, 92.935], ['A', ' HD ', 130.501, 120.794, 94.553], ['A', ' HD ', 132.155, 121.522, 94.531]]
[['A', ' N ', 128.708, 121.923, 91.53], ['A', ' CA ', 127.554, 121.826, 90.678], ['A', ' C ', 127.042, 123.194, 90.249], ['A', ' O ', 126.563, 123.346, 89.127], ['A', ' CB ', 126.453, 121.043, 91.38], ['A', ' CG ', 126.793, 119.571, 91.623], ['A', ' CD ', 127.618, 119.332, 92.862], ['A', ' OE1', 127.975, 120.29, 93.514], ['A', ' OE2', 127.9, 118.195, 93.157], ['A', ' H ', 128.676, 121.445, 92.436], ['A', ' HA ', 127.858, 121.294, 89.789], ['A', ' HB ', 126.235, 121.507, 92.344], ['A', ' HB ', 125.543, 121.083, 90.784], ['A', ' HG ', 125.87, 118.999, 91.695], ['A', ' HG ', 127.347, 119.198, 90.767]]
[['A', ' N ', 127.218, 124.209, 91.094], ['A', ' CA ', 126.725, 125.544, 90.809], ['A', ' C ', 127.474, 126.244, 89.678], ['A', ' O ', 127.027, 127.278, 89.188], ['A', ' CB ', 126.814, 126.398, 92.054], ['A', ' OG ', 125.94, 125.95, 93.058], ['A', ' H ', 127.671, 124.052, 92.001], ['A', ' HA ', 125.678, 125.463, 90.519], ['A', ' HB ', 127.833, 126.367, 92.423], ['A', ' HB ', 126.59, 127.433, 91.804], ['A', ' HG ', 126.09, 126.525, 93.814]]
[['A', ' N ', 128.646, 125.735, 89.311], ['A', ' CA ', 129.449, 126.328, 88.255], ['A', ' C ', 129.372, 125.681, 86.904], ['A', ' O ', 130.029, 126.155, 85.959], ['A', ' CB ', 130.882, 126.405, 88.667], ['A', ' CG ', 131.091, 127.567, 89.44], ['A', ' CD1', 130.499, 127.909, 90.588], ['A', ' CD2', 131.953, 128.636, 89.099], ['A', ' NE1', 130.927, 129.125, 90.982], ['A', ' CE2', 131.812, 129.588, 90.08], ['A', ' CE3', 132.813, 128.867, 88.04], ['A', ' CZ2', 132.487, 130.758, 90.045], ['A', ' CZ3', 133.498, 130.049, 88.008], ['A', ' CH2', 133.332, 130.971, 88.987], ['A', ' H ', 128.97, 124.863, 89.734], ['A', ' HA ', 129.105, 127.355, 88.135], ['A', ' HB ', 131.119, 125.522, 89.257], ['A', ' HB ', 131.527, 126.406, 87.8], ['A', ' HD1', 129.774, 127.312, 91.119], ['A', ' HE1', 130.625, 129.615, 91.811], ['A', ' HE3', 132.943, 128.134, 87.248], ['A', ' HZ2', 132.364, 131.513, 90.81], ['A', ' HZ3', 134.178, 130.235, 87.171], ['A', ' HH2', 133.875, 131.897, 88.927]]
[['A', ' N ', 128.608, 124.615, 86.763], ['A', ' CA ', 128.593, 124.011, 85.461], ['A', ' C ', 127.158, 123.876, 85.028], ['A', ' O ', 126.296, 123.471, 85.798], ['A', ' CB ', 129.316, 122.672, 85.498], ['A', ' CG ', 130.744, 122.788, 86.024], ['A', ' CD1', 130.986, 122.49, 87.328], ['A', ' CD2', 131.777, 123.217, 85.234], ['A', ' CE1', 132.249, 122.609, 87.86], ['A', ' CE2', 133.06, 123.336, 85.767], ['A', ' CZ ', 133.285, 123.037, 87.069], ['A', ' OH ', 134.55, 123.156, 87.599], ['A', ' H ', 128.041, 124.238, 87.536], ['A', ' HA ', 129.087, 124.66, 84.739], ['A', ' HB ', 128.778, 121.992, 86.134], ['A', ' HB ', 129.341, 122.242, 84.499], ['A', ' HD1', 130.167, 122.153, 87.94], ['A', ' HD2', 131.589, 123.46, 84.198], ['A', ' HE1', 132.422, 122.368, 88.902], ['A', ' HE2', 133.888, 123.671, 85.15], ['A', ' HH ', 135.172, 123.44, 86.907]]
[['A', ' N ', 126.892, 124.249, 83.791], ['A', ' CA ', 125.557, 124.139, 83.249], ['A', ' C ', 125.266, 122.73, 82.795], ['A', ' O ', 124.146, 122.237, 82.907], ['A', ' CB ', 125.448, 125.143, 82.119], ['A', ' CG ', 126.61, 124.977, 81.143], ['A', ' OD1', 127.552, 124.239, 81.47], ['A', ' OD2', 126.602, 125.618, 80.113], ['A', ' H ', 127.639, 124.575, 83.178], ['A', ' HA ', 124.841, 124.405, 84.028], ['A', ' HB ', 124.507, 124.993, 81.588], ['A', ' HB ', 125.449, 126.155, 82.521]]
[['A', ' N ', 126.317, 122.086, 82.336], ['A', ' CA ', 126.309, 120.728, 81.834], ['A', ' C ', 126.465, 119.743, 82.997], ['A', ' O ', 127.534, 119.75, 83.624], ['A', ' CB ', 127.461, 120.509, 80.843], ['A', ' CG ', 127.395, 119.128, 80.196], ['A', ' OD1', 126.533, 118.366, 80.629], ['A', ' OD2', 128.173, 118.824, 79.299], ['A', ' H ', 127.154, 122.661, 82.249], ['A', ' HA ', 125.39, 120.574, 81.286], ['A', ' HB ', 127.42, 121.278, 80.066], ['A', ' HB ', 128.418, 120.619, 81.36]]
[['A', ' N ', 125.453, 118.896, 83.319], ['A', ' CA ', 125.454, 117.911, 84.389], ['A', ' C ', 126.623, 116.944, 84.239], ['A', ' O ', 127.093, 116.368, 85.216], ['A', ' CB ', 124.13, 117.18, 84.191], ['A', ' CG ', 123.253, 118.169, 83.497], ['A', ' CD ', 124.173, 118.934, 82.583], ['A', ' HA ', 125.467, 118.427, 85.35], ['A', ' HB ', 124.293, 116.266, 83.596], ['A', ' HB ', 123.729, 116.862, 85.162], ['A', ' HG ', 122.454, 117.652, 82.948], ['A', ' HG ', 122.763, 118.821, 84.234], ['A', ' HD ', 124.269, 118.439, 81.602], ['A', ' HD ', 123.768, 119.937, 82.507]]
[['A', ' N ', 127.142, 116.812, 83.013], ['A', ' CA ', 128.266, 115.929, 82.774], ['A', ' C ', 129.455, 116.407, 83.561], ['A', ' O ', 130.263, 115.607, 84.017], ['A', ' CB ', 128.645, 115.9, 81.297], ['A', ' CG ', 129.84, 115.011, 80.932], ['A', ' CD ', 129.636, 113.56, 81.181], ['A', ' OE1', 128.509, 113.138, 81.307], ['A', ' OE2', 130.621, 112.857, 81.23], ['A', ' H ', 126.754, 117.319, 82.203], ['A', ' HA ', 128.003, 114.922, 83.103], ['A', ' HB ', 127.783, 115.596, 80.702], ['A', ' HB ', 128.91, 116.904, 80.986], ['A', ' HG ', 130.045, 115.148, 79.872], ['A', ' HG ', 130.719, 115.348, 81.477]]
[['A', ' N ', 129.604, 117.71, 83.71], ['A', ' CA ', 130.736, 118.184, 84.44], ['A', ' C ', 130.332, 118.334, 85.875], ['A', ' O ', 131.038, 117.9, 86.787], ['A', ' CB ', 131.258, 119.508, 83.928], ['A', ' CG1', 131.732, 119.335, 82.486], ['A', ' CG2', 132.384, 119.906, 84.85], ['A', ' CD1', 132.09, 120.635, 81.782], ['A', ' H ', 128.914, 118.373, 83.353], ['A', ' HA ', 131.54, 117.452, 84.377], ['A', ' HB ', 130.48, 120.259, 83.923], ['A', ' HG1', 132.566, 118.668, 82.471], ['A', ' HG1', 130.926, 118.869, 81.917], ['A', ' HG2', 132.836, 120.813, 84.522], ['A', ' HG2', 132.04, 120.042, 85.865], ['A', ' HG2', 133.105, 119.123, 84.84], ['A', ' HD1', 132.389, 120.414, 80.76], ['A', ' HD1', 131.222, 121.297, 81.768], ['A', ' HD1', 132.911, 121.129, 82.29]]
[['A', ' N ', 129.151, 118.882, 86.102], ['A', ' CA ', 128.743, 119.142, 87.466], ['A', ' C ', 128.817, 117.893, 88.329], ['A', ' O ', 129.263, 117.962, 89.468], ['A', ' CB ', 127.314, 119.639, 87.471], ['A', ' H ', 128.574, 119.191, 85.315], ['A', ' HA ', 129.409, 119.894, 87.885], ['A', ' HB ', 126.988, 119.838, 88.466], ['A', ' HB ', 127.217, 120.541, 86.873], ['A', ' HB ', 126.695, 118.872, 87.064]]
[['A', ' N ', 128.464, 116.737, 87.774], ['A', ' CA ', 128.462, 115.499, 88.526], ['A', ' C ', 129.755, 114.699, 88.451], ['A', ' O ', 129.824, 113.612, 89.026], ['A', ' CB ', 127.303, 114.625, 88.069], ['A', ' CG ', 125.942, 115.22, 88.368], ['A', ' CD ', 124.824, 114.294, 87.926], ['A', ' CE ', 123.459, 114.883, 88.255], ['A', ' NZ ', 122.345, 113.985, 87.827], ['A', ' H ', 128.113, 116.715, 86.813], ['A', ' HA ', 128.301, 115.752, 89.574], ['A', ' HB ', 127.376, 114.467, 86.991], ['A', ' HB ', 127.364, 113.652, 88.552], ['A', ' HG ', 125.857, 115.416, 89.437], ['A', ' HG ', 125.848, 116.167, 87.834], ['A', ' HD ', 124.894, 114.141, 86.847], ['A', ' HD ', 124.93, 113.331, 88.422], ['A', ' HE ', 123.391, 115.042, 89.331], ['A', ' HE ', 123.354, 115.843, 87.748], ['A', ' HZ ', 121.459, 114.411, 88.064], ['A', ' HZ ', 122.391, 113.839, 86.829], ['A', ' HZ ', 122.426, 113.097, 88.301]]
[['A', ' N ', 130.751, 115.178, 87.715], ['A', ' CA ', 132.031, 114.481, 87.6], ['A', ' C ', 133.158, 115.23, 88.263], ['A', ' O ', 134.122, 114.619, 88.714], ['A', ' CB ', 132.426, 114.211, 86.165], ['A', ' CG ', 131.597, 113.174, 85.46], ['A', ' CD ', 132.039, 112.988, 84.059], ['A', ' NE ', 133.41, 112.462, 83.962], ['A', ' CZ ', 134.152, 112.474, 82.827], ['A', ' NH1', 133.645, 112.954, 81.705], ['A', ' NH2', 135.388, 111.99, 82.812], ['A', ' H ', 130.642, 116.093, 87.284], ['A', ' HA ', 131.937, 113.518, 88.1], ['A', ' HB ', 132.344, 115.137, 85.592], ['A', ' HB ', 133.468, 113.9, 86.131], ['A', ' HG ', 131.682, 112.223, 85.98], ['A', ' HG ', 130.552, 113.492, 85.451], ['A', ' HD ', 131.366, 112.285, 83.571], ['A', ' HD ', 132.001, 113.941, 83.539], ['A', ' HE ', 133.828, 112.072, 84.795], ['A', ' HH1', 132.668, 113.279, 81.661], ['A', ' HH1', 134.2, 112.954, 80.856], ['A', ' HH2', 135.812, 111.546, 83.634], ['A', ' HH2', 135.92, 112.006, 81.951]]
[['A', ' N ', 133.056, 116.547, 88.316], ['A', ' CA ', 134.121, 117.34, 88.878], ['A', ' C ', 134.356, 116.904, 90.307], ['A', ' O ', 133.418, 116.765, 91.096], ['A', ' CB ', 133.763, 118.817, 88.792], ['A', ' H ', 132.253, 117.012, 87.898], ['A', ' HA ', 135.032, 117.147, 88.32], ['A', ' HB ', 134.567, 119.417, 89.21], ['A', ' HB ', 133.605, 119.088, 87.746], ['A', ' HB ', 132.845, 118.997, 89.351]]
[['A', ' N ', 135.627, 116.764, 90.644], ['A', ' CA ', 136.073, 116.302, 91.954], ['A', ' C ', 136.732, 117.355, 92.822], ['A', ' O ', 137.601, 117.046, 93.637], ['A', ' CB ', 137.049, 115.156, 91.772], ['A', ' SG ', 136.325, 113.705, 91.011], ['A', ' H ', 136.315, 116.902, 89.897], ['A', ' HA ', 135.203, 115.921, 92.489], ['A', ' HB ', 137.879, 115.48, 91.143], ['A', ' HB ', 137.465, 114.858, 92.733], ['A', ' HG ', 137.46, 112.981, 91.037]]
[['A', ' N ', 136.333, 118.598, 92.663], ['A', ' CA ', 136.869, 119.652, 93.497], ['A', ' C ', 135.828, 120.69, 93.8], ['A', ' O ', 134.856, 120.839, 93.066], ['A', ' CB ', 138.016, 120.314, 92.816], ['A', ' OG ', 137.604, 120.96, 91.647], ['A', ' H ', 135.647, 118.82, 91.957], ['A', ' HA ', 137.205, 119.22, 94.441], ['A', ' HB ', 138.409, 121.023, 93.484], ['A', ' HB ', 138.794, 119.59, 92.595], ['A', ' HG ', 138.388, 121.377, 91.295]]
[['A', ' N ', 136.019, 121.415, 94.89], ['A', ' CA ', 135.106, 122.48, 95.242], ['A', ' C ', 135.63, 123.772, 94.693], ['A', ' O ', 136.758, 123.828, 94.21], ['A', ' CB ', 134.882, 122.583, 96.751], ['A', ' OG1', 136.099, 122.925, 97.396], ['A', ' CG2', 134.367, 121.256, 97.304], ['A', ' H ', 136.82, 121.248, 95.484], ['A', ' HA ', 134.15, 122.301, 94.771], ['A', ' HB ', 134.148, 123.368, 96.951], ['A', ' HG1', 135.862, 123.408, 98.231], ['A', ' HG2', 134.214, 121.354, 98.375], ['A', ' HG2', 133.424, 121.003, 96.824], ['A', ' HG2', 135.092, 120.466, 97.118]]
[['A', ' N ', 134.814, 124.813, 94.744], ['A', ' CA ', 135.192, 126.111, 94.245], ['A', ' C ', 135.263, 127.188, 95.306], ['A', ' O ', 134.239, 127.681, 95.77], ['A', ' CB ', 134.19, 126.518, 93.165], ['A', ' CG1', 134.293, 125.461, 92.052], ['A', ' CG2', 134.307, 128.001, 92.735], ['A', ' CD1', 133.378, 125.649, 90.938], ['A', ' H ', 133.88, 124.704, 95.145], ['A', ' HA ', 136.154, 126.016, 93.753], ['A', ' HB ', 133.194, 126.381, 93.574], ['A', ' HG1', 135.308, 125.411, 91.693], ['A', ' HG1', 134.04, 124.494, 92.477], ['A', ' HG2', 133.552, 128.232, 92.002], ['A', ' HG2', 134.16, 128.665, 93.578], ['A', ' HG2', 135.255, 128.191, 92.332], ['A', ' HD1', 133.498, 124.83, 90.224], ['A', ' HD1', 132.361, 125.659, 91.316], ['A', ' HD1', 133.596, 126.584, 90.44]]
[['A', ' N ', 136.444, 127.529, 95.789], ['A', ' CA ', 136.636, 128.604, 96.7], ['A', ' C ', 136.212, 129.836, 95.931], ['A', ' O ', 136.578, 129.955, 94.763], ['A', ' CB ', 138.137, 128.554, 96.934], ['A', ' CG ', 138.537, 127.182, 96.601], ['A', ' CD ', 137.641, 126.789, 95.48], ['A', ' HA ', 136.029, 128.442, 97.603], ['A', ' HB ', 138.589, 129.221, 96.254], ['A', ' HB ', 138.411, 128.862, 97.941], ['A', ' HG ', 139.602, 127.159, 96.307], ['A', ' HG ', 138.443, 126.516, 97.474], ['A', ' HD ', 138.061, 127.105, 94.515], ['A', ' HD ', 137.494, 125.711, 95.548]]
[['A', ' N ', 135.525, 130.782, 96.538], ['A', ' CA ', 135.156, 131.94, 95.767], ['A', ' C ', 135.293, 133.224, 96.614], ['A', ' O ', 134.427, 133.555, 97.439], ['A', ' CB ', 133.711, 131.673, 95.338], ['A', ' CG ', 133.107, 132.568, 94.396], ['A', ' CD1', 133.783, 132.403, 93.079], ['A', ' CD2', 131.662, 132.287, 94.262], ['A', ' H ', 135.167, 130.664, 97.487], ['A', ' HA ', 135.83, 132.019, 94.922], ['A', ' HB ', 133.668, 130.669, 94.915], ['A', ' HB ', 133.092, 131.673, 96.236], ['A', ' HG ', 133.26, 133.555, 94.734], ['A', ' HD1', 133.334, 133.086, 92.366], ['A', ' HD1', 134.815, 132.606, 93.165], ['A', ' HD1', 133.655, 131.381, 92.735], ['A', ' HD2', 131.217, 132.981, 93.543], ['A', ' HD2', 131.55, 131.285, 93.902], ['A', ' HD2', 131.169, 132.398, 95.228]]
[['A', ' N ', 136.372, 133.972, 96.41], ['A', ' CA ', 136.655, 135.105, 97.293], ['A', ' C ', 135.918, 136.339, 96.808], ['A', ' O ', 135.983, 136.691, 95.635], ['A', ' CB ', 138.158, 135.337, 97.39], ['A', ' CG ', 138.572, 136.176, 98.533], ['A', ' CD1', 138.415, 135.626, 99.78], ['A', ' CD2', 139.138, 137.407, 98.394], ['A', ' CE1', 138.798, 136.286, 100.891], ['A', ' CE2', 139.541, 138.083, 99.534], ['A', ' CZ ', 139.362, 137.507, 100.778], ['A', ' OH ', 139.753, 138.138, 101.925], ['A', ' H ', 137.011, 133.732, 95.662], ['A', ' HA ', 136.276, 134.877, 98.285], ['A', ' HB ', 138.664, 134.416, 97.481], ['A', ' HB ', 138.509, 135.811, 96.472], ['A', ' HD1', 137.981, 134.648, 99.876], ['A', ' HD2', 139.278, 137.85, 97.406], ['A', ' HE1', 138.663, 135.831, 101.876], ['A', ' HE2', 140.0, 139.064, 99.447], ['A', ' HH ', 139.424, 137.619, 102.688]]
[['A', ' N ', 135.136, 136.947, 97.687], ['A', ' CA ', 134.286, 138.085, 97.373], ['A', ' C ', 133.209, 137.707, 96.378], ['A', ' O ', 132.613, 138.573, 95.74], ['A', ' CB ', 135.064, 139.287, 96.817], ['A', ' CG ', 135.962, 139.96, 97.821], ['A', ' OD1', 135.577, 140.081, 98.969], ['A', ' OD2', 137.023, 140.4, 97.429], ['A', ' H ', 135.121, 136.625, 98.651], ['A', ' HA ', 133.797, 138.4, 98.296], ['A', ' HB ', 135.659, 139.001, 95.959], ['A', ' HB ', 134.35, 140.029, 96.463]]
[['A', ' N ', 132.942, 136.416, 96.226], ['A', ' CA ', 131.901, 135.997, 95.313], ['A', ' C ', 132.389, 135.89, 93.873], ['A', ' O ', 131.593, 135.634, 92.967], ['A', ' H ', 133.457, 135.707, 96.758], ['A', ' HA ', 131.509, 135.035, 95.639], ['A', ' HA ', 131.075, 136.704, 95.362]]
[['A', ' N ', 133.683, 136.074, 93.641], ['A', ' CA ', 134.205, 136.003, 92.294], ['A', ' C ', 135.399, 135.077, 92.276], ['A', ' O ', 136.129, 134.974, 93.254], ['A', ' CB ', 134.572, 137.393, 91.827], ['A', ' CG ', 133.379, 138.335, 91.796], ['A', ' CD ', 133.701, 139.711, 91.381], ['A', ' NE ', 134.13, 139.795, 90.011], ['A', ' CZ ', 133.355, 139.828, 88.926], ['A', ' NH1', 132.041, 139.74, 89.0], ['A', ' NH2', 133.967, 139.95, 87.774], ['A', ' H ', 134.324, 136.299, 94.409], ['A', ' HA ', 133.443, 135.595, 91.63], ['A', ' HB ', 135.335, 137.815, 92.484], ['A', ' HB ', 134.984, 137.334, 90.825], ['A', ' HG ', 132.621, 137.925, 91.135], ['A', ' HG ', 132.967, 138.416, 92.801], ['A', ' HD ', 132.828, 140.349, 91.513], ['A', ' HD ', 134.51, 140.086, 92.009], ['A', ' HE ', 135.118, 139.904, 89.826], ['A', ' HH1', 131.588, 139.644, 89.896], ['A', ' HH1', 131.485, 139.768, 88.157], ['A', ' HH2', 134.993, 140.025, 87.797], ['A', ' HH2', 133.453, 139.983, 86.909]]
[['A', ' N ', 135.607, 134.367, 91.189], ['A', ' CA ', 136.776, 133.526, 91.134], ['A', ' C ', 137.973, 134.419, 91.043], ['A', ' O ', 137.904, 135.441, 90.372], ['A', ' CB ', 136.666, 132.602, 89.973], ['A', ' CG ', 136.38, 133.371, 88.776], ['A', ' OD1', 135.272, 133.933, 88.674], ['A', ' ND2', 137.305, 133.457, 87.879], ['A', ' H ', 134.989, 134.439, 90.383], ['A', ' HA ', 136.864, 132.948, 92.057], ['A', ' HB ', 137.6, 132.063, 89.841], ['A', ' HB ', 135.883, 131.876, 90.149], ['A', ' HD2', 137.148, 133.987, 87.051], ['A', ' HD2', 138.195, 133.009, 88.029]]
[['A', ' N ', 139.054, 134.075, 91.721], ['A', ' CA ', 140.244, 134.901, 91.603], ['A', ' C ', 141.473, 134.104, 91.307], ['A', ' O ', 141.643, 133.021, 91.857], ['A', ' CB ', 140.487, 135.707, 92.896], ['A', ' CG1', 139.347, 136.681, 93.124], ['A', ' CG2', 140.624, 134.764, 94.115], ['A', ' H ', 139.049, 133.223, 92.264], ['A', ' HA ', 140.094, 135.604, 90.786], ['A', ' HB ', 141.398, 136.288, 92.78], ['A', ' HG1', 139.543, 137.267, 94.019], ['A', ' HG1', 139.273, 137.343, 92.272], ['A', ' HG1', 138.409, 136.148, 93.247], ['A', ' HG2', 140.786, 135.365, 95.001], ['A', ' HG2', 139.709, 134.191, 94.24], ['A', ' HG2', 141.462, 134.081, 93.994]]
[['A', ' N ', 142.387, 134.684, 90.548], ['A', ' CA ', 143.648, 133.985, 90.347], ['A', ' C ', 144.475, 134.047, 91.591], ['A', ' O ', 144.518, 135.089, 92.253], ['A', ' CB ', 144.523, 134.597, 89.271], ['A', ' CG ', 144.068, 134.484, 87.892], ['A', ' CD ', 145.082, 135.078, 86.968], ['A', ' OE1', 145.947, 135.763, 87.464], ['A', ' OE2', 145.033, 134.833, 85.79], ['A', ' H ', 142.158, 135.58, 90.098], ['A', ' HA ', 143.437, 132.944, 90.108], ['A', ' HB ', 144.639, 135.659, 89.486], ['A', ' HB ', 145.517, 134.147, 89.331], ['A', ' HG ', 143.899, 133.444, 87.643], ['A', ' HG ', 143.13, 135.014, 87.814]]
[['A', ' N ', 145.165, 132.969, 91.866], ['A', ' CA ', 146.109, 132.925, 92.959], ['A', ' C ', 147.369, 132.325, 92.339], ['A', ' O ', 147.263, 131.535, 91.406], ['A', ' CB ', 145.548, 132.082, 94.101], ['A', ' CG1', 145.487, 130.669, 93.716], ['A', ' CG2', 146.321, 132.283, 95.296], ['A', ' H ', 145.019, 132.148, 91.27], ['A', ' HA ', 146.32, 133.934, 93.32], ['A', ' HB ', 144.519, 132.39, 94.295], ['A', ' HG1', 145.074, 130.16, 94.54], ['A', ' HG1', 144.858, 130.548, 92.845], ['A', ' HG1', 146.471, 130.264, 93.503], ['A', ' HG2', 145.895, 131.684, 96.105], ['A', ' HG2', 147.302, 132.0, 95.109], ['A', ' HG2', 146.295, 133.315, 95.568]]
[['A', ' N ', 148.559, 132.665, 92.797], ['A', ' CA ', 149.707, 132.067, 92.143], ['A', ' C ', 150.839, 133.054, 92.118], ['A', ' O ', 150.829, 133.985, 92.906], ['A', ' H ', 148.677, 133.313, 93.569], ['A', ' HA ', 150.004, 131.158, 92.65], ['A', ' HA ', 149.417, 131.798, 91.134]]
[['A', ' N ', 151.926, 132.759, 91.393], ['A', ' CA ', 153.107, 133.584, 91.23], ['A', ' C ', 152.933, 134.862, 90.414], ['A', ' O ', 153.746, 135.755, 90.555], ['A', ' CB ', 154.072, 132.632, 90.557], ['A', ' CG ', 153.209, 131.632, 89.897], ['A', ' CD ', 152.018, 131.469, 90.747], ['A', ' HA ', 153.488, 133.847, 92.229], ['A', ' HB ', 154.699, 133.19, 89.843], ['A', ' HB ', 154.76, 132.199, 91.307], ['A', ' HG ', 152.993, 131.897, 88.851], ['A', ' HG ', 153.748, 130.715, 89.893], ['A', ' HD ', 151.178, 131.258, 90.084], ['A', ' HD ', 152.182, 130.663, 91.491]]
[['A', ' N ', 151.908, 134.984, 89.531], ['A', ' CA ', 151.79, 136.306, 88.891], ['A', ' C ', 150.895, 137.103, 89.801], ['A', ' O ', 150.883, 138.326, 89.811], ['A', ' CB ', 151.239, 136.33, 87.483], ['A', ' CG ', 149.779, 135.995, 87.309], ['A', ' CD ', 149.312, 136.364, 85.951], ['A', ' NE ', 149.358, 137.796, 85.758], ['A', ' CZ ', 148.444, 138.676, 86.201], ['A', ' NH1', 147.368, 138.299, 86.869], ['A', ' NH2', 148.636, 139.947, 85.952], ['A', ' H ', 151.267, 134.236, 89.325], ['A', ' HA ', 152.759, 136.793, 88.865], ['A', ' HB ', 151.403, 137.321, 87.075], ['A', ' HB ', 151.809, 135.645, 86.879], ['A', ' HG ', 149.627, 134.926, 87.434], ['A', ' HG ', 149.164, 136.531, 88.02], ['A', ' HD ', 149.985, 135.934, 85.227], ['A', ' HD ', 148.294, 136.005, 85.772], ['A', ' HE ', 150.149, 138.176, 85.24], ['A', ' HH1', 147.166, 137.304, 87.06], ['A', ' HH1', 146.712, 138.992, 87.19], ['A', ' HH2', 149.459, 140.239, 85.406], ['A', ' HH2', 147.975, 140.635, 86.267]]
[['A', ' N ', 150.101, 136.383, 90.556], ['A', ' CA ', 149.32, 136.976, 91.588], ['A', ' C ', 150.408, 137.142, 92.584], ['A', ' O ', 151.48, 136.618, 92.34], ['A', ' CB ', 148.189, 136.111, 92.06], ['A', ' H ', 150.078, 135.386, 90.436], ['A', ' HA ', 148.944, 137.949, 91.277], ['A', ' HB ', 147.69, 136.575, 92.911], ['A', ' HB ', 147.472, 135.958, 91.254], ['A', ' HB ', 148.59, 135.184, 92.36]]
[['A', ' N ', 150.282, 137.958, 93.594], ['A', ' CA ', 151.415, 138.012, 94.516], ['A', ' C ', 152.699, 138.414, 93.77], ['A', ' O ', 153.795, 137.951, 94.077], ['A', ' CB ', 151.617, 136.633, 95.122], ['A', ' CG ', 152.474, 136.535, 96.285], ['A', ' CD ', 152.534, 135.156, 96.702], ['A', ' NE ', 153.234, 134.364, 95.74], ['A', ' CZ ', 153.185, 133.03, 95.62], ['A', ' NH1', 152.447, 132.286, 96.415], ['A', ' NH2', 153.903, 132.477, 94.692], ['A', ' H ', 149.41, 138.435, 93.783], ['A', ' HA ', 151.21, 138.74, 95.301], ['A', ' HB ', 150.668, 136.173, 95.35], ['A', ' HB ', 152.102, 135.983, 94.417], ['A', ' HG ', 153.48, 136.851, 96.107], ['A', ' HG ', 152.043, 137.131, 97.053], ['A', ' HD ', 153.037, 135.07, 97.661], ['A', ' HD ', 151.523, 134.795, 96.762], ['A', ' HE ', 153.815, 134.874, 95.08], ['A', ' HH1', 151.885, 132.721, 97.163], ['A', ' HH1', 152.47, 131.259, 96.306], ['A', ' HH2', 154.512, 133.068, 94.122], ['A', ' HH2', 153.922, 131.479, 94.562]]
[['A', ' N ', 152.544, 139.288, 92.793], ['A', ' CA ', 153.644, 139.822, 92.008], ['A', ' C ', 153.155, 141.166, 91.548], ['A', ' O ', 153.913, 142.03, 91.142], ['A', ' CB ', 153.987, 138.903, 90.857], ['A', ' CG ', 155.254, 139.213, 90.109], ['A', ' SD ', 156.716, 139.005, 91.097], ['A', ' CE ', 156.913, 137.237, 91.155], ['A', ' H ', 151.61, 139.578, 92.577], ['A', ' HA ', 154.516, 139.967, 92.644], ['A', ' HB ', 154.043, 137.918, 91.239], ['A', ' HB ', 153.192, 138.932, 90.133], ['A', ' HG ', 155.327, 138.576, 89.232], ['A', ' HG ', 155.236, 140.218, 89.786], ['A', ' HE ', 157.797, 136.992, 91.738], ['A', ' HE ', 156.036, 136.773, 91.616], ['A', ' HE ', 157.031, 136.852, 90.148]]
[['A', ' N ', 151.835, 141.309, 91.637], ['A', ' CA ', 151.074, 142.493, 91.277], ['A', ' C ', 150.614, 143.138, 92.576], ['A', ' O ', 149.813, 144.069, 92.587], ['A', ' CB ', 149.851, 142.129, 90.407], ['A', ' CG1', 150.292, 141.508, 89.115], ['A', ' CG2', 148.961, 141.144, 91.159], ['A', ' H ', 151.326, 140.517, 91.971], ['A', ' HA ', 151.719, 143.188, 90.735], ['A', ' HB ', 149.292, 143.033, 90.173], ['A', ' HG1', 149.427, 141.258, 88.512], ['A', ' HG1', 150.899, 142.214, 88.581], ['A', ' HG1', 150.863, 140.622, 89.307], ['A', ' HG2', 148.099, 140.895, 90.543], ['A', ' HG2', 149.508, 140.242, 91.377], ['A', ' HG2', 148.615, 141.591, 92.078]]
[['A', ' N ', 151.103, 142.543, 93.654], ['A', ' CA ', 150.927, 142.885, 95.044], ['A', ' C ', 152.314, 142.691, 95.59], ['A', ' O ', 153.019, 141.801, 95.117], ['A', ' CB ', 149.971, 141.946, 95.783], ['A', ' CG ', 148.523, 141.946, 95.353], ['A', ' CD ', 147.779, 143.194, 95.744], ['A', ' OE1', 148.329, 144.005, 96.46], ['A', ' OE2', 146.642, 143.33, 95.349], ['A', ' H ', 151.758, 141.804, 93.473], ['A', ' HA ', 150.623, 143.926, 95.157], ['A', ' HB ', 150.333, 140.929, 95.688], ['A', ' HB ', 149.99, 142.189, 96.847], ['A', ' HG ', 148.477, 141.841, 94.285], ['A', ' HG ', 148.025, 141.081, 95.791]]
[['A', ' N ', 152.716, 143.479, 96.572], ['A', ' CA ', 154.031, 143.383, 97.231], ['A', ' C ', 155.129, 143.899, 96.284], ['A', ' O ', 155.791, 144.897, 96.57], ['A', ' CB ', 154.313, 141.945, 97.667], ['A', ' CG ', 153.206, 141.444, 98.467], ['A', ' CD1', 152.45, 140.419, 97.987], ['A', ' CD2', 152.847, 142.038, 99.643], ['A', ' CE1', 151.366, 140.004, 98.657], ['A', ' CE2', 151.748, 141.611, 100.315], ['A', ' CZ ', 151.007, 140.599, 99.808], ['A', ' H ', 152.06, 144.172, 96.902], ['A', ' HA ', 154.025, 144.024, 98.112], ['A', ' HB ', 154.474, 141.292, 96.838], ['A', ' HB ', 155.214, 141.918, 98.271], ['A', ' HD1', 152.729, 139.949, 97.037], ['A', ' HD2', 153.433, 142.868, 100.035], ['A', ' HE1', 150.784, 139.214, 98.279], ['A', ' HE2', 151.45, 142.088, 101.252], ['A', ' HZ ', 150.123, 140.268, 100.334]]
[['A', ' N ', 155.287, 143.233, 95.149], ['A', ' CA ', 156.14, 143.668, 94.054], ['A', ' C ', 155.23, 144.26, 92.994], ['A', ' O ', 154.032, 143.999, 92.998], ['A', ' CB ', 156.978, 142.525, 93.478], ['A', ' CG ', 158.008, 141.964, 94.447], ['A', ' CD ', 158.882, 140.879, 93.826], ['A', ' OE1', 158.938, 140.755, 92.603], ['A', ' NE2', 159.579, 140.122, 94.66], ['A', ' H ', 154.706, 142.408, 95.028], ['A', ' HA ', 156.809, 144.451, 94.405], ['A', ' HB ', 156.314, 141.708, 93.188], ['A', ' HB ', 157.488, 142.862, 92.576], ['A', ' HG ', 158.653, 142.773, 94.778], ['A', ' HG ', 157.485, 141.542, 95.298], ['A', ' HE2', 160.194, 139.384, 94.309], ['A', ' HE2', 159.524, 140.287, 95.643]]
[['A', ' N ', 155.747, 145.113, 92.122], ['A', ' CA ', 154.884, 145.582, 91.046], ['A', ' C ', 155.047, 144.686, 89.829], ['A', ' O ', 156.148, 144.204, 89.554], ['A', ' H ', 156.721, 145.37, 92.158], ['A', ' HA ', 153.844, 145.573, 91.371], ['A', ' HA ', 155.138, 146.609, 90.789]]
[['A', ' N ', 153.971, 144.516, 89.079], ['A', ' CA ', 153.959, 143.724, 87.859], ['A', ' C ', 152.713, 144.155, 87.118], ['A', ' O ', 151.696, 144.434, 87.752], ['A', ' CB ', 154.007, 142.249, 88.227], ['A', ' CG ', 154.229, 141.232, 87.195], ['A', ' CD1', 155.49, 141.01, 86.697], ['A', ' CD2', 153.212, 140.439, 86.772], ['A', ' CE1', 155.715, 140.018, 85.778], ['A', ' CE2', 153.431, 139.453, 85.869], ['A', ' CZ ', 154.686, 139.235, 85.364], ['A', ' H ', 153.108, 144.947, 89.379], ['A', ' HA ', 154.832, 143.967, 87.251], ['A', ' HB ', 154.817, 142.152, 88.92], ['A', ' HB ', 153.123, 141.987, 88.759], ['A', ' HD1', 156.318, 141.634, 87.046], ['A', ' HD2', 152.211, 140.593, 87.169], ['A', ' HE1', 156.715, 139.853, 85.383], ['A', ' HE2', 152.604, 138.838, 85.552], ['A', ' HZ ', 154.855, 138.438, 84.635]]
[['A', ' N ', 152.807, 144.354, 85.816], ['A', ' CA ', 151.645, 144.801, 85.059], ['A', ' C ', 151.191, 143.783, 84.04], ['A', ' O ', 150.047, 143.802, 83.585], ['A', ' CB ', 151.943, 146.132, 84.386], ['A', ' CG ', 152.18, 147.261, 85.371], ['A', ' CD ', 152.443, 148.577, 84.661], ['A', ' CE ', 152.676, 149.705, 85.659], ['A', ' NZ ', 152.973, 151.0, 84.981], ['A', ' H ', 153.674, 144.118, 85.319], ['A', ' HA ', 150.818, 144.951, 85.751], ['A', ' HB ', 152.831, 146.027, 83.759], ['A', ' HB ', 151.112, 146.407, 83.74], ['A', ' HG ', 151.306, 147.364, 86.015], ['A', ' HG ', 153.037, 147.017, 85.995], ['A', ' HD ', 153.322, 148.479, 84.022], ['A', ' HD ', 151.586, 148.827, 84.036], ['A', ' HE ', 151.785, 149.825, 86.274], ['A', ' HE ', 153.516, 149.442, 86.302], ['A', ' HZ ', 153.121, 151.718, 85.677], ['A', ' HZ ', 153.806, 150.905, 84.416], ['A', ' HZ ', 152.196, 151.26, 84.391]]
[['A', ' N ', 152.104, 142.923, 83.653], ['A', ' CA ', 151.886, 141.952, 82.617], ['A', ' C ', 150.768, 140.993, 82.997], ['A', ' O ', 150.664, 140.575, 84.154], ['A', ' CB ', 153.197, 141.209, 82.374], ['A', ' CG ', 154.359, 142.083, 81.852], ['A', ' CD ', 155.204, 142.822, 82.943], ['A', ' OE1', 154.681, 143.166, 84.002], ['A', ' OE2', 156.367, 143.03, 82.696], ['A', ' H ', 153.03, 142.966, 84.066], ['A', ' HA ', 151.596, 142.475, 81.706], ['A', ' HB ', 153.519, 140.737, 83.284], ['A', ' HB ', 153.039, 140.431, 81.638], ['A', ' HG ', 155.029, 141.449, 81.271], ['A', ' HG ', 153.942, 142.827, 81.174]]
[['A', ' N ', 149.947, 140.644, 82.004], ['A', ' CA ', 148.825, 139.722, 82.145], ['A', ' C ', 148.911, 138.653, 81.07], ['A', ' O ', 149.488, 138.893, 80.011], ['A', ' CB ', 147.503, 140.451, 81.969], ['A', ' CG ', 147.24, 141.583, 82.941], ['A', ' CD ', 145.922, 142.222, 82.712], ['A', ' NE ', 144.842, 141.316, 83.046], ['A', ' CZ ', 143.525, 141.543, 82.854], ['A', ' NH1', 143.106, 142.676, 82.324], ['A', ' NH2', 142.661, 140.609, 83.204], ['A', ' H ', 150.116, 141.048, 81.094], ['A', ' HA ', 148.865, 139.25, 83.123], ['A', ' HB ', 147.449, 140.862, 80.963], ['A', ' HB ', 146.691, 139.734, 82.069], ['A', ' HG ', 147.254, 141.203, 83.951], ['A', ' HG ', 148.01, 142.346, 82.832], ['A', ' HD ', 145.837, 143.112, 83.335], ['A', ' HD ', 145.833, 142.495, 81.66], ['A', ' HE ', 145.102, 140.446, 83.483], ['A', ' HH1', 143.767, 143.39, 82.057], ['A', ' HH1', 142.117, 142.832, 82.188], ['A', ' HH2', 143.005, 139.726, 83.586], ['A', ' HH2', 141.666, 140.749, 83.089]]
[['A', ' N ', 148.322, 137.484, 81.313], ['A', ' CA ', 148.298, 136.428, 80.297], ['A', ' C ', 149.246, 135.293, 80.605], ['A', ' O ', 149.942, 135.31, 81.623], ['A', ' H ', 147.848, 137.317, 82.188], ['A', ' HA ', 147.288, 136.032, 80.217], ['A', ' HA ', 148.54, 136.847, 79.321]]
[['A', ' N ', 149.281, 134.315, 79.713], ['A', ' CA ', 150.078, 133.113, 79.935], ['A', ' C ', 151.567, 133.38, 79.939], ['A', ' O ', 152.314, 132.717, 80.663], ['A', ' CB ', 149.776, 132.041, 78.879], ['A', ' CG1', 148.391, 131.67, 78.945], ['A', ' CG2', 150.063, 132.517, 77.486], ['A', ' H ', 148.669, 134.417, 78.898], ['A', ' HA ', 149.801, 132.704, 80.908], ['A', ' HB ', 150.368, 131.157, 79.095], ['A', ' HG1', 148.244, 130.907, 78.199], ['A', ' HG1', 148.157, 131.293, 79.941], ['A', ' HG1', 147.778, 132.511, 78.724], ['A', ' HG2', 149.815, 131.714, 76.821], ['A', ' HG2', 149.456, 133.385, 77.243], ['A', ' HG2', 151.1, 132.759, 77.359]]
[['A', ' N ', 152.011, 134.351, 79.155], ['A', ' CA ', 153.424, 134.635, 79.159], ['A', ' C ', 153.76, 135.324, 80.456], ['A', ' O ', 154.858, 135.185, 80.958], ['A', ' CB ', 153.866, 135.465, 77.941], ['A', ' CG1', 153.566, 134.685, 76.651], ['A', ' CG2', 153.169, 136.815, 77.926], ['A', ' H ', 151.362, 134.868, 78.577], ['A', ' HA ', 153.969, 133.691, 79.121], ['A', ' HB ', 154.949, 135.615, 77.988], ['A', ' HG1', 153.911, 135.264, 75.791], ['A', ' HG1', 154.085, 133.729, 76.672], ['A', ' HG1', 152.501, 134.512, 76.56], ['A', ' HG2', 153.508, 137.376, 77.056], ['A', ' HG2', 152.092, 136.681, 77.868], ['A', ' HG2', 153.413, 137.386, 78.814]]
[['A', ' N ', 152.832, 136.097, 81.004], ['A', ' CA ', 153.11, 136.742, 82.264], ['A', ' C ', 153.237, 135.692, 83.357], ['A', ' O ', 154.166, 135.725, 84.161], ['A', ' CB ', 152.007, 137.715, 82.6], ['A', ' H ', 151.934, 136.203, 80.552], ['A', ' HA ', 154.055, 137.276, 82.175], ['A', ' HB ', 152.221, 138.211, 83.519], ['A', ' HB ', 151.928, 138.442, 81.807], ['A', ' HB ', 151.072, 137.19, 82.693]]
[['A', ' N ', 152.37, 134.686, 83.316], ['A', ' CA ', 152.358, 133.644, 84.335], ['A', ' C ', 153.606, 132.799, 84.327], ['A', ' O ', 154.171, 132.475, 85.381], ['A', ' CB ', 151.189, 132.703, 84.103], ['A', ' CG ', 149.849, 133.265, 84.352], ['A', ' CD ', 148.815, 132.326, 83.926], ['A', ' OE1', 149.014, 131.126, 84.049], ['A', ' NE2', 147.723, 132.832, 83.413], ['A', ' H ', 151.635, 134.709, 82.605], ['A', ' HA ', 152.27, 134.11, 85.308], ['A', ' HB ', 151.209, 132.379, 83.068], ['A', ' HB ', 151.309, 131.81, 84.721], ['A', ' HG ', 149.73, 133.441, 85.415], ['A', ' HG ', 149.731, 134.177, 83.791], ['A', ' HE2', 146.992, 132.22, 83.099], ['A', ' HE2', 147.598, 133.825, 83.356]]
[['A', ' N ', 154.122, 132.516, 83.145], ['A', ' CA ', 155.239, 131.604, 83.082], ['A', ' C ', 156.572, 132.355, 83.076], ['A', ' O ', 157.639, 131.766, 82.918], ['A', ' CB ', 155.003, 130.645, 81.896], ['A', ' CG ', 156.004, 129.555, 81.732], ['A', ' ND1', 156.29, 128.624, 82.698], ['A', ' CD2', 156.71, 129.208, 80.677], ['A', ' CE1', 157.204, 127.795, 82.242], ['A', ' NE2', 157.498, 128.136, 81.023], ['A', ' H ', 153.636, 132.806, 82.287], ['A', ' HA ', 155.237, 130.982, 83.973], ['A', ' HB ', 154.021, 130.183, 82.007], ['A', ' HB ', 154.982, 131.227, 80.972], ['A', ' HD1', 155.866, 128.482, 83.602], ['A', ' HD2', 156.744, 129.624, 79.708], ['A', ' HE1', 157.583, 126.99, 82.868]]
[['A', ' N ', 156.494, 133.652, 83.364], ['A', ' CA ', 157.617, 134.545, 83.571], ['A', ' C ', 157.676, 134.918, 85.03], ['A', ' O ', 158.741, 134.867, 85.644], ['A', ' CB ', 157.535, 135.783, 82.683], ['A', ' CG1', 158.59, 136.817, 83.079], ['A', ' CG2', 157.832, 135.33, 81.242], ['A', ' H ', 155.568, 134.067, 83.478], ['A', ' HA ', 158.536, 134.017, 83.313], ['A', ' HB ', 156.54, 136.227, 82.759], ['A', ' HG1', 158.521, 137.672, 82.409], ['A', ' HG1', 158.425, 137.155, 84.1], ['A', ' HG1', 159.561, 136.393, 83.007], ['A', ' HG2', 157.776, 136.184, 80.566], ['A', ' HG2', 158.83, 134.896, 81.195], ['A', ' HG2', 157.118, 134.581, 80.932]]
[['A', ' N ', 156.522, 135.22, 85.621], ['A', ' CA ', 156.463, 135.608, 87.01], ['A', ' C ', 157.066, 134.527, 87.874], ['A', ' O ', 157.713, 134.829, 88.869], ['A', ' CB ', 155.043, 135.863, 87.42], ['A', ' H ', 155.664, 135.259, 85.075], ['A', ' HA ', 157.038, 136.513, 87.139], ['A', ' HB ', 155.025, 136.165, 88.459], ['A', ' HB ', 154.621, 136.65, 86.802], ['A', ' HB ', 154.46, 134.949, 87.29]]
[['A', ' N ', 156.894, 133.27, 87.497], ['A', ' CA ', 157.47, 132.188, 88.274], ['A', ' C ', 158.983, 132.266, 88.334], ['A', ' O ', 159.594, 131.975, 89.362], ['A', ' CB ', 157.119, 130.897, 87.621], ['A', ' CG ', 155.734, 130.598, 87.741], ['A', ' CD ', 155.395, 129.436, 87.048], ['A', ' NE ', 153.991, 129.271, 86.992], ['A', ' CZ ', 153.23, 128.727, 87.924], ['A', ' NH1', 153.745, 128.228, 89.037], ['A', ' NH2', 151.947, 128.701, 87.684], ['A', ' H ', 156.302, 133.065, 86.683], ['A', ' HA ', 157.065, 132.225, 89.287], ['A', ' HB ', 157.37, 130.938, 86.559], ['A', ' HB ', 157.694, 130.082, 88.066], ['A', ' HG ', 155.57, 130.412, 88.779], ['A', ' HG ', 155.115, 131.42, 87.407], ['A', ' HD ', 155.765, 129.526, 86.029], ['A', ' HD ', 155.837, 128.578, 87.543], ['A', ' HE ', 153.515, 129.612, 86.158], ['A', ' HH1', 154.747, 128.239, 89.187], ['A', ' HH1', 153.146, 127.796, 89.724], ['A', ' HH2', 151.607, 129.04, 86.766], ['A', ' HH2', 151.271, 128.282, 88.336]]
[['A', ' N ', 159.597, 132.642, 87.226], ['A', ' CA ', 161.032, 132.707, 87.141], ['A', ' C ', 161.533, 133.869, 87.996], ['A', ' O ', 162.562, 133.79, 88.682], ['A', ' CB ', 161.396, 132.828, 85.686], ['A', ' H ', 159.058, 132.947, 86.421], ['A', ' HA ', 161.449, 131.783, 87.541], ['A', ' HB ', 162.42, 132.846, 85.557], ['A', ' HB ', 160.993, 131.968, 85.152], ['A', ' HB ', 160.96, 133.733, 85.283]]
[['A', ' N ', 160.76, 134.946, 87.995], ['A', ' CA ', 161.127, 136.111, 88.772], ['A', ' C ', 161.01, 135.757, 90.25], ['A', ' O ', 161.812, 136.197, 91.092], ['A', ' CB ', 160.182, 137.26, 88.446], ['A', ' CG ', 160.227, 137.794, 87.001], ['A', ' CD1', 159.125, 138.817, 86.837], ['A', ' CD2', 161.576, 138.389, 86.676], ['A', ' H ', 159.939, 134.955, 87.38], ['A', ' HA ', 162.159, 136.372, 88.565], ['A', ' HB ', 159.168, 136.927, 88.639], ['A', ' HB ', 160.396, 138.089, 89.121], ['A', ' HG ', 160.029, 136.976, 86.31], ['A', ' HD1', 159.124, 139.184, 85.812], ['A', ' HD1', 158.169, 138.376, 87.056], ['A', ' HD1', 159.294, 139.647, 87.52], ['A', ' HD2', 161.564, 138.755, 85.648], ['A', ' HD2', 161.783, 139.217, 87.354], ['A', ' HD2', 162.352, 137.64, 86.769]]
[['A', ' N ', 159.995, 134.961, 90.567], ['A', ' CA ', 159.787, 134.516, 91.918], ['A', ' C ', 160.936, 133.649, 92.39], ['A', ' O ', 161.385, 133.796, 93.521], ['A', ' CB ', 158.482, 133.785, 92.082], ['A', ' CG ', 158.252, 133.372, 93.479], ['A', ' CD ', 156.935, 132.888, 93.693], ['A', ' OE1', 156.02, 133.629, 93.481], ['A', ' OE2', 156.781, 131.737, 94.002], ['A', ' H ', 159.326, 134.697, 89.838], ['A', ' HA ', 159.744, 135.397, 92.556], ['A', ' HB ', 157.657, 134.412, 91.753], ['A', ' HB ', 158.481, 132.893, 91.463], ['A', ' HG ', 158.954, 132.578, 93.743], ['A', ' HG ', 158.439, 134.218, 94.142]]
[['A', ' N ', 161.48, 132.786, 91.533], ['A', ' CA ', 162.591, 131.957, 91.985], ['A', ' C ', 163.705, 132.832, 92.505], ['A', ' O ', 164.272, 132.545, 93.563], ['A', ' CB ', 163.163, 131.138, 90.849], ['A', ' CG ', 162.271, 130.126, 90.383], ['A', ' SD ', 162.814, 129.267, 88.927], ['A', ' CE ', 163.985, 128.176, 89.591], ['A', ' H ', 161.042, 132.653, 90.615], ['A', ' HA ', 162.247, 131.308, 92.789], ['A', ' HB ', 163.393, 131.79, 90.013], ['A', ' HB ', 164.089, 130.674, 91.171], ['A', ' HG ', 162.173, 129.414, 91.183], ['A', ' HG ', 161.307, 130.548, 90.191], ['A', ' HE ', 164.363, 127.563, 88.791], ['A', ' HE ', 164.796, 128.726, 90.052], ['A', ' HE ', 163.511, 127.536, 90.329]]
[['A', ' N ', 164.008, 133.92, 91.792], ['A', ' CA ', 165.064, 134.802, 92.271], ['A', ' C ', 164.698, 135.388, 93.638], ['A', ' O ', 165.54, 135.444, 94.542], ['A', ' CB ', 165.334, 135.925, 91.27], ['A', ' CG ', 166.003, 135.45, 89.994], ['A', ' CD ', 166.522, 136.614, 89.089], ['A', ' CE ', 165.391, 137.363, 88.377], ['A', ' NZ ', 165.904, 138.347, 87.329], ['A', ' H ', 163.524, 134.073, 90.896], ['A', ' HA ', 165.975, 134.216, 92.392], ['A', ' HB ', 164.391, 136.398, 91.002], ['A', ' HB ', 165.968, 136.681, 91.73], ['A', ' HG ', 166.841, 134.796, 90.245], ['A', ' HG ', 165.27, 134.862, 89.447], ['A', ' HD ', 167.082, 137.321, 89.703], ['A', ' HD ', 167.204, 136.212, 88.34], ['A', ' HE ', 164.722, 136.647, 87.896], ['A', ' HE ', 164.828, 137.92, 89.123], ['A', ' HZ ', 165.118, 138.824, 86.916], ['A', ' HZ ', 166.506, 139.023, 87.77], ['A', ' HZ ', 166.429, 137.89, 86.548]]
[['A', ' N ', 163.435, 135.782, 93.81], ['A', ' CA ', 162.997, 136.348, 95.086], ['A', ' C ', 163.101, 135.353, 96.234], ['A', ' O ', 163.592, 135.681, 97.326], ['A', ' CB ', 161.532, 136.83, 95.001], ['A', ' OG1', 161.417, 137.89, 94.034], ['A', ' CG2', 161.039, 137.326, 96.349], ['A', ' H ', 162.8, 135.747, 93.005], ['A', ' HA ', 163.633, 137.202, 95.316], ['A', ' HB ', 160.902, 136.003, 94.688], ['A', ' HG1', 161.629, 137.547, 93.149], ['A', ' HG2', 160.012, 137.647, 96.247], ['A', ' HG2', 161.087, 136.538, 97.095], ['A', ' HG2', 161.652, 138.165, 96.675]]
[['A', ' N ', 162.632, 134.14, 95.997], ['A', ' CA ', 162.633, 133.12, 97.018], ['A', ' C ', 164.039, 132.769, 97.433], ['A', ' O ', 164.322, 132.626, 98.623], ['A', ' CB ', 161.926, 131.888, 96.503], ['A', ' H ', 162.243, 133.946, 95.076], ['A', ' HA ', 162.107, 133.506, 97.889], ['A', ' HB ', 161.91, 131.129, 97.271], ['A', ' HB ', 160.904, 132.142, 96.219], ['A', ' HB ', 162.455, 131.512, 95.629]]
[['A', ' N ', 164.95, 132.706, 96.479], ['A', ' CA ', 166.297, 132.352, 96.833], ['A', ' C ', 166.949, 133.425, 97.668], ['A', ' O ', 167.638, 133.104, 98.642], ['A', ' CB ', 167.102, 132.035, 95.592], ['A', ' CG ', 168.549, 131.635, 95.809], ['A', ' CD1', 168.674, 130.483, 96.738], ['A', ' CD2', 169.076, 131.196, 94.526], ['A', ' H ', 164.677, 132.814, 95.498], ['A', ' HA ', 166.232, 131.447, 97.429], ['A', ' HB ', 166.602, 131.248, 95.045], ['A', ' HB ', 167.097, 132.929, 94.959], ['A', ' HG ', 169.123, 132.481, 96.193], ['A', ' HD1', 169.73, 130.225, 96.811], ['A', ' HD1', 168.308, 130.734, 97.727], ['A', ' HD1', 168.117, 129.633, 96.348], ['A', ' HD2', 170.11, 130.889, 94.657], ['A', ' HD2', 168.492, 130.356, 94.194], ['A', ' HD2', 169.003, 132.007, 93.805]]
[['A', ' N ', 166.725, 134.695, 97.342], ['A', ' CA ', 167.333, 135.728, 98.15], ['A', ' C ', 166.838, 135.646, 99.583], ['A', ' O ', 167.633, 135.796, 100.517], ['A', ' CB ', 167.03, 137.096, 97.584], ['A', ' OG ', 167.676, 137.295, 96.357], ['A', ' H ', 166.189, 134.944, 96.502], ['A', ' HA ', 168.412, 135.577, 98.147], ['A', ' HB ', 165.951, 137.188, 97.444], ['A', ' HB ', 167.336, 137.863, 98.294], ['A', ' HG ', 167.357, 138.14, 96.028]]
[['A', ' N ', 165.554, 135.338, 99.787], ['A', ' CA ', 165.089, 135.262, 101.163], ['A', ' C ', 165.703, 134.07, 101.888], ['A', ' O ', 165.995, 134.161, 103.084], ['A', ' CB ', 163.576, 135.182, 101.259], ['A', ' CG ', 163.021, 135.14, 102.716], ['A', ' CD ', 163.395, 136.369, 103.497], ['A', ' NE ', 162.815, 136.386, 104.819], ['A', ' CZ ', 163.216, 137.196, 105.828], ['A', ' NH1', 164.207, 138.063, 105.664], ['A', ' NH2', 162.611, 137.123, 107.006], ['A', ' H ', 164.911, 135.255, 98.988], ['A', ' HA ', 165.412, 136.175, 101.658], ['A', ' HB ', 163.134, 136.037, 100.751], ['A', ' HB ', 163.231, 134.282, 100.739], ['A', ' HG ', 161.932, 135.085, 102.688], ['A', ' HG ', 163.404, 134.269, 103.25], ['A', ' HD ', 164.469, 136.393, 103.627], ['A', ' HD ', 163.074, 137.262, 102.963], ['A', ' HE ', 162.029, 135.74, 105.013], ['A', ' HH1', 164.705, 138.148, 104.763], ['A', ' HH1', 164.492, 138.654, 106.429], ['A', ' HH2', 161.851, 136.433, 107.157], ['A', ' HH2', 162.901, 137.715, 107.765]]
[['A', ' N ', 165.865, 132.938, 101.202], ['A', ' CA ', 166.461, 131.777, 101.849], ['A', ' C ', 167.877, 132.103, 102.333], ['A', ' O ', 168.281, 131.728, 103.441], ['A', ' CB ', 166.504, 130.611, 100.871], ['A', ' H ', 165.532, 132.886, 100.231], ['A', ' HA ', 165.856, 131.518, 102.713], ['A', ' HB ', 166.937, 129.743, 101.341], ['A', ' HB ', 165.513, 130.372, 100.529], ['A', ' HB ', 167.11, 130.897, 100.014]]
[['A', ' N ', 168.604, 132.876, 101.535], ['A', ' CA ', 169.956, 133.25, 101.896], ['A', ' C ', 169.929, 134.14, 103.127], ['A', ' O ', 170.723, 133.924, 104.046], ['A', ' CB ', 170.675, 133.927, 100.72], ['A', ' CG1', 170.876, 132.865, 99.609], ['A', ' CG2', 172.041, 134.474, 101.191], ['A', ' CD1', 171.286, 133.391, 98.247], ['A', ' H ', 168.218, 133.133, 100.618], ['A', ' HA ', 170.508, 132.348, 102.145], ['A', ' HB ', 170.058, 134.734, 100.321], ['A', ' HG1', 171.642, 132.175, 99.943], ['A', ' HG1', 169.945, 132.316, 99.484], ['A', ' HG2', 172.565, 134.942, 100.367], ['A', ' HG2', 171.909, 135.22, 101.983], ['A', ' HG2', 172.638, 133.653, 101.572], ['A', ' HD1', 171.391, 132.555, 97.557], ['A', ' HD1', 170.513, 134.066, 97.877], ['A', ' HD1', 172.227, 133.919, 98.309]]
[['A', ' N ', 169.012, 135.107, 103.17], ['A', ' CA ', 168.914, 136.008, 104.313], ['A', ' C ', 168.621, 135.257, 105.611], ['A', ' O ', 169.155, 135.614, 106.666], ['A', ' CB ', 167.807, 137.032, 104.089], ['A', ' CG ', 168.1, 138.062, 103.024], ['A', ' CD ', 166.919, 138.951, 102.724], ['A', ' OE1', 165.851, 138.698, 103.251], ['A', ' OE2', 167.078, 139.88, 101.969], ['A', ' H ', 168.408, 135.254, 102.353], ['A', ' HA ', 169.866, 136.531, 104.416], ['A', ' HB ', 166.897, 136.513, 103.804], ['A', ' HB ', 167.603, 137.557, 105.021], ['A', ' HG ', 168.929, 138.681, 103.364], ['A', ' HG ', 168.417, 137.557, 102.119]]
[['A', ' N ', 167.79, 134.218, 105.563], ['A', ' CA ', 167.529, 133.514, 106.807], ['A', ' C ', 168.789, 132.868, 107.304], ['A', ' O ', 169.067, 132.924, 108.495], ['A', ' CB ', 166.44, 132.44, 106.7], ['A', ' CG1', 165.088, 133.066, 106.345], ['A', ' CG2', 166.355, 131.622, 108.061], ['A', ' CD1', 164.523, 134.065, 107.34], ['A', ' H ', 167.312, 133.992, 104.68], ['A', ' HA ', 167.238, 134.24, 107.559], ['A', ' HB ', 166.687, 131.765, 105.883], ['A', ' HG1', 165.186, 133.571, 105.391], ['A', ' HG1', 164.367, 132.261, 106.233], ['A', ' HG2', 165.587, 130.86, 107.999], ['A', ' HG2', 167.3, 131.135, 108.269], ['A', ' HG2', 166.121, 132.287, 108.881], ['A', ' HD1', 163.579, 134.415, 106.964], ['A', ' HD1', 164.359, 133.597, 108.306], ['A', ' HD1', 165.179, 134.916, 107.458]]
[['A', ' N ', 169.555, 132.25, 106.419], ['A', ' CA ', 170.79, 131.64, 106.873], ['A', ' C ', 171.826, 132.691, 107.291], ['A', ' O ', 172.63, 132.423, 108.173], ['A', ' CB ', 171.333, 130.701, 105.816], ['A', ' CG ', 170.522, 129.427, 105.554], ['A', ' CD1', 171.088, 128.749, 104.383], ['A', ' CD2', 170.585, 128.464, 106.739], ['A', ' H ', 169.253, 132.186, 105.439], ['A', ' HA ', 170.566, 131.064, 107.764], ['A', ' HB ', 171.356, 131.253, 104.876], ['A', ' HB ', 172.345, 130.411, 106.093], ['A', ' HG ', 169.508, 129.7, 105.347], ['A', ' HD1', 170.516, 127.854, 104.16], ['A', ' HD1', 171.06, 129.417, 103.549], ['A', ' HD1', 172.1, 128.487, 104.61], ['A', ' HD2', 170.021, 127.567, 106.505], ['A', ' HD2', 171.623, 128.194, 106.925], ['A', ' HD2', 170.167, 128.917, 107.618]]
[['A', ' N ', 171.787, 133.91, 106.717], ['A', ' CA ', 172.693, 134.971, 107.194], ['A', ' C ', 172.44, 135.24, 108.671], ['A', ' O ', 173.373, 135.545, 109.422], ['A', ' CB ', 172.476, 136.337, 106.502], ['A', ' CG ', 173.016, 136.545, 105.102], ['A', ' OD1', 173.912, 135.866, 104.716], ['A', ' OD2', 172.525, 137.418, 104.435], ['A', ' H ', 171.171, 134.065, 105.914], ['A', ' HA ', 173.723, 134.644, 107.061], ['A', ' HB ', 171.415, 136.54, 106.475], ['A', ' HB ', 172.912, 137.106, 107.136]]
[['A', ' N ', 171.178, 135.122, 109.091], ['A', ' CA ', 170.793, 135.33, 110.477], ['A', ' C ', 170.656, 133.964, 111.143], ['A', ' O ', 171.65, 133.257, 111.301], ['A', ' CB ', 169.473, 136.102, 110.557], ['A', ' CG ', 169.549, 137.534, 110.068], ['A', ' CD ', 168.217, 138.264, 110.15], ['A', ' OE1', 167.225, 137.636, 110.454], ['A', ' OE2', 168.199, 139.451, 109.914], ['A', ' H ', 170.448, 134.917, 108.398], ['A', ' HA ', 171.572, 135.894, 110.988], ['A', ' HB ', 168.722, 135.593, 109.944], ['A', ' HB ', 169.116, 136.129, 111.585], ['A', ' HG ', 170.288, 138.071, 110.66], ['A', ' HG ', 169.89, 137.527, 109.031]]
[['A', ' N ', 169.45, 133.587, 111.559], ['A', ' CA ', 169.248, 132.279, 112.166], ['A', ' C ', 170.287, 131.859, 113.191], ['A', ' O ', 171.266, 131.177, 112.872], ['A', ' CB ', 169.205, 131.199, 111.096], ['A', ' CG ', 169.026, 129.744, 111.585], ['A', ' CD1', 167.67, 129.577, 112.282], ['A', ' CD2', 169.195, 128.853, 110.407], ['A', ' H ', 168.658, 134.195, 111.416], ['A', ' HA ', 168.288, 132.312, 112.669], ['A', ' HB ', 168.377, 131.421, 110.436], ['A', ' HB ', 170.126, 131.25, 110.507], ['A', ' HG ', 169.786, 129.476, 112.309], ['A', ' HD1', 167.563, 128.545, 112.614], ['A', ' HD1', 167.612, 130.223, 113.153], ['A', ' HD1', 166.869, 129.828, 111.591], ['A', ' HD2', 169.095, 127.83, 110.74], ['A', ' HD2', 168.443, 129.081, 109.652], ['A', ' HD2', 170.187, 129.005, 109.989]]
[['A', ' N ', 170.128, 132.289, 114.427], ['A', ' CA ', 171.051, 131.797, 115.429], ['A', ' C ', 170.748, 130.306, 115.535], ['A', ' O ', 169.578, 129.926, 115.47], ['A', ' CB ', 170.894, 132.477, 116.777], ['A', ' CG ', 172.11, 132.208, 117.643], ['A', ' OD1', 172.325, 131.07, 118.025], ['A', ' OD2', 172.838, 133.141, 117.904], ['A', ' H ', 169.359, 132.892, 114.675], ['A', ' HA ', 172.077, 131.925, 115.08], ['A', ' HB ', 170.778, 133.552, 116.641], ['A', ' HB ', 170.004, 132.099, 117.286]]
[['A', ' N ', 171.773, 129.473, 115.686], ['A', ' CA ', 171.604, 128.024, 115.753], ['A', ' C ', 171.398, 127.494, 117.159], ['A', ' O ', 171.207, 126.29, 117.356], ['A', ' CB ', 172.824, 127.32, 115.159], ['A', ' OG1', 173.989, 127.677, 115.915], ['A', ' CG2', 173.007, 127.743, 113.737], ['A', ' H ', 172.71, 129.854, 115.762], ['A', ' HA ', 170.728, 127.756, 115.161], ['A', ' HB ', 172.684, 126.24, 115.198], ['A', ' HG1', 173.985, 127.196, 116.752], ['A', ' HG2', 173.874, 127.24, 113.317], ['A', ' HG2', 172.117, 127.472, 113.166], ['A', ' HG2', 173.152, 128.819, 113.696]]
[['A', ' N ', 171.452, 128.366, 118.156], ['A', ' CA ', 171.232, 127.917, 119.521], ['A', ' C ', 170.037, 128.666, 120.061], ['A', ' O ', 170.108, 129.818, 120.491], ['A', ' CB ', 172.442, 128.176, 120.379], ['A', ' OG ', 172.209, 127.775, 121.702], ['A', ' H ', 171.644, 129.363, 117.97], ['A', ' HA ', 171.006, 126.852, 119.528], ['A', ' HB ', 173.296, 127.636, 119.975], ['A', ' HB ', 172.683, 129.241, 120.35], ['A', ' HG ', 173.011, 127.986, 122.185]]
[['A', ' N ', 168.913, 127.988, 120.044], ['A', ' CA ', 167.662, 128.609, 120.385], ['A', ' C ', 166.649, 127.545, 120.731], ['A', ' O ', 166.817, 126.393, 120.323], ['A', ' CB ', 167.184, 129.424, 119.191], ['A', ' H ', 168.939, 127.032, 119.721], ['A', ' HA ', 167.827, 129.248, 121.25], ['A', ' HB ', 166.236, 129.913, 119.394], ['A', ' HB ', 167.927, 130.182, 118.937], ['A', ' HB ', 167.056, 128.749, 118.345]]
[['A', ' N ', 165.612, 127.857, 121.502], ['A', ' CA ', 164.488, 126.991, 121.666], ['A', ' C ', 163.875, 127.017, 120.303], ['A', ' O ', 163.915, 128.062, 119.662], ['A', ' CB ', 163.651, 127.692, 122.728], ['A', ' CG ', 164.059, 129.151, 122.621], ['A', ' CD ', 165.526, 129.125, 122.225], ['A', ' HA ', 164.815, 125.982, 121.957], ['A', ' HB ', 162.581, 127.534, 122.522], ['A', ' HB ', 163.855, 127.256, 123.718], ['A', ' HG ', 163.435, 129.658, 121.866], ['A', ' HG ', 163.88, 129.667, 123.576], ['A', ' HD ', 165.711, 129.986, 121.581], ['A', ' HD ', 166.178, 129.115, 123.111]]
[['A', ' N ', 163.319, 125.922, 119.855], ['A', ' CA ', 162.738, 125.924, 118.53], ['A', ' C ', 161.269, 125.618, 118.624], ['A', ' O ', 160.441, 126.341, 118.081], ['A', ' CB ', 163.452, 124.906, 117.645], ['A', ' CG1', 162.874, 124.877, 116.304], ['A', ' CG2', 164.844, 125.247, 117.549], ['A', ' H ', 163.287, 125.1, 120.441], ['A', ' HA ', 162.858, 126.91, 118.086], ['A', ' HB ', 163.329, 123.913, 118.074], ['A', ' HG1', 163.383, 124.128, 115.698], ['A', ' HG1', 161.84, 124.644, 116.366], ['A', ' HG1', 162.996, 125.84, 115.851], ['A', ' HG2', 165.33, 124.514, 116.923], ['A', ' HG2', 164.944, 126.232, 117.111], ['A', ' HG2', 165.303, 125.244, 118.532]]
[['A', ' N ', 160.96, 124.504, 119.269], ['A', ' CA ', 159.598, 124.051, 119.373], ['A', ' C ', 158.963, 124.659, 120.601], ['A', ' O ', 159.594, 124.712, 121.658], ['A', ' CB ', 159.563, 122.551, 119.487], ['A', ' CG ', 158.217, 121.924, 119.36], ['A', ' CD ', 158.323, 120.464, 119.287], ['A', ' NE ', 157.03, 119.829, 119.056], ['A', ' CZ ', 156.166, 119.433, 120.016], ['A', ' NH1', 156.433, 119.624, 121.293], ['A', ' NH2', 155.04, 118.842, 119.658], ['A', ' H ', 161.685, 123.939, 119.675], ['A', ' HA ', 159.05, 124.363, 118.48], ['A', ' HB ', 160.205, 122.139, 118.783], ['A', ' HB ', 159.947, 122.27, 120.463], ['A', ' HG ', 157.579, 122.203, 120.2], ['A', ' HG ', 157.78, 122.268, 118.428], ['A', ' HD ', 158.975, 120.204, 118.452], ['A', ' HD ', 158.754, 120.076, 120.205], ['A', ' HE ', 156.76, 119.651, 118.085], ['A', ' HH1', 157.29, 120.077, 121.573], ['A', ' HH1', 155.777, 119.32, 121.998], ['A', ' HH2', 154.843, 118.687, 118.669], ['A', ' HH2', 154.383, 118.527, 120.355]]
[['A', ' N ', 157.73, 125.104, 120.452], ['A', ' CA ', 156.919, 125.662, 121.508], ['A', ' C ', 156.434, 124.608, 122.488], ['A', ' O ', 156.179, 123.463, 122.125], ['A', ' CB ', 155.73, 126.353, 120.898], ['A', ' H ', 157.327, 125.06, 119.518], ['A', ' HA ', 157.524, 126.385, 122.055], ['A', ' HB ', 155.123, 126.804, 121.681], ['A', ' HB ', 156.07, 127.12, 120.21], ['A', ' HB ', 155.159, 125.611, 120.36]]
[['A', ' N ', 156.284, 125.011, 123.737], ['A', ' CA ', 155.735, 124.179, 124.806], ['A', ' C ', 154.234, 124.448, 124.911], ['A', ' O ', 153.839, 125.593, 125.144], ['A', ' CB ', 156.408, 124.475, 126.143], ['A', ' CG ', 155.974, 123.507, 127.24], ['A', ' OD1', 155.334, 122.526, 126.922], ['A', ' OD2', 156.295, 123.747, 128.382], ['A', ' H ', 156.547, 125.96, 123.962], ['A', ' HA ', 155.884, 123.129, 124.554], ['A', ' HB ', 157.491, 124.414, 126.027], ['A', ' HB ', 156.165, 125.489, 126.458]]
[['A', ' N ', 153.39, 123.469, 124.619], ['A', ' CA ', 151.958, 123.739, 124.609], ['A', ' C ', 151.08, 122.569, 125.021], ['A', ' O ', 151.507, 121.419, 125.034], ['A', ' CB ', 151.542, 124.165, 123.219], ['A', ' CG ', 151.753, 123.083, 122.257], ['A', ' CD1', 150.748, 122.181, 121.972], ['A', ' CD2', 152.971, 122.936, 121.652], ['A', ' CE1', 150.971, 121.155, 121.115], ['A', ' CE2', 153.195, 121.918, 120.799], ['A', ' CZ ', 152.199, 121.019, 120.531], ['A', ' H ', 153.745, 122.539, 124.437], ['A', ' HA ', 151.764, 124.558, 125.302], ['A', ' HB ', 150.488, 124.44, 123.209], ['A', ' HB ', 152.127, 125.032, 122.912], ['A', ' HD1', 149.773, 122.286, 122.446], ['A', ' HD2', 153.766, 123.644, 121.871], ['A', ' HE1', 150.177, 120.442, 120.899], ['A', ' HE2', 154.169, 121.811, 120.336], ['A', ' HZ ', 152.384, 120.197, 119.845]]
[['A', ' N ', 149.838, 122.911, 125.373], ['A', ' CA ', 148.758, 121.992, 125.734], ['A', ' C ', 147.792, 121.839, 124.558], ['A', ' O ', 147.184, 122.823, 124.132], ['A', ' CB ', 148.044, 122.491, 126.995], ['A', ' CG ', 146.983, 121.521, 127.588], ['A', ' OD1', 146.354, 120.749, 126.876], ['A', ' OD2', 146.831, 121.554, 128.799], ['A', ' H ', 149.613, 123.895, 125.366], ['A', ' HA ', 149.189, 121.011, 125.944], ['A', ' HB ', 148.787, 122.699, 127.767], ['A', ' HB ', 147.546, 123.435, 126.767]]
[['A', ' N ', 147.707, 120.637, 123.99], ['A', ' CA ', 146.902, 120.367, 122.797], ['A', ' C ', 145.392, 120.369, 123.038], ['A', ' O ', 144.595, 120.278, 122.094], ['A', ' CB ', 147.296, 119.036, 122.151], ['A', ' CG ', 146.876, 117.762, 122.915], ['A', ' CD ', 147.843, 117.353, 123.984], ['A', ' OE1', 148.55, 118.207, 124.468], ['A', ' OE2', 147.875, 116.198, 124.321], ['A', ' H ', 148.236, 119.862, 124.404], ['A', ' HA ', 147.111, 121.148, 122.09], ['A', ' HB ', 146.861, 118.979, 121.154], ['A', ' HB ', 148.378, 119.004, 122.031], ['A', ' HG ', 145.898, 117.898, 123.366], ['A', ' HG ', 146.789, 116.952, 122.192]]
[['A', ' N ', 144.967, 120.414, 124.286], ['A', ' CA ', 143.545, 120.365, 124.539], ['A', ' C ', 142.92, 121.725, 124.34], ['A', ' O ', 142.677, 122.457, 125.299], ['A', ' CB ', 143.256, 119.901, 125.945], ['A', ' CG ', 143.683, 118.488, 126.243], ['A', ' CD ', 143.484, 118.161, 127.667], ['A', ' NE ', 144.352, 118.974, 128.507], ['A', ' CZ ', 144.333, 119.024, 129.859], ['A', ' NH1', 143.487, 118.281, 130.565], ['A', ' NH2', 145.178, 119.832, 130.469], ['A', ' H ', 145.634, 120.509, 125.071], ['A', ' HA ', 143.098, 119.668, 123.846], ['A', ' HB ', 143.758, 120.567, 126.645], ['A', ' HB ', 142.185, 119.97, 126.134], ['A', ' HG ', 143.105, 117.792, 125.634], ['A', ' HG ', 144.748, 118.38, 126.014], ['A', ' HD ', 142.45, 118.357, 127.943], ['A', ' HD ', 143.723, 117.112, 127.836], ['A', ' HE ', 145.045, 119.582, 128.017], ['A', ' HH1', 142.841, 117.663, 130.099], ['A', ' HH1', 143.489, 118.334, 131.574], ['A', ' HH2', 145.825, 120.417, 129.895], ['A', ' HH2', 145.196, 119.899, 131.469]]
[['A', ' N ', 142.635, 122.035, 123.09], ['A', ' CA ', 142.105, 123.331, 122.725], ['A', ' C ', 140.641, 123.468, 123.093], ['A', ' O ', 139.96, 122.495, 123.463], ['A', ' H ', 142.929, 121.364, 122.383], ['A', ' HA ', 142.687, 124.117, 123.208], ['A', ' HA ', 142.208, 123.468, 121.649]]
[['A', ' N ', 140.137, 124.694, 122.941], ['A', ' CA ', 138.748, 125.009, 123.244], ['A', ' C ', 137.927, 125.144, 121.983], ['A', ' O ', 136.699, 125.182, 122.026], ['A', ' CB ', 138.666, 126.327, 124.013], ['A', ' OG1', 139.183, 127.382, 123.186], ['A', ' CG2', 139.5, 126.225, 125.273], ['A', ' H ', 140.751, 125.445, 122.65], ['A', ' HA ', 138.326, 124.204, 123.847], ['A', ' HB ', 137.63, 126.542, 124.272], ['A', ' HG1', 138.514, 127.626, 122.519], ['A', ' HG2', 139.447, 127.167, 125.818], ['A', ' HG2', 139.113, 125.42, 125.897], ['A', ' HG2', 140.536, 126.016, 125.02]]
[['A', ' N ', 138.628, 125.288, 120.876], ['A', ' CA ', 138.065, 125.435, 119.552], ['A', ' C ', 137.934, 126.889, 119.118], ['A', ' O ', 137.233, 127.67, 119.76], ['A', ' H ', 139.629, 125.221, 120.96], ['A', ' HA ', 138.705, 124.897, 118.857], ['A', ' HA ', 137.087, 124.955, 119.519]]
[['A', ' N ', 138.577, 127.271, 118.011], ['A', ' CA ', 138.417, 128.637, 117.533], ['A', ' C ', 138.587, 128.806, 116.02], ['A', ' O ', 138.813, 129.925, 115.572], ['A', ' CB ', 139.351, 129.601, 118.265], ['A', ' CG ', 140.817, 129.426, 117.987], ['A', ' CD ', 141.664, 130.526, 118.656], ['A', ' CE ', 141.964, 130.226, 120.13], ['A', ' NZ ', 142.846, 131.274, 120.759], ['A', ' H ', 139.189, 126.635, 117.532], ['A', ' HA ', 137.397, 128.947, 117.765], ['A', ' HB ', 139.083, 130.624, 118.003], ['A', ' HB ', 139.198, 129.493, 119.336], ['A', ' HG ', 141.127, 128.463, 118.387], ['A', ' HG ', 141.01, 129.441, 116.913], ['A', ' HD ', 142.615, 130.612, 118.122], ['A', ' HD ', 141.147, 131.478, 118.587], ['A', ' HE ', 141.039, 130.163, 120.694], ['A', ' HE ', 142.483, 129.267, 120.187], ['A', ' HZ ', 143.082, 131.024, 121.732], ['A', ' HZ ', 143.754, 131.344, 120.288], ['A', ' HZ ', 142.409, 132.168, 120.742]]
[['A', ' N ', 138.526, 127.723, 115.234], ['A', ' CA ', 138.711, 127.835, 113.78], ['A', ' C ', 139.949, 128.628, 113.42], ['A', ' O ', 139.857, 129.721, 112.859], ['A', ' CB ', 137.486, 128.47, 113.131], ['A', ' CG ', 136.162, 127.708, 113.286], ['A', ' CD1', 135.043, 128.575, 112.766], ['A', ' CD2', 136.19, 126.385, 112.471], ['A', ' H ', 138.322, 126.823, 115.626], ['A', ' HA ', 138.848, 126.836, 113.378], ['A', ' HB ', 137.349, 129.469, 113.54], ['A', ' HB ', 137.682, 128.571, 112.087], ['A', ' HG ', 135.993, 127.495, 114.337], ['A', ' HD1', 134.094, 128.053, 112.877], ['A', ' HD1', 135.013, 129.506, 113.332], ['A', ' HD1', 135.216, 128.797, 111.712], ['A', ' HD2', 135.244, 125.864, 112.591], ['A', ' HD2', 136.331, 126.597, 111.436], ['A', ' HD2', 136.971, 125.751, 112.786]]
[['A', ' N ', 141.099, 128.112, 113.822], ['A', ' CA ', 142.349, 128.798, 113.618], ['A', ' C ', 142.637, 128.82, 112.147], ['A', ' O ', 142.347, 127.857, 111.436], ['A', ' H ', 141.087, 127.181, 114.218], ['A', ' HA ', 142.281, 129.811, 114.009], ['A', ' HA ', 143.147, 128.285, 114.146]]
[['A', ' N ', 143.241, 129.896, 111.682], ['A', ' CA ', 143.546, 130.027, 110.266], ['A', ' C ', 145.013, 130.215, 110.032], ['A', ' O ', 145.624, 131.128, 110.584], ['A', ' CB ', 142.833, 131.245, 109.671], ['A', ' CG1', 141.342, 131.104, 109.872], ['A', ' CG2', 143.163, 131.33, 108.143], ['A', ' CD1', 140.573, 132.373, 109.639], ['A', ' H ', 143.487, 130.634, 112.36], ['A', ' HA ', 143.228, 129.125, 109.745], ['A', ' HB ', 143.159, 132.151, 110.179], ['A', ' HG1', 140.992, 130.336, 109.204], ['A', ' HG1', 141.133, 130.791, 110.889], ['A', ' HG2', 142.667, 132.178, 107.69], ['A', ' HG2', 144.233, 131.444, 107.983], ['A', ' HG2', 142.825, 130.413, 107.653], ['A', ' HD1', 139.51, 132.187, 109.799], ['A', ' HD1', 140.915, 133.13, 110.344], ['A', ' HD1', 140.721, 132.731, 108.642]]
[['A', ' N ', 145.568, 129.407, 109.161], ['A', ' CA ', 146.961, 129.569, 108.82], ['A', ' C ', 147.081, 129.557, 107.325], ['A', ' O ', 146.361, 128.819, 106.652], ['A', ' H ', 144.991, 128.677, 108.727], ['A', ' HA ', 147.355, 130.501, 109.227], ['A', ' HA ', 147.53, 128.743, 109.238]]
[['A', ' N ', 148.015, 130.308, 106.768], ['A', ' CA ', 148.103, 130.247, 105.334], ['A', ' C ', 149.502, 130.454, 104.84], ['A', ' O ', 150.251, 131.289, 105.336], ['A', ' CB ', 147.179, 131.263, 104.729], ['A', ' H ', 148.621, 130.912, 107.309], ['A', ' HA ', 147.798, 129.257, 105.037], ['A', ' HB ', 147.229, 131.155, 103.66], ['A', ' HB ', 146.166, 131.084, 105.069], ['A', ' HB ', 147.487, 132.265, 105.021]]
[['A', ' N ', 149.844, 129.691, 103.834], ['A', ' CA ', 151.161, 129.75, 103.269], ['A', ' C ', 151.218, 130.141, 101.817], ['A', ' O ', 150.517, 129.618, 100.952], ['A', ' CB ', 151.866, 128.406, 103.472], ['A', ' CG1', 151.927, 128.041, 104.98], ['A', ' CG2', 153.251, 128.444, 102.869], ['A', ' CD1', 152.762, 128.932, 105.897], ['A', ' H ', 149.15, 129.019, 103.493], ['A', ' HA ', 151.719, 130.502, 103.814], ['A', ' HB ', 151.289, 127.61, 102.992], ['A', ' HG1', 150.92, 128.05, 105.369], ['A', ' HG1', 152.301, 127.036, 105.048], ['A', ' HG2', 153.721, 127.509, 103.031], ['A', ' HG2', 153.216, 128.624, 101.806], ['A', ' HG2', 153.833, 129.22, 103.336], ['A', ' HD1', 152.695, 128.541, 106.917], ['A', ' HD1', 153.798, 128.923, 105.587], ['A', ' HD1', 152.395, 129.956, 105.896]]
[['A', ' N ', 152.13, 131.033, 101.518], ['A', ' CA ', 152.316, 131.404, 100.133], ['A', ' C ', 153.194, 130.375, 99.457], ['A', ' O ', 154.426, 130.497, 99.404], ['A', ' CB ', 152.93, 132.772, 99.976], ['A', ' CG ', 152.099, 133.869, 100.412], ['A', ' CD ', 150.946, 134.17, 99.599], ['A', ' OE1', 150.726, 133.609, 98.558], ['A', ' OE2', 150.24, 135.037, 100.024], ['A', ' H ', 152.659, 131.454, 102.268], ['A', ' HA ', 151.349, 131.401, 99.631], ['A', ' HB ', 153.823, 132.825, 100.536], ['A', ' HB ', 153.202, 132.941, 98.946], ['A', ' HG ', 151.726, 133.628, 101.352], ['A', ' HG ', 152.72, 134.748, 100.507]]
[['A', ' N ', 152.5, 129.321, 99.052], ['A', ' CA ', 152.935, 128.12, 98.354], ['A', ' C ', 153.33, 128.527, 96.937], ['A', ' O ', 152.829, 129.531, 96.428], ['A', ' CB ', 151.796, 127.097, 98.364], ['A', ' H ', 151.518, 129.395, 99.327], ['A', ' HA ', 153.802, 127.719, 98.872], ['A', ' HB ', 152.026, 126.175, 97.889], ['A', ' HB ', 151.523, 126.895, 99.379], ['A', ' HB ', 150.962, 127.491, 97.879]]
[['A', ' N ', 154.162, 127.777, 96.215], ['A', ' CA ', 154.606, 128.107, 94.875], ['A', ' C ', 153.478, 128.153, 93.857], ['A', ' O ', 153.645, 128.678, 92.76], ['A', ' CB ', 155.579, 126.992, 94.569], ['A', ' CG ', 155.172, 125.865, 95.463], ['A', ' CD ', 154.654, 126.495, 96.702], ['A', ' HA ', 155.134, 129.074, 94.905], ['A', ' HB ', 155.517, 126.729, 93.5], ['A', ' HB ', 156.587, 127.345, 94.739], ['A', ' HG ', 154.436, 125.217, 94.966], ['A', ' HG ', 156.04, 125.226, 95.682], ['A', ' HD ', 153.881, 125.845, 97.028], ['A', ' HD ', 155.427, 126.61, 97.45]]
[['A', ' N ', 152.338, 127.569, 94.184], ['A', ' CA ', 151.234, 127.571, 93.258], ['A', ' C ', 150.171, 128.572, 93.673], ['A', ' O ', 149.135, 128.649, 93.022], ['A', ' CB ', 150.586, 126.197, 93.204], ['A', ' CG ', 151.509, 125.021, 92.912], ['A', ' CD ', 152.247, 125.165, 91.668], ['A', ' NE ', 153.085, 124.018, 91.391], ['A', ' CZ ', 152.756, 122.928, 90.667], ['A', ' NH1', 151.593, 122.78, 90.102], ['A', ' NH2', 153.657, 122.006, 90.489], ['A', ' H ', 152.214, 127.133, 95.084], ['A', ' HA ', 151.591, 127.847, 92.267], ['A', ' HB ', 150.118, 125.991, 94.159], ['A', ' HB ', 149.799, 126.192, 92.447], ['A', ' HG ', 152.232, 124.918, 93.717], ['A', ' HG ', 150.911, 124.115, 92.845], ['A', ' HD ', 151.579, 125.319, 90.85], ['A', ' HD ', 152.907, 126.022, 91.741], ['A', ' HE ', 154.02, 124.045, 91.76], ['A', ' HH1', 150.89, 123.516, 90.151], ['A', ' HH1', 151.416, 121.961, 89.538], ['A', ' HH2', 154.585, 122.133, 90.865], ['A', ' HH2', 153.447, 121.202, 89.919]]
[['A', ' N ', 150.416, 129.341, 94.737], ['A', ' CA ', 149.431, 130.296, 95.248], ['A', ' C ', 149.095, 130.061, 96.719], ['A', ' O ', 149.503, 129.072, 97.299], ['A', ' H ', 151.321, 129.276, 95.202], ['A', ' HA ', 149.826, 131.306, 95.134], ['A', ' HA ', 148.536, 130.24, 94.644]]
[['A', ' N ', 148.343, 130.961, 97.34], ['A', ' CA ', 148.067, 130.872, 98.767], ['A', ' C ', 147.3, 129.63, 99.204], ['A', ' O ', 146.169, 129.394, 98.791], ['A', ' CB ', 147.23, 132.094, 99.151], ['A', ' CG ', 146.917, 132.306, 100.619], ['A', ' CD1', 148.198, 132.656, 101.376], ['A', ' CD2', 145.872, 133.411, 100.742], ['A', ' H ', 148.001, 131.76, 96.832], ['A', ' HA ', 149.023, 130.888, 99.283], ['A', ' HB ', 147.755, 132.986, 98.799], ['A', ' HB ', 146.278, 132.035, 98.622], ['A', ' HG ', 146.532, 131.398, 101.044], ['A', ' HD1', 147.982, 132.827, 102.418], ['A', ' HD1', 148.925, 131.866, 101.294], ['A', ' HD1', 148.599, 133.556, 100.962], ['A', ' HD2', 145.636, 133.562, 101.794], ['A', ' HD2', 146.26, 134.34, 100.316], ['A', ' HD2', 144.967, 133.115, 100.21]]
[['A', ' N ', 147.915, 128.893, 100.122], ['A', ' CA ', 147.451, 127.647, 100.728], ['A', ' C ', 146.854, 127.913, 102.107], ['A', ' O ', 147.602, 128.121, 103.061], ['A', ' CB ', 148.67, 126.686, 100.785], ['A', ' CG ', 148.428, 125.285, 101.328], ['A', ' OD1', 147.451, 125.097, 101.932], ['A', ' OD2', 149.185, 124.385, 101.069], ['A', ' H ', 148.846, 129.204, 100.378], ['A', ' HA ', 146.684, 127.222, 100.106], ['A', ' HB ', 149.062, 126.583, 99.77], ['A', ' HB ', 149.459, 127.148, 101.373]]
[['A', ' N ', 145.522, 127.973, 102.221], ['A', ' CA ', 144.889, 128.359, 103.485], ['A', ' C ', 144.225, 127.197, 104.204], ['A', ' O ', 143.281, 126.594, 103.698], ['A', ' CB ', 143.763, 129.375, 103.225], ['A', ' CG1', 143.12, 129.803, 104.553], ['A', ' CG2', 144.264, 130.533, 102.425], ['A', ' H ', 144.932, 127.778, 101.409], ['A', ' HA ', 145.641, 128.787, 104.14], ['A', ' HB ', 143.0, 128.889, 102.661], ['A', ' HG1', 142.316, 130.48, 104.352], ['A', ' HG1', 142.723, 128.946, 105.089], ['A', ' HG1', 143.864, 130.299, 105.174], ['A', ' HG2', 143.448, 131.215, 102.22], ['A', ' HG2', 145.025, 131.05, 102.962], ['A', ' HG2', 144.663, 130.168, 101.48]]
[['A', ' N ', 144.648, 126.901, 105.42], ['A', ' CA ', 144.019, 125.799, 106.13], ['A', ' C ', 143.34, 126.333, 107.359], ['A', ' O ', 143.856, 127.209, 108.06], ['A', ' CB ', 144.983, 124.711, 106.598], ['A', ' CG ', 145.729, 123.983, 105.553], ['A', ' ND1', 146.348, 122.777, 105.792], ['A', ' CD2', 146.024, 124.297, 104.294], ['A', ' CE1', 146.983, 122.401, 104.694], ['A', ' NE2', 146.794, 123.322, 103.797], ['A', ' H ', 145.406, 127.445, 105.837], ['A', ' HA ', 143.257, 125.327, 105.518], ['A', ' HB ', 145.703, 125.155, 107.263], ['A', ' HB ', 144.423, 123.982, 107.181], ['A', ' HD2', 145.761, 125.163, 103.731], ['A', ' HE1', 147.584, 121.497, 104.571], ['A', ' HE2', 147.173, 123.406, 102.846]]
[['A', ' N ', 142.188, 125.779, 107.645], ['A', ' CA ', 141.458, 126.119, 108.841], ['A', ' C ', 141.332, 124.904, 109.728], ['A', ' O ', 141.084, 123.798, 109.245], ['A', ' CB ', 140.1, 126.702, 108.496], ['A', ' CG ', 139.221, 127.01, 109.717], ['A', ' SD ', 137.666, 127.756, 109.284], ['A', ' CE ', 138.152, 129.43, 109.256], ['A', ' H ', 141.813, 125.076, 107.001], ['A', ' HA ', 142.018, 126.868, 109.38], ['A', ' HB ', 140.245, 127.62, 107.934], ['A', ' HB ', 139.565, 126.004, 107.847], ['A', ' HG ', 139.011, 126.105, 110.281], ['A', ' HG ', 139.761, 127.7, 110.377], ['A', ' HE ', 137.305, 130.061, 108.986], ['A', ' HE ', 138.529, 129.725, 110.24], ['A', ' HE ', 138.922, 129.538, 108.546]]
[['A', ' N ', 141.462, 125.097, 111.035], ['A', ' CA ', 141.312, 123.964, 111.928], ['A', ' C ', 140.691, 124.327, 113.264], ['A', ' O ', 140.922, 125.39, 113.85], ['A', ' CB ', 142.67, 123.337, 112.187], ['A', ' H ', 141.691, 126.036, 111.382], ['A', ' HA ', 140.666, 123.24, 111.442], ['A', ' HB ', 142.553, 122.46, 112.828], ['A', ' HB ', 143.122, 123.043, 111.251], ['A', ' HB ', 143.318, 124.066, 112.681]]
[['A', ' N ', 139.93, 123.402, 113.797], ['A', ' CA ', 139.371, 123.586, 115.113], ['A', ' C ', 139.688, 122.378, 115.94], ['A', ' O ', 139.297, 121.262, 115.594], ['A', ' CB ', 137.865, 123.781, 115.058], ['A', ' CG ', 137.233, 124.084, 116.358], ['A', ' CD ', 135.765, 124.5, 116.232], ['A', ' CE ', 134.839, 123.309, 116.026], ['A', ' NZ ', 133.4, 123.715, 116.059], ['A', ' H ', 139.759, 122.546, 113.262], ['A', ' HA ', 139.836, 124.447, 115.588], ['A', ' HB ', 137.623, 124.536, 114.367], ['A', ' HB ', 137.422, 122.86, 114.737], ['A', ' HG ', 137.305, 123.22, 117.02], ['A', ' HG ', 137.767, 124.895, 116.789], ['A', ' HD ', 135.463, 125.012, 117.152], ['A', ' HD ', 135.646, 125.189, 115.398], ['A', ' HE ', 135.049, 122.841, 115.066], ['A', ' HE ', 135.016, 122.583, 116.82], ['A', ' HZ ', 132.82, 122.899, 115.93], ['A', ' HZ ', 133.177, 124.145, 116.955], ['A', ' HZ ', 133.219, 124.378, 115.321]]
[['A', ' N ', 140.346, 122.606, 117.056], ['A', ' CA ', 140.729, 121.543, 117.954], ['A', ' C ', 140.027, 121.704, 119.271], ['A', ' O ', 140.095, 122.765, 119.89], ['A', ' CB ', 142.243, 121.553, 118.18], ['A', ' CG1', 142.632, 120.463, 119.182], ['A', ' CG2', 142.945, 121.329, 116.851], ['A', ' H ', 140.602, 123.554, 117.28], ['A', ' HA ', 140.435, 120.593, 117.522], ['A', ' HB ', 142.543, 122.516, 118.599], ['A', ' HG1', 143.702, 120.485, 119.339], ['A', ' HG1', 142.142, 120.627, 120.137], ['A', ' HG1', 142.344, 119.488, 118.796], ['A', ' HG2', 144.026, 121.342, 117.0], ['A', ' HG2', 142.642, 120.37, 116.461], ['A', ' HG2', 142.67, 122.106, 116.147]]
[['A', ' N ', 139.351, 120.652, 119.687], ['A', ' CA ', 138.646, 120.652, 120.949], ['A', ' C ', 138.948, 119.376, 121.699], ['A', ' O ', 138.844, 118.277, 121.159], ['A', ' CB ', 137.133, 120.739, 120.759], ['A', ' CG ', 136.625, 121.998, 120.069], ['A', ' CD ', 135.104, 122.024, 119.881], ['A', ' OE1', 134.48, 121.029, 120.16], ['A', ' OE2', 134.574, 123.032, 119.466], ['A', ' H ', 139.395, 119.809, 119.11], ['A', ' HA ', 138.976, 121.498, 121.541], ['A', ' HB ', 136.789, 119.87, 120.23], ['A', ' HB ', 136.661, 120.713, 121.741], ['A', ' HG ', 136.916, 122.841, 120.669], ['A', ' HG ', 137.107, 122.089, 119.103]]
[['A', ' N ', 139.3, 119.505, 122.958], ['A', ' CA ', 139.521, 118.348, 123.815], ['A', ' C ', 140.551, 117.362, 123.264], ['A', ' O ', 140.411, 116.152, 123.427], ['A', ' CB ', 138.209, 117.623, 124.04], ['A', ' CG ', 137.203, 118.486, 124.684], ['A', ' OD1', 137.492, 119.209, 125.646], ['A', ' ND2', 136.003, 118.445, 124.169], ['A', ' H ', 139.415, 120.457, 123.331], ['A', ' HA ', 139.898, 118.705, 124.775], ['A', ' HB ', 137.806, 117.237, 123.107], ['A', ' HB ', 138.384, 116.766, 124.688], ['A', ' HD2', 135.272, 119.01, 124.552], ['A', ' HD2', 135.816, 117.852, 123.384]]
[['A', ' N ', 141.588, 117.87, 122.62], ['A', ' CA ', 142.663, 117.032, 122.108], ['A', ' C ', 142.387, 116.397, 120.748], ['A', ' O ', 143.182, 115.579, 120.28], ['A', ' H ', 141.645, 118.872, 122.519], ['A', ' HA ', 143.571, 117.634, 122.039], ['A', ' HA ', 142.872, 116.246, 122.831]]
[['A', ' N ', 141.267, 116.73, 120.117], ['A', ' CA ', 140.936, 116.174, 118.812], ['A', ' C ', 140.564, 117.258, 117.832], ['A', ' O ', 140.01, 118.299, 118.19], ['A', ' CB ', 139.801, 115.162, 118.905], ['A', ' CG ', 140.074, 113.927, 119.758], ['A', ' CD ', 141.122, 113.011, 119.114], ['A', ' CE ', 141.25, 111.679, 119.84], ['A', ' NZ ', 141.747, 111.834, 121.243], ['A', ' H ', 140.595, 117.355, 120.57], ['A', ' HA ', 141.799, 115.675, 118.408], ['A', ' HB ', 138.939, 115.654, 119.341], ['A', ' HB ', 139.524, 114.838, 117.897], ['A', ' HG ', 140.419, 114.248, 120.741], ['A', ' HG ', 139.147, 113.374, 119.884], ['A', ' HD ', 140.866, 112.83, 118.067], ['A', ' HD ', 142.089, 113.491, 119.152], ['A', ' HE ', 140.279, 111.188, 119.861], ['A', ' HE ', 141.951, 111.053, 119.289], ['A', ' HZ ', 141.82, 110.924, 121.673], ['A', ' HZ ', 142.657, 112.279, 121.247], ['A', ' HZ ', 141.1, 112.399, 121.772]]
[['A', ' N ', 140.828, 117.012, 116.58], ['A', ' CA ', 140.415, 117.936, 115.567], ['A', ' C ', 138.923, 117.707, 115.39], ['A', ' O ', 138.446, 116.579, 115.419], ['A', ' CB ', 141.204, 117.699, 114.274], ['A', ' CG1', 142.698, 117.951, 114.546], ['A', ' CG2', 140.697, 118.629, 113.181], ['A', ' CD1', 143.609, 117.461, 113.467], ['A', ' H ', 141.299, 116.148, 116.303], ['A', ' HA ', 140.578, 118.956, 115.899], ['A', ' HB ', 141.094, 116.66, 113.96], ['A', ' HG1', 142.863, 119.01, 114.667], ['A', ' HG1', 142.978, 117.444, 115.469], ['A', ' HG2', 141.247, 118.46, 112.279], ['A', ' HG2', 139.648, 118.436, 112.989], ['A', ' HG2', 140.818, 119.667, 113.496], ['A', ' HD1', 144.637, 117.661, 113.744], ['A', ' HD1', 143.474, 116.375, 113.348], ['A', ' HD1', 143.398, 117.951, 112.53]]
[['A', ' N ', 138.159, 118.775, 115.382], ['A', ' CA ', 136.726, 118.671, 115.195], ['A', ' C ', 136.395, 119.135, 113.82], ['A', ' O ', 135.421, 118.705, 113.204], ['A', ' CB ', 135.99, 119.514, 116.207], ['A', ' CG ', 136.242, 119.104, 117.586], ['A', ' CD ', 135.797, 117.718, 117.836], ['A', ' OE1', 134.636, 117.38, 117.602], ['A', ' NE2', 136.697, 116.885, 118.293], ['A', ' H ', 138.604, 119.678, 115.435], ['A', ' HA ', 136.42, 117.63, 115.283], ['A', ' HB ', 136.315, 120.549, 116.111], ['A', ' HB ', 134.92, 119.479, 116.017], ['A', ' HG ', 137.308, 119.184, 117.809], ['A', ' HG ', 135.669, 119.754, 118.227], ['A', ' HE2', 136.457, 115.931, 118.467], ['A', ' HE2', 137.638, 117.204, 118.455]]
[['A', ' N ', 137.227, 120.031, 113.345], ['A', ' CA ', 137.061, 120.595, 112.031], ['A', ' C ', 138.38, 120.816, 111.366], ['A', ' O ', 139.328, 121.301, 111.988], ['A', ' CB ', 136.364, 121.939, 112.092], ['A', ' CG ', 136.221, 122.558, 110.799], ['A', ' CD1', 135.166, 122.249, 110.004], ['A', ' CD2', 137.168, 123.456, 110.344], ['A', ' CE1', 135.039, 122.82, 108.785], ['A', ' CE2', 137.038, 124.016, 109.123], ['A', ' CZ ', 135.971, 123.702, 108.348], ['A', ' H ', 137.972, 120.355, 113.965], ['A', ' HA ', 136.478, 119.905, 111.419], ['A', ' HB ', 135.384, 121.833, 112.544], ['A', ' HB ', 136.931, 122.603, 112.682], ['A', ' HD1', 134.418, 121.537, 110.356], ['A', ' HD2', 138.03, 123.708, 110.969], ['A', ' HE1', 134.188, 122.57, 108.152], ['A', ' HE2', 137.779, 124.712, 108.753], ['A', ' HZ ', 135.866, 124.155, 107.37]]
[['A', ' N ', 138.44, 120.482, 110.105], ['A', ' CA ', 139.591, 120.779, 109.302], ['A', ' C ', 139.192, 120.865, 107.857], ['A', ' O ', 138.457, 120.011, 107.358], ['A', ' CB ', 140.69, 119.749, 109.501], ['A', ' CG ', 141.82, 119.964, 108.589], ['A', ' CD1', 142.793, 120.886, 108.863], ['A', ' CD2', 141.859, 119.243, 107.45], ['A', ' CE1', 143.806, 121.086, 107.97], ['A', ' CE2', 142.855, 119.429, 106.557], ['A', ' CZ ', 143.821, 120.347, 106.803], ['A', ' OH ', 144.801, 120.517, 105.88], ['A', ' H ', 137.645, 120.036, 109.664], ['A', ' HA ', 139.969, 121.75, 109.593], ['A', ' HB ', 141.063, 119.824, 110.509], ['A', ' HB ', 140.306, 118.745, 109.355], ['A', ' HD1', 142.747, 121.458, 109.775], ['A', ' HD2', 141.073, 118.519, 107.258], ['A', ' HE1', 144.582, 121.823, 108.172], ['A', ' HE2', 142.879, 118.848, 105.634], ['A', ' HH ', 145.332, 121.306, 106.085]]
[['A', ' N ', 139.675, 121.896, 107.186], ['A', ' CA ', 139.443, 122.056, 105.758], ['A', ' C ', 140.502, 122.939, 105.156], ['A', ' O ', 141.187, 123.671, 105.88], ['A', ' CB ', 138.093, 122.661, 105.476], ['A', ' OG ', 138.043, 123.989, 105.902], ['A', ' H ', 140.226, 122.591, 107.702], ['A', ' HA ', 139.495, 121.081, 105.288], ['A', ' HB ', 137.893, 122.607, 104.405], ['A', ' HB ', 137.322, 122.081, 105.981], ['A', ' HG ', 137.192, 124.321, 105.617]]
[['A', ' N ', 140.626, 122.942, 103.831], ['A', ' CA ', 141.593, 123.854, 103.259], ['A', ' C ', 141.172, 124.41, 101.894], ['A', ' O ', 140.51, 123.746, 101.103], ['A', ' CB ', 142.919, 123.138, 103.174], ['A', ' H ', 140.075, 122.3, 103.246], ['A', ' HA ', 141.686, 124.703, 103.928], ['A', ' HB ', 143.654, 123.823, 102.818], ['A', ' HB ', 143.21, 122.787, 104.166], ['A', ' HB ', 142.837, 122.289, 102.5]]
[['A', ' N ', 141.579, 125.659, 101.651], ['A', ' CA ', 141.384, 126.395, 100.404], ['A', ' C ', 142.757, 126.607, 99.851], ['A', ' O ', 143.483, 127.495, 100.304], ['A', ' CB ', 140.792, 127.763, 100.697], ['A', ' CG ', 139.575, 127.787, 101.541], ['A', ' CD1', 139.258, 129.244, 101.857], ['A', ' CD2', 138.451, 127.081, 100.824], ['A', ' H ', 142.113, 126.11, 102.392], ['A', ' HA ', 140.797, 125.811, 99.693], ['A', ' HB ', 141.529, 128.385, 101.152], ['A', ' HB ', 140.523, 128.211, 99.741], ['A', ' HG ', 139.764, 127.277, 102.486], ['A', ' HD1', 138.38, 129.295, 102.49], ['A', ' HD1', 140.103, 129.694, 102.379], ['A', ' HD1', 139.078, 129.78, 100.937], ['A', ' HD2', 137.552, 127.1, 101.44], ['A', ' HD2', 138.252, 127.569, 99.887], ['A', ' HD2', 138.715, 126.043, 100.632]]
[['A', ' N ', 143.12, 125.81, 98.902], ['A', ' CA ', 144.485, 125.757, 98.468], ['A', ' C ', 144.493, 126.153, 96.947], ['A', ' O ', 143.415, 126.274, 96.349], ['A', ' CB ', 144.962, 124.355, 98.958], ['A', ' CG1', 146.304, 124.095, 98.729], ['A', ' CG2', 144.705, 124.189, 100.391], ['A', ' H ', 142.424, 125.158, 98.524], ['A', ' HA ', 145.037, 126.506, 99.007], ['A', ' HB ', 144.417, 123.657, 98.472], ['A', ' HG1', 146.521, 123.096, 99.071], ['A', ' HG1', 146.499, 124.192, 97.713], ['A', ' HG1', 146.888, 124.778, 99.275], ['A', ' HG2', 145.015, 123.197, 100.7], ['A', ' HG2', 145.261, 124.933, 100.959], ['A', ' HG2', 143.677, 124.284, 100.586]]
[['A', ' N ', 145.615, 126.617, 96.343], ['A', ' CA ', 145.691, 127.116, 94.991], ['A', ' C ', 145.193, 126.339, 93.816], ['A', ' O ', 144.802, 126.952, 92.818], ['A', ' CB ', 147.183, 127.302, 94.832], ['A', ' CG ', 147.795, 126.556, 95.942], ['A', ' CD ', 146.864, 126.833, 97.011], ['A', ' HA ', 145.224, 128.089, 94.982], ['A', ' HB ', 147.5, 126.932, 93.846], ['A', ' HB ', 147.402, 128.351, 94.855], ['A', ' HG ', 147.905, 125.495, 95.705], ['A', ' HG ', 148.804, 126.941, 96.145], ['A', ' HD ', 147.062, 126.327, 97.867], ['A', ' HD ', 146.949, 127.887, 97.174]]
[['A', ' N ', 145.176, 125.035, 93.844], ['A', ' CA ', 144.67, 124.464, 92.622], ['A', ' C ', 143.204, 124.766, 92.432], ['A', ' O ', 142.798, 125.084, 91.309], ['A', ' CB ', 144.923, 122.978, 92.505], ['A', ' OG1', 146.349, 122.742, 92.46], ['A', ' CG2', 144.265, 122.441, 91.253], ['A', ' H ', 145.456, 124.457, 94.649], ['A', ' HA ', 145.203, 124.927, 91.792], ['A', ' HB ', 144.508, 122.485, 93.372], ['A', ' HG1', 146.747, 123.009, 93.321], ['A', ' HG2', 144.435, 121.401, 91.178], ['A', ' HG2', 143.202, 122.603, 91.293], ['A', ' HG2', 144.669, 122.941, 90.388]]
[['A', ' N ', 142.386, 124.675, 93.484], ['A', ' CA ', 140.987, 124.885, 93.212], ['A', ' C ', 140.676, 126.349, 93.208], ['A', ' O ', 139.683, 126.753, 92.613], ['A', ' CB ', 140.057, 124.177, 94.177], ['A', ' OG1', 140.169, 124.726, 95.471], ['A', ' CG2', 140.371, 122.703, 94.202], ['A', ' H ', 142.706, 124.436, 94.431], ['A', ' HA ', 140.765, 124.498, 92.22], ['A', ' HB ', 139.049, 124.314, 93.84], ['A', ' HG1', 141.067, 124.594, 95.817], ['A', ' HG2', 139.689, 122.213, 94.89], ['A', ' HG2', 140.258, 122.305, 93.201], ['A', ' HG2', 141.385, 122.537, 94.524]]
[['A', ' N ', 141.542, 127.185, 93.782], ['A', ' CA ', 141.276, 128.603, 93.635], ['A', ' C ', 141.335, 128.925, 92.139], ['A', ' O ', 140.512, 129.688, 91.638], ['A', ' CB ', 142.322, 129.479, 94.323], ['A', ' CG ', 142.219, 129.702, 95.812], ['A', ' CD1', 143.054, 129.257, 96.764], ['A', ' CD2', 141.259, 130.478, 96.493], ['A', ' NE1', 142.658, 129.671, 97.978], ['A', ' CE2', 141.571, 130.414, 97.844], ['A', ' CE3', 140.186, 131.209, 96.09], ['A', ' CZ2', 140.842, 131.051, 98.779], ['A', ' CZ3', 139.447, 131.843, 97.035], ['A', ' CH2', 139.77, 131.77, 98.349], ['A', ' H ', 142.317, 126.832, 94.356], ['A', ' HA ', 140.284, 128.833, 94.021], ['A', ' HB ', 143.262, 129.008, 94.142], ['A', ' HB ', 142.352, 130.456, 93.832], ['A', ' HD1', 143.907, 128.672, 96.6], ['A', ' HE1', 143.132, 129.455, 98.868], ['A', ' HE3', 139.919, 131.272, 95.034], ['A', ' HZ2', 141.097, 131.0, 99.836], ['A', ' HZ3', 138.593, 132.401, 96.698], ['A', ' HH2', 139.175, 132.292, 99.072]]
[['A', ' N ', 142.309, 128.332, 91.43], ['A', ' CA ', 142.482, 128.573, 90.004], ['A', ' C ', 141.578, 127.8, 89.037], ['A', ' O ', 141.227, 128.342, 87.988], ['A', ' CB ', 143.926, 128.378, 89.636], ['A', ' CG ', 144.755, 129.504, 90.121], ['A', ' OD1', 144.266, 130.634, 90.257], ['A', ' ND2', 145.984, 129.255, 90.384], ['A', ' H ', 142.995, 127.749, 91.924], ['A', ' HA ', 142.252, 129.625, 89.838], ['A', ' HB ', 144.289, 127.448, 90.085], ['A', ' HB ', 144.032, 128.291, 88.557], ['A', ' HD2', 146.586, 130.006, 90.706], ['A', ' HD2', 146.363, 128.336, 90.28]]
[['A', ' N ', 141.115, 126.598, 89.365], ['A', ' CA ', 140.293, 125.877, 88.382], ['A', ' C ', 139.12, 126.669, 87.784], ['A', ' O ', 138.948, 126.627, 86.56], ['A', ' CB ', 139.848, 124.48, 88.875], ['A', ' CG1', 141.06, 123.537, 88.919], ['A', ' CG2', 138.76, 123.946, 87.988], ['A', ' CD1', 140.829, 122.234, 89.665], ['A', ' H ', 141.437, 126.15, 90.23], ['A', ' HA ', 140.918, 125.669, 87.543], ['A', ' HB ', 139.484, 124.534, 89.887], ['A', ' HG1', 141.339, 123.289, 87.9], ['A', ' HG1', 141.884, 124.054, 89.375], ['A', ' HG2', 138.45, 122.986, 88.337], ['A', ' HG2', 137.886, 124.593, 87.988], ['A', ' HG2', 139.135, 123.862, 86.975], ['A', ' HD1', 141.736, 121.64, 89.637], ['A', ' HD1', 140.573, 122.45, 90.699], ['A', ' HD1', 140.031, 121.667, 89.206]]
[['A', ' N ', 138.294, 127.373, 88.564], ['A', ' CA ', 137.174, 128.181, 88.128], ['A', ' C ', 137.584, 129.348, 87.226], ['A', ' O ', 136.739, 129.951, 86.569], ['A', ' CB ', 136.634, 128.712, 89.446], ['A', ' CG ', 137.13, 127.762, 90.455], ['A', ' CD ', 138.432, 127.35, 90.0], ['A', ' HA ', 136.435, 127.538, 87.627], ['A', ' HB ', 136.994, 129.724, 89.613], ['A', ' HB ', 135.539, 128.754, 89.424], ['A', ' HG ', 137.227, 128.249, 91.435], ['A', ' HG ', 136.446, 126.933, 90.563], ['A', ' HD ', 139.154, 128.085, 90.344], ['A', ' HD ', 138.609, 126.382, 90.405]]
[['A', ' N ', 138.87, 129.691, 87.218], ['A', ' CA ', 139.376, 130.783, 86.414], ['A', ' C ', 140.068, 130.236, 85.185], ['A', ' O ', 140.11, 130.89, 84.141], ['A', ' CB ', 140.378, 131.639, 87.222], ['A', ' OG1', 139.735, 132.142, 88.387], ['A', ' CG2', 140.872, 132.814, 86.406], ['A', ' H ', 139.556, 129.173, 87.755], ['A', ' HA ', 138.542, 131.404, 86.093], ['A', ' HB ', 141.229, 131.023, 87.525], ['A', ' HG1', 139.688, 131.434, 89.042], ['A', ' HG2', 141.551, 133.395, 87.01], ['A', ' HG2', 141.396, 132.473, 85.519], ['A', ' HG2', 140.03, 133.437, 86.113]]
[['A', ' N ', 140.627, 129.031, 85.293], ['A', ' CA ', 141.349, 128.453, 84.175], ['A', ' C ', 140.46, 128.05, 83.024], ['A', ' O ', 140.795, 128.292, 81.88], ['A', ' CB ', 142.127, 127.232, 84.611], ['A', ' CG ', 143.277, 127.54, 85.451], ['A', ' SD ', 144.355, 126.152, 85.708], ['A', ' CE ', 143.479, 125.214, 86.879], ['A', ' H ', 140.583, 128.54, 86.185], ['A', ' HA ', 142.049, 129.2, 83.806], ['A', ' HB ', 141.456, 126.58, 85.168], ['A', ' HB ', 142.467, 126.689, 83.759], ['A', ' HG ', 143.803, 128.309, 84.987], ['A', ' HG ', 142.952, 127.902, 86.399], ['A', ' HE ', 144.004, 124.322, 87.111], ['A', ' HE ', 143.337, 125.792, 87.781], ['A', ' HE ', 142.554, 124.948, 86.463]]
[['A', ' N ', 139.298, 127.484, 83.299], ['A', ' CA ', 138.44, 127.04, 82.194], ['A', ' C ', 138.231, 128.128, 81.141], ['A', ' O ', 138.649, 127.971, 79.99], ['A', ' H ', 139.057, 127.299, 84.281], ['A', ' HA ', 138.909, 126.192, 81.708], ['A', ' HA ', 137.493, 126.683, 82.578]]
[['A', ' N ', 137.642, 129.261, 81.52], ['A', ' CA ', 137.328, 130.407, 80.697], ['A', ' C ', 138.555, 131.097, 80.116], ['A', ' O ', 138.441, 131.946, 79.239], ['A', ' CB ', 136.625, 131.342, 81.674], ['A', ' CG ', 136.121, 130.457, 82.764], ['A', ' CD ', 137.148, 129.403, 82.901], ['A', ' HA ', 136.643, 130.086, 79.9], ['A', ' HB ', 137.332, 132.086, 82.043], ['A', ' HB ', 135.822, 131.886, 81.148], ['A', ' HG ', 135.99, 131.029, 83.699], ['A', ' HG ', 135.133, 130.05, 82.495], ['A', ' HD ', 137.924, 129.756, 83.561], ['A', ' HD ', 136.649, 128.516, 83.282]]
[['A', ' N ', 139.739, 130.766, 80.599], ['A', ' CA ', 140.951, 131.423, 80.166], ['A', ' C ', 141.306, 131.071, 78.744], ['A', ' O ', 142.155, 131.724, 78.13], ['A', ' CB ', 142.081, 131.039, 81.092], ['A', ' H ', 139.863, 129.995, 81.253], ['A', ' HA ', 140.782, 132.495, 80.219], ['A', ' HB ', 142.977, 131.571, 80.804], ['A', ' HB ', 141.831, 131.278, 82.107], ['A', ' HB ', 142.244, 129.979, 81.026]]
[['A', ' N ', 140.694, 130.02, 78.218], ['A', ' CA ', 140.997, 129.578, 76.876], ['A', ' C ', 140.088, 130.267, 75.841], ['A', ' O ', 140.306, 130.141, 74.63], ['A', ' CB ', 140.844, 128.056, 76.784], ['A', ' OG1', 139.48, 127.688, 76.959], ['A', ' CG2', 141.654, 127.413, 77.935], ['A', ' H ', 140.005, 129.488, 78.77], ['A', ' HA ', 142.031, 129.837, 76.65], ['A', ' HB ', 141.198, 127.705, 75.815], ['A', ' HG1', 139.361, 126.771, 76.694], ['A', ' HG2', 141.562, 126.333, 77.888], ['A', ' HG2', 142.688, 127.687, 77.842], ['A', ' HG2', 141.282, 127.759, 78.901]]
[['A', ' N ', 139.067, 130.973, 76.315], ['A', ' CA ', 138.076, 131.556, 75.428], ['A', ' C ', 138.674, 132.694, 74.611], ['A', ' O ', 139.464, 133.501, 75.1], ['A', ' CB ', 136.881, 132.029, 76.256], ['A', ' CG ', 136.115, 130.873, 76.925], ['A', ' CD ', 134.99, 131.316, 77.862], ['A', ' OE1', 134.795, 132.494, 78.001], ['A', ' OE2', 134.333, 130.455, 78.459], ['A', ' H ', 138.963, 131.119, 77.323], ['A', ' HA ', 137.734, 130.789, 74.736], ['A', ' HB ', 137.22, 132.713, 77.034], ['A', ' HB ', 136.184, 132.568, 75.615], ['A', ' HG ', 135.696, 130.27, 76.135], ['A', ' HG ', 136.818, 130.25, 77.471]]
[['A', ' N ', 138.263, 132.764, 73.352], ['A', ' CA ', 138.678, 133.785, 72.405], ['A', ' C ', 139.847, 133.338, 71.539], ['A', ' O ', 140.197, 134.006, 70.567], ['A', ' H ', 137.609, 132.06, 73.025], ['A', ' HA ', 137.833, 134.042, 71.766], ['A', ' HA ', 138.955, 134.686, 72.947]]
[['A', ' N ', 140.436, 132.196, 71.866], ['A', ' CA ', 141.581, 131.687, 71.134], ['A', ' C ', 141.386, 130.32, 70.537], ['A', ' O ', 140.519, 129.553, 70.95], ['A', ' CB ', 142.8, 131.715, 72.031], ['A', ' CG ', 143.207, 133.097, 72.321], ['A', ' CD1', 142.658, 133.809, 73.369], ['A', ' CD2', 144.149, 133.707, 71.524], ['A', ' CE1', 143.039, 135.098, 73.59], ['A', ' CE2', 144.528, 134.99, 71.757], ['A', ' CZ ', 143.974, 135.684, 72.778], ['A', ' H ', 140.118, 131.671, 72.689], ['A', ' HA ', 141.777, 132.369, 70.308], ['A', ' HB ', 142.568, 131.215, 72.976], ['A', ' HB ', 143.629, 131.183, 71.567], ['A', ' HD1', 141.906, 133.344, 74.017], ['A', ' HD2', 144.592, 133.155, 70.695], ['A', ' HE1', 142.6, 135.668, 74.417], ['A', ' HE2', 145.264, 135.477, 71.125], ['A', ' HZ ', 144.284, 136.717, 72.947]]
[['A', ' N ', 142.19, 130.012, 69.529], ['A', ' CA ', 142.121, 128.703, 68.909], ['A', ' C ', 142.359, 127.676, 69.99], ['A', ' O ', 143.259, 127.842, 70.818], ['A', ' CB ', 143.148, 128.567, 67.8], ['A', ' CG ', 142.968, 127.357, 66.981], ['A', ' ND1', 143.318, 126.099, 67.413], ['A', ' CD2', 142.489, 127.207, 65.731], ['A', ' CE1', 143.059, 125.227, 66.464], ['A', ' NE2', 142.558, 125.871, 65.429], ['A', ' H ', 142.864, 130.687, 69.198], ['A', ' HA ', 141.152, 128.519, 68.48], ['A', ' HB ', 143.092, 129.434, 67.144], ['A', ' HB ', 144.147, 128.541, 68.224], ['A', ' HD2', 142.122, 128.001, 65.079], ['A', ' HE1', 143.24, 124.155, 66.522], ['A', ' HE2', 142.273, 125.452, 64.551]]
[['A', ' N ', 141.592, 126.593, 69.96], ['A', ' CA ', 141.65, 125.558, 70.978], ['A', ' C ', 143.027, 124.973, 71.181], ['A', ' O ', 143.333, 124.527, 72.287], ['A', ' CB ', 140.673, 124.421, 70.701], ['A', ' CG ', 141.019, 123.555, 69.58], ['A', ' ND1', 141.83, 122.453, 69.727], ['A', ' CD2', 140.629, 123.565, 68.295], ['A', ' CE1', 141.939, 121.837, 68.574], ['A', ' NE2', 141.217, 122.488, 67.686], ['A', ' H ', 140.883, 126.516, 69.237], ['A', ' HA ', 141.358, 125.998, 71.928], ['A', ' HB ', 140.574, 123.806, 71.58], ['A', ' HB ', 139.7, 124.846, 70.499], ['A', ' HD2', 139.967, 124.282, 67.828], ['A', ' HE1', 142.52, 120.934, 68.387], ['A', ' HE2', 141.107, 122.234, 66.714]]
[['A', ' N ', 143.909, 125.031, 70.183], ['A', ' CA ', 145.248, 124.479, 70.344], ['A', ' C ', 146.019, 125.189, 71.449], ['A', ' O ', 147.017, 124.668, 71.942], ['A', ' CB ', 146.06, 124.575, 69.057], ['A', ' CG ', 146.488, 125.989, 68.653], ['A', ' CD ', 147.19, 125.997, 67.33], ['A', ' OE1', 147.626, 124.946, 66.918], ['A', ' OE2', 147.271, 127.027, 66.708], ['A', ' H ', 143.643, 125.407, 69.265], ['A', ' HA ', 145.15, 123.427, 70.614], ['A', ' HB ', 146.963, 123.974, 69.157], ['A', ' HB ', 145.48, 124.158, 68.236], ['A', ' HG ', 145.636, 126.65, 68.624], ['A', ' HG ', 147.176, 126.378, 69.402]]
[['A', ' N ', 145.586, 126.388, 71.831], ['A', ' CA ', 146.248, 127.135, 72.872], ['A', ' C ', 145.666, 126.844, 74.233], ['A', ' O ', 146.263, 127.179, 75.258], ['A', ' CB ', 146.148, 128.618, 72.616], ['A', ' CG ', 146.903, 129.066, 71.457], ['A', ' CD1', 146.245, 129.446, 70.325], ['A', ' CD2', 148.272, 129.084, 71.513], ['A', ' CE1', 146.959, 129.854, 69.236], ['A', ' CE2', 148.988, 129.485, 70.43], ['A', ' CZ ', 148.34, 129.87, 69.293], ['A', ' OH ', 149.067, 130.279, 68.201], ['A', ' H ', 144.753, 126.787, 71.39], ['A', ' HA ', 147.282, 126.844, 72.883], ['A', ' HB ', 145.1, 128.893, 72.474], ['A', ' HB ', 146.499, 129.13, 73.468], ['A', ' HD1', 145.159, 129.424, 70.289], ['A', ' HD2', 148.782, 128.776, 72.423], ['A', ' HE1', 146.442, 130.157, 68.327], ['A', ' HE2', 150.075, 129.503, 70.462], ['A', ' HH ', 150.006, 130.216, 68.395]]
[['A', ' N ', 144.526, 126.182, 74.266], ['A', ' CA ', 143.836, 125.89, 75.499], ['A', ' C ', 144.789, 125.276, 76.506], ['A', ' O ', 144.854, 125.726, 77.655], ['A', ' H ', 144.121, 125.829, 73.401], ['A', ' HA ', 143.444, 126.82, 75.89], ['A', ' HA ', 142.987, 125.238, 75.312]]
[['A', ' N ', 145.453, 124.169, 76.152], ['A', ' CA ', 146.412, 123.475, 76.964], ['A', ' C ', 147.607, 124.328, 77.388], ['A', ' O ', 148.254, 124.006, 78.376], ['A', ' CB ', 146.841, 122.328, 76.054], ['A', ' CG ', 145.674, 122.114, 75.138], ['A', ' CD ', 145.148, 123.475, 74.881], ['A', ' HA ', 145.901, 123.062, 77.837], ['A', ' HB ', 147.757, 122.611, 75.512], ['A', ' HB ', 147.079, 121.441, 76.657], ['A', ' HG ', 146.0, 121.607, 74.216], ['A', ' HG ', 144.932, 121.461, 75.617], ['A', ' HD ', 145.714, 123.895, 74.044], ['A', ' HD ', 144.074, 123.415, 74.674]]
[['A', ' N ', 147.939, 125.406, 76.667], ['A', ' CA ', 149.065, 126.219, 77.092], ['A', ' C ', 148.61, 127.097, 78.217], ['A', ' O ', 149.369, 127.406, 79.139], ['A', ' CB ', 149.604, 127.125, 75.983], ['A', ' CG ', 150.424, 126.465, 74.943], ['A', ' ND1', 151.679, 125.976, 75.206], ['A', ' CD2', 150.204, 126.233, 73.638], ['A', ' CE1', 152.19, 125.471, 74.105], ['A', ' NE2', 151.314, 125.612, 73.142], ['A', ' H ', 147.417, 125.725, 75.858], ['A', ' HA ', 149.875, 125.587, 77.45], ['A', ' HB ', 148.769, 127.621, 75.486], ['A', ' HB ', 150.205, 127.901, 76.443], ['A', ' HD2', 149.34, 126.482, 73.069], ['A', ' HE1', 153.169, 125.011, 74.007], ['A', ' HE2', 151.431, 125.316, 72.181]]
[['A', ' N ', 147.35, 127.484, 78.156], ['A', ' CA ', 146.82, 128.367, 79.157], ['A', ' C ', 146.685, 127.668, 80.478], ['A', ' O ', 147.157, 128.176, 81.497], ['A', ' CB ', 145.444, 128.876, 78.725], ['A', ' CG1', 144.816, 129.645, 79.785], ['A', ' CG2', 145.546, 129.734, 77.512], ['A', ' H ', 146.775, 127.185, 77.36], ['A', ' HA ', 147.501, 129.184, 79.288], ['A', ' HB ', 144.821, 128.029, 78.508], ['A', ' HG1', 143.87, 129.948, 79.397], ['A', ' HG1', 144.671, 129.05, 80.684], ['A', ' HG1', 145.423, 130.518, 80.023], ['A', ' HG2', 144.55, 130.063, 77.216], ['A', ' HG2', 146.134, 130.583, 77.736], ['A', ' HG2', 145.995, 129.18, 76.702]]
[['A', ' N ', 146.085, 126.487, 80.473], ['A', ' CA ', 145.917, 125.827, 81.751], ['A', ' C ', 147.268, 125.387, 82.292], ['A', ' O ', 147.489, 125.404, 83.497], ['A', ' CB ', 144.905, 124.659, 81.681], ['A', ' CG1', 145.411, 123.551, 80.75], ['A', ' CG2', 143.541, 125.206, 81.184], ['A', ' CD1', 144.636, 122.272, 80.783], ['A', ' H ', 145.723, 126.111, 79.589], ['A', ' HA ', 145.501, 126.549, 82.452], ['A', ' HB ', 144.781, 124.234, 82.681], ['A', ' HG1', 145.382, 123.943, 79.754], ['A', ' HG1', 146.423, 123.28, 80.993], ['A', ' HG2', 142.803, 124.42, 81.161], ['A', ' HG2', 143.205, 125.978, 81.846], ['A', ' HG2', 143.652, 125.625, 80.182], ['A', ' HD1', 145.074, 121.569, 80.075], ['A', ' HD1', 144.695, 121.856, 81.784], ['A', ' HD1', 143.608, 122.434, 80.523]]
[['A', ' N ', 148.197, 125.06, 81.405], ['A', ' CA ', 149.525, 124.658, 81.79], ['A', ' C ', 150.3, 125.806, 82.427], ['A', ' O ', 150.974, 125.613, 83.432], ['A', ' CB ', 150.209, 124.132, 80.568], ['A', ' CG ', 151.511, 123.548, 80.712], ['A', ' CD ', 152.036, 123.214, 79.361], ['A', ' NE ', 151.146, 122.3, 78.634], ['A', ' CZ ', 150.966, 122.287, 77.289], ['A', ' NH1', 151.599, 123.139, 76.515], ['A', ' NH2', 150.142, 121.403, 76.751], ['A', ' H ', 147.981, 125.04, 80.407], ['A', ' HA ', 149.434, 123.857, 82.514], ['A', ' HB ', 149.586, 123.337, 80.195], ['A', ' HB ', 150.258, 124.908, 79.808], ['A', ' HG ', 152.141, 124.275, 81.186], ['A', ' HG ', 151.465, 122.644, 81.312], ['A', ' HD ', 152.142, 124.134, 78.793], ['A', ' HD ', 153.012, 122.727, 79.45], ['A', ' HE ', 150.632, 121.623, 79.174], ['A', ' HH1', 152.239, 123.818, 76.918], ['A', ' HH1', 151.473, 123.108, 75.517], ['A', ' HH2', 149.639, 120.757, 77.34], ['A', ' HH2', 150.012, 121.379, 75.75]]
[['A', ' N ', 150.154, 127.026, 81.902], ['A', ' CA ', 150.843, 128.206, 82.434], ['A', ' C ', 150.504, 128.443, 83.9], ['A', ' O ', 151.366, 128.878, 84.674], ['A', ' CB ', 150.47, 129.431, 81.624], ['A', ' H ', 149.621, 127.136, 81.036], ['A', ' HA ', 151.914, 128.037, 82.354], ['A', ' HB ', 151.002, 130.301, 81.997], ['A', ' HB ', 150.736, 129.259, 80.584], ['A', ' HB ', 149.395, 129.601, 81.701]]
[['A', ' N ', 149.278, 128.114, 84.289], ['A', ' CA ', 148.84, 128.271, 85.669], ['A', ' C ', 149.501, 127.27, 86.603], ['A', ' O ', 149.57, 127.493, 87.816], ['A', ' CB ', 147.337, 128.135, 85.782], ['A', ' CG ', 146.569, 129.321, 85.381], ['A', ' CD1', 145.99, 129.383, 84.153], ['A', ' CD2', 146.414, 130.344, 86.267], ['A', ' CE1', 145.245, 130.473, 83.791], ['A', ' CE2', 145.684, 131.432, 85.921], ['A', ' CZ ', 145.093, 131.507, 84.693], ['A', ' OH ', 144.371, 132.622, 84.346], ['A', ' H ', 148.606, 127.813, 83.57], ['A', ' HA ', 149.12, 129.273, 85.995], ['A', ' HB ', 147.028, 127.32, 85.141], ['A', ' HB ', 147.062, 127.876, 86.804], ['A', ' HD1', 146.112, 128.565, 83.478], ['A', ' HD2', 146.877, 130.292, 87.253], ['A', ' HE1', 144.781, 130.516, 82.808], ['A', ' HE2', 145.572, 132.244, 86.626], ['A', ' HH ', 144.531, 133.348, 84.998]]
[['A', ' N ', 149.973, 126.168, 86.052], ['A', ' CA ', 150.602, 125.065, 86.754], ['A', ' C ', 149.772, 124.526, 87.918], ['A', ' O ', 150.145, 124.725, 89.072], ['A', ' CB ', 151.95, 125.495, 87.297], ['A', ' CG ', 152.951, 124.361, 87.533], ['A', ' OD1', 153.004, 123.414, 86.743], ['A', ' OD2', 153.751, 124.489, 88.43], ['A', ' H ', 149.97, 126.092, 85.035], ['A', ' HA ', 150.77, 124.268, 86.041], ['A', ' HB ', 152.383, 126.199, 86.607], ['A', ' HB ', 151.81, 126.008, 88.237]]
[['A', ' N ', 148.552, 124.054, 87.711], ['A', ' CA ', 147.742, 123.436, 88.725], ['A', ' C ', 148.271, 122.068, 89.079], ['A', ' O ', 148.939, 121.445, 88.267], ['A', ' CB ', 146.409, 123.36, 88.049], ['A', ' CG ', 146.753, 123.3, 86.576], ['A', ' CD ', 147.853, 124.259, 86.452], ['A', ' HA ', 147.702, 124.086, 89.615], ['A', ' HB ', 145.858, 122.539, 88.435], ['A', ' HB ', 145.853, 124.26, 88.316], ['A', ' HG ', 147.102, 122.296, 86.306], ['A', ' HG ', 145.9, 123.525, 85.928], ['A', ' HD ', 148.43, 124.085, 85.588], ['A', ' HD ', 147.416, 125.256, 86.43]]
[['A', ' N ', 147.959, 121.585, 90.273], ['A', ' CA ', 148.344, 120.24, 90.668], ['A', ' C ', 147.335, 119.179, 90.244], ['A', ' O ', 147.684, 118.034, 89.972], ['A', ' CB ', 148.573, 120.253, 92.13], ['A', ' SG ', 150.024, 121.162, 92.556], ['A', ' H ', 147.432, 122.145, 90.94], ['A', ' HA ', 149.294, 120.006, 90.19], ['A', ' HB ', 147.739, 120.701, 92.619], ['A', ' HB ', 148.637, 119.31, 92.486], ['A', ' HG ', 150.137, 120.684, 93.806]]
[['A', ' N ', 146.076, 119.567, 90.199], ['A', ' CA ', 144.946, 118.781, 89.697], ['A', ' C ', 144.767, 117.401, 90.299], ['A', ' O ', 143.859, 117.153, 91.097], ['A', ' CB ', 145.187, 118.616, 88.21], ['A', ' CG ', 145.326, 119.897, 87.458], ['A', ' CD1', 145.766, 119.575, 86.076], ['A', ' CD2', 144.036, 120.719, 87.502], ['A', ' H ', 145.899, 120.511, 90.494], ['A', ' HA ', 144.03, 119.331, 89.886], ['A', ' HB ', 146.099, 118.059, 88.035], ['A', ' HB ', 144.37, 118.038, 87.782], ['A', ' HG ', 146.122, 120.456, 87.893], ['A', ' HD1', 145.942, 120.472, 85.509], ['A', ' HD1', 146.691, 119.009, 86.121], ['A', ' HD1', 145.033, 118.999, 85.609], ['A', ' HD2', 144.213, 121.623, 86.967], ['A', ' HD2', 143.22, 120.184, 87.052], ['A', ' HD2', 143.771, 120.973, 88.512]]
[['A', ' N ', 145.674, 116.494, 89.952], ['A', ' CA ', 145.615, 115.122, 90.486], ['A', ' C ', 145.794, 115.093, 91.987], ['A', ' O ', 145.161, 114.296, 92.692], ['A', ' CB ', 146.721, 114.28, 89.917], ['A', ' OG ', 147.944, 114.716, 90.435], ['A', ' H ', 146.437, 116.784, 89.347], ['A', ' HA ', 144.662, 114.687, 90.245], ['A', ' HB ', 146.546, 113.244, 90.188], ['A', ' HB ', 146.734, 114.341, 88.858], ['A', ' HG ', 148.629, 114.201, 90.001]]
[['A', ' N ', 146.585, 116.052, 92.466], ['A', ' CA ', 146.938, 116.347, 93.8], ['A', ' C ', 146.474, 117.742, 93.935], ['A', ' O ', 147.183, 118.611, 94.441], ['A', ' CB ', 148.44, 116.089, 94.035], ['A', ' SG ', 149.745, 117.04, 93.045], ['A', ' H ', 147.061, 116.592, 91.72], ['A', ' HA ', 146.371, 115.724, 94.498], ['A', ' HB ', 148.58, 116.274, 94.995], ['A', ' HB ', 148.648, 115.023, 93.902]]
[['A', ' N ', 145.254, 117.997, 93.428], ['A', ' CA ', 144.808, 119.338, 93.503], ['A', ' C ', 145.069, 119.716, 94.878], ['A', ' O ', 144.567, 119.135, 95.845], ['A', ' CB ', 143.331, 119.501, 93.185], ['A', ' H ', 144.68, 117.281, 92.98], ['A', ' HA ', 145.413, 119.955, 92.851], ['A', ' HB ', 143.045, 120.54, 93.315], ['A', ' HB ', 143.128, 119.205, 92.171], ['A', ' HB ', 142.751, 118.88, 93.862]]
[['A', ' N ', 145.815, 120.75, 94.97], ['A', ' CA ', 146.169, 121.297, 96.208], ['A', ' C ', 144.94, 122.081, 96.527], ['A', ' O ', 144.927, 123.27, 96.193], ['A', ' CB ', 147.397, 122.179, 96.036], ['A', ' OG1', 147.117, 123.163, 95.003], ['A', ' CG2', 148.553, 121.352, 95.686], ['A', ' H ', 146.197, 121.161, 94.135], ['A', ' HA ', 146.358, 120.515, 96.943], ['A', ' HB ', 147.646, 122.655, 96.914], ['A', ' HG1', 146.34, 123.718, 95.298], ['A', ' HG2', 149.397, 121.984, 95.566], ['A', ' HG2', 148.73, 120.643, 96.473], ['A', ' HG2', 148.354, 120.829, 94.802]]
[['A', ' N ', 143.889, 121.364, 97.052], ['A', ' CA ', 142.487, 121.735, 97.354], ['A', ' C ', 142.158, 123.233, 97.22], ['A', ' O ', 142.44, 123.842, 96.187], ['A', ' OXT', 141.379, 123.775, 97.997], ['A', ' CB ', 142.072, 121.169, 98.769], ['A', ' CG ', 142.089, 119.613, 98.853], ['A', ' ND1', 141.222, 118.823, 98.127], ['A', ' CD2', 142.871, 118.758, 99.563], ['A', ' CE1', 141.478, 117.548, 98.386], ['A', ' NE2', 142.472, 117.485, 99.255], ['A', ' H ', 144.122, 120.38, 97.205], ['A', ' HA ', 141.858, 121.237, 96.623], ['A', ' HB ', 142.734, 121.579, 99.544], ['A', ' HB ', 141.056, 121.498, 99.029], ['A', ' HD2', 143.666, 119.031, 100.247], ['A', ' HE1', 140.956, 116.694, 97.954], ['A', ' HE2', 142.876, 116.647, 99.627]]
[['A', ' N ', 127.544, 122.825, 67.273], ['A', ' CA ', 128.994, 123.016, 67.42], ['A', ' C ', 129.617, 121.873, 68.259], ['A', ' O ', 129.011, 121.45, 69.25], ['A', ' CB ', 129.267, 124.383, 68.057], ['A', ' OG ', 128.845, 125.399, 67.21], ['A', ' H ', 127.098, 123.727, 67.158], ['A', ' H ', 127.352, 122.249, 66.465], ['A', ' H ', 127.181, 122.372, 68.105], ['A', ' HA ', 129.436, 123.02, 66.413], ['A', ' HB ', 128.761, 124.484, 69.023], ['A', ' HB ', 130.323, 124.508, 68.246], ['A', ' HG ', 129.091, 126.253, 67.664]] AA_SCO= 1.807 CA_SCO= 1.7503
[['A', ' N ', 130.795, 121.37, 67.827], ['A', ' CA ', 131.571, 120.307, 68.471], ['A', ' C ', 132.375, 120.817, 69.654], ['A', ' O ', 132.625, 122.024, 69.788], ['A', ' CB ', 132.495, 119.604, 67.466], ['A', ' CG ', 133.727, 120.383, 66.989], ['A', ' CD ', 133.436, 121.33, 65.849], ['A', ' OE1', 132.292, 121.71, 65.676], ['A', ' OE2', 134.352, 121.649, 65.132], ['A', ' H ', 131.204, 121.768, 66.976], ['A', ' HA ', 130.883, 119.548, 68.851], ['A', ' HB ', 132.854, 118.674, 67.906], ['A', ' HB ', 131.918, 119.338, 66.581], ['A', ' HG ', 134.15, 120.949, 67.817], ['A', ' HG ', 134.48, 119.667, 66.669]] AA_SCO= 1.8790909090909091 CA_SCO= 1.7658181818181817
[['A', ' N ', 132.733, 119.889, 70.531], ['A', ' CA ', 133.551, 120.243, 71.657], ['A', ' C ', 134.856, 119.518, 71.576], ['A', ' O ', 134.924, 118.36, 71.162], ['A', ' CB ', 132.883, 119.874, 72.966], ['A', ' CG ', 131.593, 120.562, 73.174], ['A', ' CD ', 131.104, 120.476, 74.566], ['A', ' NE ', 130.777, 119.116, 74.963], ['A', ' CZ ', 130.241, 118.767, 76.159], ['A', ' NH1', 129.967, 119.68, 77.076], ['A', ' NH2', 129.97, 117.5, 76.41], ['A', ' H ', 132.468, 118.925, 70.383], ['A', ' HA ', 133.743, 121.312, 71.635], ['A', ' HB ', 132.72, 118.8, 73.009], ['A', ' HB ', 133.542, 120.143, 73.796], ['A', ' HG ', 131.708, 121.592, 72.881], ['A', ' HG ', 130.844, 120.101, 72.533], ['A', ' HD ', 131.871, 120.858, 75.233], ['A', ' HD ', 130.206, 121.089, 74.66], ['A', ' HE ', 130.955, 118.376, 74.297], ['A', ' HH1', 130.155, 120.654, 76.907], ['A', ' HH1', 129.514, 119.399, 77.971], ['A', ' HH2', 130.164, 116.792, 75.719], ['A', ' HH2', 129.553, 117.24, 77.303]] AA_SCO= 1.9341666666666668 CA_SCO= 1.779
[['A', ' N ', 135.881, 120.19, 72.019], ['A', ' CA ', 137.185, 119.614, 72.084], ['A', ' C ', 137.364, 119.197, 73.511], ['A', ' O ', 137.375, 120.035, 74.413], ['A', ' CB ', 138.248, 120.66, 71.717], ['A', ' CG1', 137.916, 121.32, 70.348], ['A', ' CG2', 139.654, 120.052, 71.752], ['A', ' CD1', 137.797, 120.398, 69.16], ['A', ' H ', 135.723, 121.146, 72.33], ['A', ' HA ', 137.251, 118.736, 71.445], ['A', ' HB ', 138.204, 121.449, 72.441], ['A', ' HG1', 136.976, 121.855, 70.45], ['A', ' HG1', 138.69, 122.039, 70.13], ['A', ' HG2', 140.387, 120.824, 71.522], ['A', ' HG2', 139.857, 119.655, 72.745], ['A', ' HG2', 139.738, 119.251, 71.026], ['A', ' HD1', 137.565, 120.99, 68.275], ['A', ' HD1', 138.734, 119.872, 68.998], ['A', ' HD1', 136.997, 119.678, 69.322]] AA_SCO= 1.8053846153846156 CA_SCO= 1.5698461538461537
[['A', ' N ', 137.46, 117.908, 73.743], ['A', ' CA ', 137.566, 117.456, 75.108], ['A', ' C ', 138.841, 116.702, 75.312], ['A', ' O ', 139.079, 115.675, 74.676], ['A', ' CB ', 136.363, 116.589, 75.468], ['A', ' CG1', 136.505, 116.092, 76.898], ['A', ' CG2', 135.096, 117.431, 75.291], ['A', ' H ', 137.453, 117.251, 72.972], ['A', ' HA ', 137.574, 118.315, 75.773], ['A', ' HB ', 136.32, 115.719, 74.816], ['A', ' HG1', 135.644, 115.482, 77.165], ['A', ' HG1', 137.405, 115.491, 77.011], ['A', ' HG1', 136.562, 116.937, 77.572], ['A', ' HG2', 134.222, 116.839, 75.548], ['A', ' HG2', 135.164, 118.282, 75.941], ['A', ' HG2', 135.009, 117.767, 74.261]] AA_SCO= 1.8585714285714288 CA_SCO= 1.2844999999999998
[['A', ' N ', 139.65, 117.202, 76.219], ['A', ' CA ', 140.914, 116.571, 76.476], ['A', ' C ', 140.932, 116.02, 77.896], ['A', ' O ', 141.005, 116.783, 78.859], ['A', ' CB ', 142.036, 117.603, 76.288], ['A', ' CG1', 141.951, 118.21, 74.854], ['A', ' CG2', 143.374, 116.905, 76.485], ['A', ' CD1', 142.826, 119.429, 74.617], ['A', ' H ', 139.36, 118.057, 76.706], ['A', ' HA ', 141.059, 115.748, 75.781], ['A', ' HB ', 141.925, 118.407, 77.01], ['A', ' HG1', 142.222, 117.439, 74.134], ['A', ' HG1', 140.931, 118.516, 74.661], ['A', ' HG2', 144.195, 117.599, 76.371], ['A', ' HG2', 143.407, 116.494, 77.466], ['A', ' HG2', 143.482, 116.103, 75.756], ['A', ' HD1', 142.685, 119.783, 73.592], ['A', ' HD1', 142.539, 120.219, 75.311], ['A', ' HD1', 143.871, 119.184, 74.763]] AA_SCO= 1.9393333333333336 CA_SCO= 1.3127999999999997
[['A', ' N ', 140.85, 114.693, 78.0], ['A', ' CA ', 140.862, 113.947, 79.265], ['A', ' C ', 142.196, 114.029, 80.048], ['A', ' O ', 142.173, 114.069, 81.275], ['A', ' CB ', 140.426, 112.512, 79.035], ['A', ' OG ', 140.479, 111.778, 80.218], ['A', ' H ', 140.768, 114.171, 77.138], ['A', ' HA ', 140.098, 114.392, 79.905], ['A', ' HB ', 139.396, 112.525, 78.679], ['A', ' HB ', 141.003, 112.027, 78.274], ['A', ' HG ', 140.159, 110.905, 80.001]] AA_SCO= 1.885625 CA_SCO= 1.3483749999999999
[['A', ' N ', 143.373, 113.834, 79.412], ['A', ' CA ', 144.68, 113.981, 80.009], ['A', ' C ', 144.985, 115.456, 80.201], ['A', ' O ', 144.4, 116.3, 79.542], ['A', ' CB ', 145.575, 113.3, 78.998], ['A', ' CG ', 144.863, 113.435, 77.719], ['A', ' CD ', 143.447, 113.346, 78.018], ['A', ' HA ', 144.698, 113.457, 80.976], ['A', ' HB ', 146.543, 113.808, 78.971], ['A', ' HB ', 145.752, 112.253, 79.286], ['A', ' HG ', 145.132, 114.371, 77.219], ['A', ' HG ', 145.133, 112.623, 77.075], ['A', ' HD ', 143.022, 113.986, 77.283], ['A', ' HD ', 143.137, 112.308, 77.926]] AA_SCO= 1.8947058823529412 CA_SCO= 1.384470588235294
[['A', ' N ', 145.943, 115.772, 81.051], ['A', ' CA ', 146.312, 117.158, 81.303], ['A', ' C ', 147.663, 117.529, 80.738], ['A', ' O ', 148.175, 118.611, 81.025], ['A', ' CB ', 146.396, 117.406, 82.801], ['A', ' OG1', 147.417, 116.598, 83.36], ['A', ' CG2', 145.152, 116.996, 83.393], ['A', ' H ', 146.423, 115.06, 81.582], ['A', ' HA ', 145.557, 117.81, 80.862], ['A', ' HB ', 146.583, 118.454, 83.014], ['A', ' HG1', 147.573, 116.88, 84.281], ['A', ' HG2', 145.202, 117.138, 84.456], ['A', ' HG2', 144.364, 117.601, 82.962], ['A', ' HG2', 144.959, 115.952, 83.193]] AA_SCO= 1.9283333333333335 CA_SCO= 1.416722222222222
[['A', ' N ', 148.246, 116.635, 79.955], ['A', ' CA ', 149.615, 116.788, 79.482], ['A', ' C ', 150.556, 116.818, 80.658], ['A', ' O ', 150.334, 116.137, 81.66], ['A', ' CB ', 149.801, 118.052, 78.662], ['A', ' OG ', 151.104, 118.118, 78.149], ['A', ' H ', 147.721, 115.808, 79.72], ['A', ' HA ', 149.869, 115.932, 78.854], ['A', ' HB ', 149.089, 118.043, 77.838], ['A', ' HB ', 149.614, 118.941, 79.239], ['A', ' HG ', 151.024, 118.578, 77.29]] AA_SCO= 1.9552631578947368 CA_SCO= 1.4458421052631578
[['A', ' N ', 151.6, 117.621, 80.572], ['A', ' CA ', 152.624, 117.619, 81.606], ['A', ' C ', 152.262, 118.553, 82.748], ['A', ' O ', 152.908, 119.578, 82.973], ['A', ' CB ', 153.928, 117.992, 80.956], ['A', ' CG ', 154.36, 116.971, 79.923], ['A', ' CD ', 155.688, 117.247, 79.413], ['A', ' NE ', 155.722, 118.528, 78.822], ['A', ' CZ ', 155.387, 118.859, 77.566], ['A', ' NH1', 155.016, 117.971, 76.697], ['A', ' NH2', 155.428, 120.107, 77.222], ['A', ' H ', 151.702, 118.18, 79.732], ['A', ' HA ', 152.717, 116.611, 82.004], ['A', ' HB ', 153.836, 118.963, 80.473], ['A', ' HB ', 154.712, 118.062, 81.677], ['A', ' HG ', 154.358, 115.99, 80.389], ['A', ' HG ', 153.658, 116.968, 79.09], ['A', ' HD ', 156.41, 117.228, 80.235], ['A', ' HD ', 155.961, 116.518, 78.668], ['A', ' HE ', 156.006, 119.281, 79.435], ['A', ' HH1', 154.982, 117.009, 76.958], ['A', ' HH1', 154.743, 118.278, 75.768], ['A', ' HH2', 155.698, 120.814, 77.9], ['A', ' HH2', 155.157, 120.418, 76.272]] AA_SCO= 2.1384210526315792 CA_SCO= 1.4946315789473683
[['A', ' N ', 151.197, 118.158, 83.447], ['A', ' CA ', 150.547, 118.839, 84.57], ['A', ' C ', 150.035, 117.86, 85.59], ['A', ' O ', 148.861, 117.865, 85.952], ['A', ' CB ', 149.406, 119.708, 84.054], ['A', ' CG ', 149.87, 120.838, 83.225], ['A', ' CD ', 150.521, 121.806, 84.124], ['A', ' OE1', 149.79, 122.511, 84.748], ['A', ' NE2', 151.827, 121.811, 84.267], ['A', ' H ', 150.784, 117.282, 83.105], ['A', ' HA ', 151.282, 119.447, 85.084], ['A', ' HB ', 148.751, 119.106, 83.452], ['A', ' HB ', 148.832, 120.106, 84.89], ['A', ' HG ', 150.544, 120.537, 82.446], ['A', ' HG ', 148.997, 121.315, 82.782], ['A', ' HE2', 152.274, 122.442, 84.965], ['A', ' HE2', 152.378, 121.123, 83.75]] AA_SCO= 2.208421052631579 CA_SCO= 1.4921052631578944
[['A', ' N ', 150.915, 116.979, 86.015], ['A', ' CA ', 150.662, 115.918, 86.99], ['A', ' C ', 149.69, 114.881, 86.431], ['A', ' O ', 150.085, 113.757, 86.111], ['A', ' CB ', 150.112, 116.465, 88.311], ['A', ' CG ', 151.026, 117.444, 88.993], ['A', ' CD ', 152.363, 116.899, 89.224], ['A', ' OE1', 152.484, 115.725, 89.473], ['A', ' OE2', 153.295, 117.653, 89.103], ['A', ' H ', 151.854, 117.052, 85.648], ['A', ' HA ', 151.602, 115.41, 87.198], ['A', ' HB ', 149.145, 116.933, 88.181], ['A', ' HB ', 149.967, 115.636, 88.999], ['A', ' HG ', 151.103, 118.34, 88.38], ['A', ' HG ', 150.58, 117.73, 89.948]] AA_SCO= 2.150526315789474 CA_SCO= 1.4942631578947367
[['A', ' N ', 148.427, 115.285, 86.275], ['A', ' CA ', 147.379, 114.443, 85.72], ['A', ' C ', 145.977, 114.727, 86.251], ['A', ' O ', 145.758, 115.631, 87.048], ['A', ' H ', 148.224, 116.242, 86.548], ['A', ' HA ', 147.382, 114.537, 84.637], ['A', ' HA ', 147.63, 113.405, 85.921]] AA_SCO= 2.104736842105263 CA_SCO= 1.492315789473684
[['A', ' N ', 145.039, 113.91, 85.794], ['A', ' CA ', 143.634, 113.913, 86.194], ['A', ' C ', 142.751, 115.152, 86.093], ['A', ' O ', 142.112, 115.524, 87.082], ['A', ' CB ', 143.538, 113.45, 87.62], ['A', ' CG ', 144.132, 112.125, 87.879], ['A', ' ND1', 144.247, 111.617, 89.143], ['A', ' CD2', 144.642, 111.181, 87.052], ['A', ' CE1', 144.793, 110.433, 89.088], ['A', ' NE2', 145.044, 110.149, 87.834], ['A', ' H ', 145.328, 113.212, 85.125], ['A', ' HA ', 143.131, 113.162, 85.585], ['A', ' HB ', 143.983, 114.178, 88.256], ['A', ' HB ', 142.5, 113.389, 87.878], ['A', ' HD2', 144.722, 111.214, 85.97], ['A', ' HE1', 145.003, 109.802, 89.937], ['A', ' HE2', 145.479, 109.276, 87.506]] AA_SCO= 2.078947368421052 CA_SCO= 1.4473684210526316
[['A', ' N ', 142.695, 115.797, 84.955], ['A', ' CA ', 141.767, 116.909, 84.801], ['A', ' C ', 141.348, 116.987, 83.38], ['A', ' O ', 142.086, 116.62, 82.48], ['A', ' CB ', 142.336, 118.217, 85.249], ['A', ' H ', 143.255, 115.486, 84.172], ['A', ' HA ', 140.883, 116.695, 85.386], ['A', ' HB ', 141.588, 118.999, 85.125], ['A', ' HB ', 142.609, 118.136, 86.286], ['A', ' HB ', 143.177, 118.46, 84.668]] AA_SCO= 2.0352631578947364 CA_SCO= 1.3527894736842105
[['A', ' N ', 140.167, 117.495, 83.173], ['A', ' CA ', 139.634, 117.569, 81.845], ['A', ' C ', 139.301, 118.965, 81.388], ['A', ' O ', 138.692, 119.769, 82.102], ['A', ' CB ', 138.402, 116.68, 81.776], ['A', ' CG ', 137.705, 116.641, 80.445], ['A', ' CD ', 136.531, 115.722, 80.445], ['A', ' OE1', 136.629, 114.658, 80.996], ['A', ' OE2', 135.512, 116.096, 79.919], ['A', ' H ', 139.627, 117.83, 83.974], ['A', ' HA ', 140.379, 117.167, 81.161], ['A', ' HB ', 138.69, 115.659, 82.023], ['A', ' HB ', 137.704, 117.0, 82.525], ['A', ' HG ', 137.364, 117.633, 80.191], ['A', ' HG ', 138.413, 116.326, 79.68]] AA_SCO= 2.0721052631578947 CA_SCO= 1.3494736842105264
[['A', ' N ', 139.777, 119.268, 80.192], ['A', ' CA ', 139.517, 120.553, 79.569], ['A', ' C ', 138.471, 120.419, 78.485], ['A', ' O ', 138.634, 119.655, 77.53], ['A', ' CB ', 140.831, 121.148, 79.015], ['A', ' CG ', 140.731, 122.484, 78.229], ['A', ' CD1', 140.214, 123.609, 79.126], ['A', ' CD2', 142.129, 122.871, 77.676], ['A', ' H ', 140.314, 118.536, 79.705], ['A', ' HA ', 139.102, 121.219, 80.316], ['A', ' HB ', 141.52, 121.293, 79.834], ['A', ' HB ', 141.27, 120.413, 78.342], ['A', ' HG ', 140.044, 122.354, 77.413], ['A', ' HD1', 140.145, 124.528, 78.548], ['A', ' HD1', 139.227, 123.369, 79.508], ['A', ' HD1', 140.891, 123.759, 79.957], ['A', ' HD2', 142.05, 123.795, 77.116], ['A', ' HD2', 142.826, 123.015, 78.487], ['A', ' HD2', 142.501, 122.086, 77.022]] AA_SCO= 2.028421052631579 CA_SCO= 1.326263157894737
[['A', ' N ', 137.371, 121.143, 78.645], ['A', ' CA ', 136.274, 121.09, 77.698], ['A', ' C ', 136.099, 122.419, 76.999], ['A', ' O ', 135.774, 123.439, 77.62], ['A', ' CB ', 134.969, 120.743, 78.435], ['A', ' CG1', 133.779, 120.716, 77.467], ['A', ' CG2', 135.14, 119.415, 79.108], ['A', ' H ', 137.294, 121.764, 79.457], ['A', ' HA ', 136.487, 120.328, 76.947], ['A', ' HB ', 134.769, 121.508, 79.189], ['A', ' HG1', 132.872, 120.473, 78.019], ['A', ' HG1', 133.657, 121.693, 76.997], ['A', ' HG1', 133.938, 119.973, 76.702], ['A', ' HG2', 134.238, 119.152, 79.648], ['A', ' HG2', 135.34, 118.658, 78.369], ['A', ' HG2', 135.969, 119.46, 79.803]] AA_SCO= 2.058421052631579 CA_SCO= 1.3346315789473682
[['A', ' N ', 136.269, 122.419, 75.689], ['A', ' CA ', 136.142, 123.663, 74.964], ['A', ' C ', 135.119, 123.6, 73.854], ['A', ' O ', 135.12, 122.698, 73.018], ['A', ' CB ', 137.494, 124.016, 74.4], ['A', ' CG ', 138.545, 124.248, 75.448], ['A', ' SD ', 140.177, 124.512, 74.77], ['A', ' CE ', 140.687, 122.861, 74.289], ['A', ' H ', 136.556, 121.554, 75.218], ['A', ' HA ', 135.822, 124.447, 75.649], ['A', ' HB ', 137.82, 123.228, 73.757], ['A', ' HB ', 137.397, 124.889, 73.811], ['A', ' HG ', 138.266, 125.107, 76.053], ['A', ' HG ', 138.585, 123.39, 76.092], ['A', ' HE ', 141.689, 122.901, 73.852], ['A', ' HE ', 140.697, 122.206, 75.152], ['A', ' HE ', 140.005, 122.461, 73.559]] AA_SCO= 2.027894736842106 CA_SCO= 1.3367894736842103
[['A', ' N ', 134.278, 124.604, 73.798], ['A', ' CA ', 133.272, 124.684, 72.762], ['A', ' C ', 133.793, 125.602, 71.686], ['A', ' O ', 134.034, 126.793, 71.94], ['A', ' CB ', 131.959, 125.218, 73.321], ['A', ' CG ', 131.364, 124.362, 74.423], ['A', ' CD ', 130.011, 124.808, 74.884], ['A', ' OE1', 129.484, 125.744, 74.336], ['A', ' OE2', 129.503, 124.211, 75.803], ['A', ' H ', 134.322, 125.327, 74.517], ['A', ' HA ', 133.107, 123.698, 72.327], ['A', ' HB ', 132.123, 126.213, 73.701], ['A', ' HB ', 131.227, 125.292, 72.516], ['A', ' HG ', 131.291, 123.365, 74.079], ['A', ' HG ', 132.05, 124.373, 75.272]] AA_SCO= 1.9989473684210528 CA_SCO= 1.3236315789473683
[['A', ' N ', 133.925, 125.065, 70.48], ['A', ' CA ', 134.47, 125.833, 69.371], ['A', ' C ', 133.393, 126.071, 68.33], ['A', ' O ', 132.605, 125.179, 68.039], ['A', ' CB ', 135.687, 125.109, 68.757], ['A', ' CG1', 136.814, 125.063, 69.766], ['A', ' CG2', 135.32, 123.674, 68.345], ['A', ' H ', 133.632, 124.088, 70.339], ['A', ' HA ', 134.798, 126.799, 69.743], ['A', ' HB ', 136.032, 125.67, 67.882], ['A', ' HG1', 137.67, 124.568, 69.317], ['A', ' HG1', 137.086, 126.067, 70.032], ['A', ' HG1', 136.499, 124.515, 70.657], ['A', ' HG2', 136.191, 123.189, 67.913], ['A', ' HG2', 134.989, 123.104, 69.211], ['A', ' HG2', 134.521, 123.681, 67.601]] AA_SCO= 1.942105263157895 CA_SCO= 1.2942105263157895
[['A', ' N ', 133.327, 127.292, 67.81], ['A', ' CA ', 132.289, 127.626, 66.824], ['A', ' C ', 132.829, 127.912, 65.431], ['A', ' O ', 133.462, 128.948, 65.21], ['A', ' CB ', 131.448, 128.84, 67.258], ['A', ' CG ', 130.488, 128.62, 68.481], ['A', ' OD1', 129.742, 127.656, 68.504], ['A', ' OD2', 130.476, 129.474, 69.352], ['A', ' H ', 134.064, 127.95, 68.088], ['A', ' HA ', 131.616, 126.773, 66.741], ['A', ' HB ', 132.12, 129.662, 67.495], ['A', ' HB ', 130.842, 129.163, 66.409]] AA_SCO= 2.067894736842105 CA_SCO= 1.4472105263157893
[['A', ' N ', 132.578, 126.991, 64.486], ['A', ' CA ', 133.016, 127.036, 63.069], ['A', ' C ', 134.529, 126.967, 62.877], ['A', ' O ', 135.053, 126.077, 62.207], ['A', ' CB ', 132.469, 128.276, 62.366], ['A', ' CG ', 130.966, 128.22, 62.196], ['A', ' OD1', 130.396, 127.16, 62.358], ['A', ' OD2', 130.393, 129.238, 61.901], ['A', ' H ', 132.029, 126.187, 64.762], ['A', ' HA ', 132.589, 126.167, 62.568], ['A', ' HB ', 132.733, 129.179, 62.906], ['A', ' HB ', 132.928, 128.354, 61.379]] AA_SCO= 2.106315789473684 CA_SCO= 1.6534736842105262
[['A', ' N ', 135.204, 127.924, 63.471], ['A', ' CA ', 136.633, 128.061, 63.509], ['A', ' C ', 137.096, 127.209, 64.658], ['A', ' O ', 136.29, 126.565, 65.322], ['A', ' CB ', 137.036, 129.519, 63.736], ['A', ' CG ', 136.683, 130.439, 62.603], ['A', ' CD ', 137.477, 130.138, 61.387], ['A', ' OE1', 138.62, 129.775, 61.53], ['A', ' OE2', 136.952, 130.26, 60.311], ['A', ' H ', 134.658, 128.608, 63.98], ['A', ' HA ', 137.069, 127.689, 62.58], ['A', ' HB ', 136.534, 129.892, 64.631], ['A', ' HB ', 138.107, 129.59, 63.909], ['A', ' HG ', 135.623, 130.327, 62.373], ['A', ' HG ', 136.859, 131.47, 62.908]] AA_SCO= 2.117368421052632 CA_SCO= 1.6644736842105259
[['A', ' N ', 138.392, 127.16, 64.895], ['A', ' CA ', 138.888, 126.355, 65.998], ['A', ' C ', 138.883, 127.165, 67.286], ['A', ' O ', 139.371, 126.711, 68.316], ['A', ' H ', 139.037, 127.68, 64.311], ['A', ' HA ', 138.258, 125.472, 66.117], ['A', ' HA ', 139.887, 126.002, 65.778]] AA_SCO= 2.1231578947368424 CA_SCO= 1.6669999999999998
[['A', ' N ', 138.351, 128.376, 67.208], ['A', ' CA ', 138.3, 129.32, 68.299], ['A', ' C ', 137.274, 128.919, 69.312], ['A', ' O ', 136.106, 128.661, 68.992], ['A', ' CB ', 138.011, 130.716, 67.761], ['A', ' CG1', 139.186, 131.117, 66.845], ['A', ' CG2', 137.853, 131.702, 68.936], ['A', ' CD1', 138.941, 132.333, 66.001], ['A', ' H ', 137.96, 128.655, 66.322], ['A', ' HA ', 139.247, 129.346, 68.804], ['A', ' HB ', 137.102, 130.705, 67.16], ['A', ' HG1', 140.059, 131.304, 67.469], ['A', ' HG1', 139.413, 130.293, 66.176], ['A', ' HG2', 137.665, 132.702, 68.57], ['A', ' HG2', 137.022, 131.414, 69.577], ['A', ' HG2', 138.766, 131.7, 69.515], ['A', ' HD1', 139.824, 132.529, 65.393], ['A', ' HD1', 138.086, 132.158, 65.346], ['A', ' HD1', 138.744, 133.197, 66.624]] AA_SCO= 2.1347368421052626 CA_SCO= 1.6631052631578946
[['A', ' N ', 137.732, 128.899, 70.551], ['A', ' CA ', 136.928, 128.545, 71.69], ['A', ' C ', 136.091, 129.726, 72.069], ['A', ' O ', 136.604, 130.821, 72.284], ['A', ' CB ', 137.842, 128.181, 72.862], ['A', ' CG1', 137.032, 127.86, 74.116], ['A', ' CG2', 138.708, 127.053, 72.451], ['A', ' H ', 138.719, 129.136, 70.697], ['A', ' HA ', 136.281, 127.71, 71.439], ['A', ' HB ', 138.479, 129.035, 73.096], ['A', ' HG1', 137.708, 127.616, 74.933], ['A', ' HG1', 136.427, 128.71, 74.408], ['A', ' HG1', 136.378, 127.011, 73.921], ['A', ' HG2', 139.377, 126.82, 73.262], ['A', ' HG2', 138.105, 126.199, 72.208], ['A', ' HG2', 139.288, 127.337, 71.58]] AA_SCO= 2.1221052631578945 CA_SCO= 1.6621578947368416
[['A', ' N ', 134.802, 129.524, 72.176], ['A', ' CA ', 133.941, 130.626, 72.544], ['A', ' C ', 133.454, 130.439, 73.956], ['A', ' O ', 133.094, 131.401, 74.63], ['A', ' CB ', 132.784, 130.749, 71.559], ['A', ' OG1', 132.024, 129.537, 71.575], ['A', ' CG2', 133.356, 130.986, 70.16], ['A', ' H ', 134.421, 128.592, 71.992], ['A', ' HA ', 134.51, 131.552, 72.508], ['A', ' HB ', 132.142, 131.58, 71.842], ['A', ' HG1', 131.281, 129.603, 70.917], ['A', ' HG2', 132.536, 131.073, 69.452], ['A', ' HG2', 133.94, 131.903, 70.157], ['A', ' HG2', 133.992, 130.151, 69.871]] AA_SCO= 2.167894736842105 CA_SCO= 1.6557894736842103
[['A', ' N ', 133.496, 129.2, 74.414], ['A', ' CA ', 133.125, 128.873, 75.78], ['A', ' C ', 133.994, 127.742, 76.294], ['A', ' O ', 134.317, 126.829, 75.537], ['A', ' CB ', 131.649, 128.495, 75.87], ['A', ' CG ', 131.133, 128.183, 77.271], ['A', ' CD ', 129.645, 127.901, 77.225], ['A', ' CE ', 129.082, 127.536, 78.584], ['A', ' NZ ', 127.632, 127.205, 78.499], ['A', ' H ', 133.735, 128.458, 73.751], ['A', ' HA ', 133.286, 129.743, 76.405], ['A', ' HB ', 131.049, 129.308, 75.466], ['A', ' HB ', 131.456, 127.627, 75.264], ['A', ' HG ', 131.624, 127.291, 77.66], ['A', ' HG ', 131.337, 129.021, 77.939], ['A', ' HD ', 129.122, 128.78, 76.849], ['A', ' HD ', 129.457, 127.076, 76.544], ['A', ' HE ', 129.618, 126.673, 78.981], ['A', ' HE ', 129.213, 128.377, 79.264], ['A', ' HZ ', 127.268, 126.956, 79.429], ['A', ' HZ ', 127.117, 127.984, 78.148], ['A', ' HZ ', 127.484, 126.41, 77.896]] AA_SCO= 2.100526315789474 CA_SCO= 1.65578947368421
[['A', ' N ', 134.3, 127.725, 77.581], ['A', ' CA ', 134.978, 126.537, 78.085], ['A', ' C ', 134.98, 126.39, 79.598], ['A', ' O ', 134.708, 127.32, 80.368], ['A', ' H ', 134.11, 128.551, 78.161], ['A', ' HA ', 134.507, 125.655, 77.652], ['A', ' HA ', 136.008, 126.538, 77.728]] AA_SCO= 2.115263157894737 CA_SCO= 1.6588947368421052
[['A', ' N ', 135.281, 125.166, 80.008], ['A', ' CA ', 135.342, 124.762, 81.398], ['A', ' C ', 136.482, 123.814, 81.665], ['A', ' O ', 136.899, 123.039, 80.805], ['A', ' CB ', 134.051, 124.099, 81.864], ['A', ' CG ', 132.775, 124.976, 81.922], ['A', ' CD ', 132.871, 126.0, 83.037], ['A', ' NE ', 131.651, 126.77, 83.236], ['A', ' CZ ', 131.307, 127.879, 82.55], ['A', ' NH1', 132.071, 128.352, 81.57], ['A', ' NH2', 130.185, 128.504, 82.873], ['A', ' H ', 135.483, 124.473, 79.277], ['A', ' HA ', 135.503, 125.651, 82.0], ['A', ' HB ', 133.827, 123.273, 81.191], ['A', ' HB ', 134.205, 123.668, 82.849], ['A', ' HG ', 132.642, 125.497, 80.98], ['A', ' HG ', 131.906, 124.347, 82.104], ['A', ' HD ', 133.101, 125.511, 83.963], ['A', ' HD ', 133.666, 126.701, 82.817], ['A', ' HE ', 131.02, 126.477, 84.02], ['A', ' HH1', 132.959, 127.89, 81.294], ['A', ' HH1', 131.799, 129.188, 81.076], ['A', ' HH2', 129.608, 128.141, 83.626], ['A', ' HH2', 129.906, 129.338, 82.384]] AA_SCO= 2.173684210526316 CA_SCO= 1.6602105263157894
[['A', ' N ', 136.98, 123.863, 82.874], ['A', ' CA ', 138.054, 122.993, 83.266], ['A', ' C ', 137.759, 122.492, 84.644], ['A', ' O ', 137.262, 123.24, 85.488], ['A', ' CB ', 139.358, 123.756, 83.2], ['A', ' CG ', 140.523, 123.009, 83.539], ['A', ' CD1', 140.977, 122.118, 82.66], ['A', ' CD2', 141.167, 123.225, 84.677], ['A', ' CE1', 142.068, 121.418, 82.892], ['A', ' CE2', 142.287, 122.528, 84.922], ['A', ' CZ ', 142.734, 121.627, 84.02], ['A', ' OH ', 143.854, 120.942, 84.232], ['A', ' H ', 136.606, 124.511, 83.554], ['A', ' HA ', 138.092, 122.133, 82.599], ['A', ' HB ', 139.498, 124.114, 82.19], ['A', ' HB ', 139.308, 124.621, 83.86], ['A', ' HD1', 140.446, 121.976, 81.761], ['A', ' HD2', 140.798, 123.962, 85.387], ['A', ' HE1', 142.421, 120.693, 82.161], ['A', ' HE2', 142.819, 122.701, 85.827], ['A', ' HH ', 144.236, 121.216, 85.063]] AA_SCO= 2.236842105263158 CA_SCO= 1.6782105263157892
[['A', ' N ', 137.974, 121.211, 84.854], ['A', ' CA ', 137.724, 120.629, 86.153], ['A', ' C ', 138.592, 119.429, 86.416], ['A', ' O ', 139.048, 118.774, 85.479], ['A', ' CB ', 136.257, 120.271, 86.213], ['A', ' CG ', 135.854, 119.308, 85.159], ['A', ' CD1', 135.748, 117.964, 85.408], ['A', ' CD2', 135.593, 119.759, 83.874], ['A', ' CE1', 135.36, 117.107, 84.413], ['A', ' CE2', 135.234, 118.898, 82.901], ['A', ' CZ ', 135.106, 117.573, 83.17], ['A', ' H ', 138.307, 120.622, 84.08], ['A', ' HA ', 137.935, 121.37, 86.912], ['A', ' HB ', 136.036, 119.83, 87.178], ['A', ' HB ', 135.649, 121.164, 86.114], ['A', ' HD1', 135.961, 117.582, 86.397], ['A', ' HD2', 135.668, 120.818, 83.639], ['A', ' HE1', 135.257, 116.048, 84.608], ['A', ' HE2', 135.034, 119.265, 81.907], ['A', ' HZ ', 134.802, 116.884, 82.377]] AA_SCO= 2.246842105263158 CA_SCO= 1.7242105263157894
[['A', ' N ', 138.793, 119.097, 87.689], ['A', ' CA ', 139.557, 117.906, 87.994], ['A', ' C ', 138.678, 116.687, 87.925], ['A', ' O ', 137.479, 116.758, 88.216], ['A', ' CB ', 140.187, 118.016, 89.356], ['A', ' OG ', 139.214, 118.036, 90.355], ['A', ' H ', 138.418, 119.659, 88.442], ['A', ' HA ', 140.352, 117.802, 87.268], ['A', ' HB ', 140.866, 117.176, 89.513], ['A', ' HB ', 140.785, 118.926, 89.408], ['A', ' HG ', 139.703, 118.114, 91.182]] AA_SCO= 2.305263157894737 CA_SCO= 1.8202631578947368
[['A', ' N ', 139.286, 115.544, 87.617], ['A', ' CA ', 138.582, 114.267, 87.609], ['A', ' C ', 139.297, 113.27, 88.499], ['A', ' O ', 139.099, 112.065, 88.376], ['A', ' CB ', 138.421, 113.711, 86.181], ['A', ' CG1', 139.785, 113.488, 85.528], ['A', ' CG2', 137.592, 114.699, 85.375], ['A', ' CD1', 139.776, 112.716, 84.222], ['A', ' H ', 140.285, 115.559, 87.393], ['A', ' HA ', 137.584, 114.419, 88.021], ['A', ' HB ', 137.903, 112.751, 86.222], ['A', ' HG1', 140.21, 114.443, 85.325], ['A', ' HG1', 140.425, 112.949, 86.221], ['A', ' HG2', 137.421, 114.336, 84.364], ['A', ' HG2', 136.637, 114.818, 85.879], ['A', ' HG2', 138.098, 115.664, 85.321], ['A', ' HD1', 140.8, 112.628, 83.848], ['A', ' HD1', 139.365, 111.719, 84.388], ['A', ' HD1', 139.18, 113.228, 83.474]] AA_SCO= 2.339473684210526 CA_SCO= 1.8300526315789474
[['A', ' N ', 140.17, 113.787, 89.34], ['A', ' CA ', 140.976, 113.008, 90.264], ['A', ' C ', 140.065, 112.33, 91.247], ['A', ' O ', 139.057, 112.922, 91.592], ['A', ' CB ', 141.944, 113.95, 91.015], ['A', ' OG1', 142.844, 113.179, 91.825], ['A', ' CG2', 141.167, 114.928, 91.925], ['A', ' H ', 140.258, 114.792, 89.341], ['A', ' HA ', 141.532, 112.265, 89.7], ['A', ' HB ', 142.497, 114.523, 90.289], ['A', ' HG1', 143.608, 113.719, 92.141], ['A', ' HG2', 141.883, 115.588, 92.419], ['A', ' HG2', 140.481, 115.522, 91.331], ['A', ' HG2', 140.609, 114.391, 92.686]] AA_SCO= 2.3378947368421055 CA_SCO= 1.6652105263157895
[['A', ' N ', 140.335, 111.126, 91.733], ['A', ' CA ', 139.519, 110.508, 92.728], ['A', ' C ', 139.642, 111.335, 93.965], ['A', ' O ', 140.708, 111.881, 94.238], ['A', ' CB ', 140.145, 109.137, 92.895], ['A', ' CG ', 141.563, 109.313, 92.416], ['A', ' CD ', 141.467, 110.33, 91.294], ['A', ' HA ', 138.485, 110.457, 92.366], ['A', ' HB ', 140.077, 108.833, 93.947], ['A', ' HB ', 139.581, 108.403, 92.304], ['A', ' HG ', 142.205, 109.661, 93.24], ['A', ' HG ', 141.982, 108.349, 92.08], ['A', ' HD ', 142.395, 110.899, 91.262], ['A', ' HD ', 141.24, 109.836, 90.33]] AA_SCO= 2.3063157894736843 CA_SCO= 1.6154210526315789
[['A', ' N ', 138.601, 111.392, 94.749], ['A', ' CA ', 138.692, 112.159, 95.958], ['A', ' C ', 139.429, 111.382, 97.002], ['A', ' O ', 139.009, 110.306, 97.402], ['A', ' CB ', 137.296, 112.514, 96.429], ['A', ' CG1', 137.311, 113.218, 97.709], ['A', ' CG2', 136.679, 113.372, 95.428], ['A', ' H ', 137.743, 110.915, 94.492], ['A', ' HA ', 139.236, 113.082, 95.744], ['A', ' HB ', 136.715, 111.614, 96.55], ['A', ' HG1', 136.277, 113.459, 97.983], ['A', ' HG1', 137.746, 112.594, 98.481], ['A', ' HG1', 137.882, 114.134, 97.598], ['A', ' HG2', 135.699, 113.585, 95.791], ['A', ' HG2', 137.24, 114.302, 95.308], ['A', ' HG2', 136.621, 112.869, 94.469]] AA_SCO= 2.261052631578947 CA_SCO= 1.4387894736842106
[['A', ' N ', 140.492, 111.993, 97.482], ['A', ' CA ', 141.419, 111.426, 98.444], ['A', ' C ', 140.84, 111.353, 99.838], ['A', ' O ', 141.168, 110.464, 100.612], ['A', ' CB ', 142.614, 112.326, 98.463], ['A', ' CG ', 143.381, 112.375, 97.154], ['A', ' CD ', 144.253, 111.226, 96.911], ['A', ' NE ', 145.191, 111.113, 97.962], ['A', ' CZ ', 146.263, 111.909, 98.122], ['A', ' NH1', 146.519, 112.912, 97.296], ['A', ' NH2', 147.047, 111.714, 99.127], ['A', ' H ', 140.709, 112.892, 97.076], ['A', ' HA ', 141.691, 110.423, 98.123], ['A', ' HB ', 142.299, 113.342, 98.687], ['A', ' HB ', 143.29, 112.018, 99.259], ['A', ' HG ', 142.668, 112.385, 96.327], ['A', ' HG ', 143.947, 113.295, 97.12], ['A', ' HD ', 143.667, 110.307, 96.869], ['A', ' HD ', 144.788, 111.352, 95.971], ['A', ' HE ', 145.05, 110.374, 98.638], ['A', ' HH1', 145.918, 113.097, 96.516], ['A', ' HH1', 147.323, 113.557, 97.485], ['A', ' HH2', 146.875, 110.971, 99.78], ['A', ' HH2', 147.845, 112.336, 99.225]] AA_SCO= 2.2957894736842106 CA_SCO= 1.454526315789474
[['A', ' N ', 139.997, 112.323, 100.168], ['A', ' CA ', 139.355, 112.361, 101.471], ['A', ' C ', 140.174, 112.973, 102.604], ['A', ' O ', 139.786, 112.853, 103.767], ['A', ' H ', 139.791, 113.039, 99.489], ['A', ' HA ', 138.424, 112.893, 101.375], ['A', ' HA ', 139.082, 111.343, 101.749]] AA_SCO= 2.346315789473684 CA_SCO= 1.4545263157894737
[['A', ' N ', 141.257, 113.676, 102.297], ['A', ' CA ', 142.114, 114.204, 103.351], ['A', ' C ', 141.5, 115.158, 104.329], ['A', ' O ', 141.934, 115.209, 105.479], ['A', ' CB ', 143.398, 114.775, 102.758], ['A', ' CG ', 144.409, 113.702, 102.299], ['A', ' CD1', 145.467, 114.293, 101.459], ['A', ' CD2', 145.123, 113.143, 103.554], ['A', ' H ', 141.516, 113.807, 101.333], ['A', ' HA ', 142.408, 113.351, 103.927], ['A', ' HB ', 143.142, 115.399, 101.904], ['A', ' HB ', 143.886, 115.402, 103.509], ['A', ' HG ', 143.893, 112.911, 101.751], ['A', ' HD1', 146.183, 113.525, 101.174], ['A', ' HD1', 145.028, 114.727, 100.565], ['A', ' HD1', 145.969, 115.044, 102.036], ['A', ' HD2', 145.858, 112.394, 103.259], ['A', ' HD2', 145.63, 113.96, 104.059], ['A', ' HD2', 144.442, 112.697, 104.243]] AA_SCO= 2.3742105263157893 CA_SCO= 1.4509473684210528
[['A', ' N ', 140.508, 115.939, 103.962], ['A', ' CA ', 140.02, 116.815, 104.995], ['A', ' C ', 139.363, 115.965, 106.096], ['A', ' O ', 139.418, 116.317, 107.276], ['A', ' CB ', 139.07, 117.864, 104.417], ['A', ' CG ', 139.776, 118.879, 103.475], ['A', ' CD ', 138.835, 119.859, 102.783], ['A', ' OE1', 137.671, 119.581, 102.7], ['A', ' OE2', 139.278, 120.902, 102.368], ['A', ' H ', 140.07, 115.939, 103.032], ['A', ' HA ', 140.869, 117.334, 105.424], ['A', ' HB ', 138.252, 117.383, 103.902], ['A', ' HB ', 138.633, 118.437, 105.235], ['A', ' HG ', 140.517, 119.433, 104.045], ['A', ' HG ', 140.312, 118.316, 102.709]] AA_SCO= 2.3173684210526315 CA_SCO= 1.4759473684210527
[['A', ' N ', 138.745, 114.827, 105.737], ['A', ' CA ', 138.047, 114.029, 106.734], ['A', ' C ', 138.995, 113.058, 107.419], ['A', ' O ', 138.825, 112.723, 108.603], ['A', ' CB ', 136.877, 113.303, 106.086], ['A', ' CG ', 135.806, 114.238, 105.496], ['A', ' CD ', 135.158, 115.135, 106.559], ['A', ' CE ', 134.007, 115.946, 105.986], ['A', ' NZ ', 133.403, 116.857, 107.011], ['A', ' H ', 138.776, 114.486, 104.774], ['A', ' HA ', 137.668, 114.69, 107.505], ['A', ' HB ', 137.245, 112.67, 105.27], ['A', ' HB ', 136.397, 112.649, 106.813], ['A', ' HG ', 136.261, 114.864, 104.725], ['A', ' HG ', 135.039, 113.626, 105.032], ['A', ' HD ', 134.795, 114.523, 107.384], ['A', ' HD ', 135.885, 115.849, 106.945], ['A', ' HE ', 134.372, 116.543, 105.15], ['A', ' HE ', 133.237, 115.263, 105.625], ['A', ' HZ ', 132.642, 117.38, 106.601], ['A', ' HZ ', 133.052, 116.311, 107.787], ['A', ' HZ ', 134.108, 117.501, 107.345]] AA_SCO= 2.156315789473684 CA_SCO= 1.4786842105263158
[['A', ' N ', 140.028, 112.634, 106.69], ['A', ' CA ', 141.024, 111.737, 107.253], ['A', ' C ', 141.673, 112.42, 108.416], ['A', ' O ', 141.927, 111.801, 109.448], ['A', ' CB ', 142.09, 111.411, 106.236], ['A', ' CG ', 141.631, 110.558, 105.161], ['A', ' SD ', 142.735, 110.462, 103.767], ['A', ' CE ', 144.137, 109.655, 104.403], ['A', ' H ', 140.088, 112.923, 105.711], ['A', ' HA ', 140.538, 110.827, 107.599], ['A', ' HB ', 142.494, 112.319, 105.837], ['A', ' HB ', 142.901, 110.894, 106.741], ['A', ' HG ', 141.557, 109.582, 105.59], ['A', ' HG ', 140.652, 110.852, 104.823], ['A', ' HE ', 144.875, 109.547, 103.615], ['A', ' HE ', 144.569, 110.218, 105.225], ['A', ' HE ', 143.835, 108.688, 104.741]] AA_SCO= 2.2300000000000004 CA_SCO= 1.479421052631579
[['A', ' N ', 141.936, 113.706, 108.228], ['A', ' CA ', 142.532, 114.546, 109.229], ['A', ' C ', 141.562, 114.919, 110.32], ['A', ' O ', 141.915, 114.869, 111.489], ['A', ' CB ', 143.087, 115.812, 108.578], ['A', ' CG1', 143.542, 116.775, 109.625], ['A', ' CG2', 144.253, 115.431, 107.695], ['A', ' H ', 141.718, 114.117, 107.315], ['A', ' HA ', 143.359, 113.997, 109.68], ['A', ' HB ', 142.31, 116.29, 107.974], ['A', ' HG1', 143.957, 117.661, 109.148], ['A', ' HG1', 142.715, 117.078, 110.264], ['A', ' HG1', 144.29, 116.283, 110.216], ['A', ' HG2', 144.653, 116.324, 107.223], ['A', ' HG2', 145.01, 114.966, 108.304], ['A', ' HG2', 143.929, 114.733, 106.925]] AA_SCO= 2.271578947368421 CA_SCO= 1.48
[['A', ' N ', 140.34, 115.3, 109.962], ['A', ' CA ', 139.42, 115.763, 110.973], ['A', ' C ', 139.154, 114.764, 112.072], ['A', ' O ', 139.241, 115.114, 113.234], ['A', ' CB ', 138.061, 116.155, 110.363], ['A', ' OG1', 138.239, 117.217, 109.426], ['A', ' CG2', 137.157, 116.66, 111.464], ['A', ' H ', 140.063, 115.354, 108.982], ['A', ' HA ', 139.85, 116.647, 111.424], ['A', ' HB ', 137.609, 115.3, 109.864], ['A', ' HG1', 138.698, 116.889, 108.626], ['A', ' HG2', 136.203, 116.968, 111.044], ['A', ' HG2', 136.975, 115.897, 112.215], ['A', ' HG2', 137.636, 117.507, 111.928]] AA_SCO= 2.2694736842105265 CA_SCO= 1.4811578947368422
[['A', ' N ', 138.89, 113.505, 111.774], ['A', ' CA ', 138.561, 112.603, 112.895], ['A', ' C ', 139.768, 112.004, 113.642], ['A', ' O ', 139.807, 110.791, 113.88], ['A', ' H ', 138.858, 113.203, 110.792], ['A', ' HA ', 137.938, 113.142, 113.608], ['A', ' HA ', 137.947, 111.79, 112.51]] AA_SCO= 2.227368421052631 CA_SCO= 1.4775263157894738
[['A', ' N ', 140.738, 112.85, 113.983], ['A', ' CA ', 142.023, 112.485, 114.59], ['A', ' C ', 142.59, 113.601, 115.463], ['A', ' O ', 142.047, 114.696, 115.514], ['A', ' CB ', 143.041, 112.048, 113.531], ['A', ' CG ', 142.604, 110.801, 112.767], ['A', ' CD ', 143.612, 110.262, 111.804], ['A', ' CE ', 143.097, 109.024, 111.117], ['A', ' NZ ', 141.743, 109.245, 110.587], ['A', ' H ', 140.525, 113.83, 113.791], ['A', ' HA ', 141.853, 111.63, 115.243], ['A', ' HB ', 143.177, 112.856, 112.804], ['A', ' HB ', 144.007, 111.853, 113.993], ['A', ' HG ', 142.287, 110.023, 113.461], ['A', ' HG ', 141.764, 111.101, 112.161], ['A', ' HD ', 143.849, 111.015, 111.05], ['A', ' HD ', 144.517, 109.992, 112.342], ['A', ' HE ', 143.762, 108.803, 110.283], ['A', ' HE ', 143.086, 108.176, 111.798], ['A', ' HZ ', 141.411, 108.436, 110.097], ['A', ' HZ ', 141.114, 109.447, 111.351], ['A', ' HZ ', 141.773, 110.07, 109.959]] AA_SCO= 2.1794736842105262 CA_SCO= 1.478
[['A', ' N ', 143.62, 113.272, 116.222], ['A', ' CA ', 144.322, 114.19, 117.117], ['A', ' C ', 145.153, 115.221, 116.345], ['A', ' O ', 145.392, 115.01, 115.164], ['A', ' CB ', 145.231, 113.396, 118.03], ['A', ' H ', 143.991, 112.335, 116.122], ['A', ' HA ', 143.586, 114.695, 117.712], ['A', ' HB ', 145.743, 114.057, 118.722], ['A', ' HB ', 144.646, 112.676, 118.593], ['A', ' HB ', 145.978, 112.869, 117.43]] AA_SCO= 2.1747368421052626 CA_SCO= 1.296421052631579
[['A', ' N ', 145.51, 116.384, 116.948], ['A', ' CA ', 146.492, 117.323, 116.46], ['A', ' C ', 147.692, 116.448, 116.39], ['A', ' O ', 147.716, 115.446, 117.095], ['A', ' CB ', 146.582, 118.379, 117.544], ['A', ' CG ', 145.266, 118.293, 118.22], ['A', ' CD ', 144.877, 116.838, 118.172], ['A', ' HA ', 146.21, 117.713, 115.474], ['A', ' HB ', 147.426, 118.16, 118.214], ['A', ' HB ', 146.772, 119.364, 117.095], ['A', ' HG ', 145.332, 118.679, 119.252], ['A', ' HG ', 144.552, 118.923, 117.687], ['A', ' HD ', 145.27, 116.304, 119.047], ['A', ' HD ', 143.798, 116.799, 118.096]] AA_SCO= 2.1473684210526316 CA_SCO= 1.2967368421052632
[['A', ' N ', 148.656, 116.789, 115.564], ['A', ' CA ', 149.768, 115.894, 115.266], ['A', ' C ', 148.969, 115.154, 114.251], ['A', ' O ', 147.872, 115.622, 113.993], ['A', ' CB ', 150.236, 114.971, 116.409], ['A', ' CG ', 151.582, 114.274, 116.165], ['A', ' CD ', 152.714, 115.23, 116.206], ['A', ' OE1', 152.657, 116.134, 116.994], ['A', ' OE2', 153.616, 115.099, 115.42], ['A', ' H ', 148.561, 117.657, 115.058], ['A', ' HA ', 150.606, 116.408, 114.795], ['A', ' HB ', 150.284, 115.522, 117.352], ['A', ' HB ', 149.541, 114.14, 116.527], ['A', ' HG ', 151.729, 113.53, 116.951], ['A', ' HG ', 151.59, 113.751, 115.224]] AA_SCO= 2.182105263157895 CA_SCO= 1.2917368421052633
[['A', ' N ', 149.468, 114.145, 113.574], ['A', ' CA ', 148.7, 113.468, 112.52], ['A', ' C ', 148.459, 114.361, 111.306], ['A', ' O ', 148.991, 114.081, 110.236], ['A', ' CB ', 147.324, 112.954, 113.005], ['A', ' OG1', 147.499, 112.024, 114.071], ['A', ' CG2', 146.642, 112.257, 111.862], ['A', ' H ', 150.384, 113.79, 113.795], ['A', ' HA ', 149.277, 112.609, 112.183], ['A', ' HB ', 146.68, 113.753, 113.332], ['A', ' HG1', 147.88, 112.478, 114.831], ['A', ' HG2', 145.718, 111.904, 112.222], ['A', ' HG2', 146.461, 112.933, 111.03], ['A', ' HG2', 147.255, 111.422, 111.523]] AA_SCO= 2.3131578947368423 CA_SCO= 1.2919473684210527
[['A', ' N ', 147.725, 115.462, 111.463], ['A', ' CA ', 147.435, 116.379, 110.379], ['A', ' C ', 148.687, 116.809, 109.642], ['A', ' O ', 148.735, 116.65, 108.431], ['A', ' CB ', 146.704, 117.628, 110.871], ['A', ' H ', 147.331, 115.623, 112.381], ['A', ' HA ', 146.786, 115.857, 109.68], ['A', ' HB ', 146.457, 118.257, 110.014], ['A', ' HB ', 145.801, 117.334, 111.374], ['A', ' HB ', 147.275, 118.21, 111.555]] AA_SCO= 2.3452631578947374 CA_SCO= 1.2552105263157893
[['A', ' N ', 149.801, 117.199, 110.296], ['A', ' CA ', 151.004, 117.654, 109.649], ['A', ' C ', 151.609, 116.608, 108.75], ['A', ' O ', 152.473, 116.945, 107.951], ['A', ' CB ', 151.941, 117.932, 110.814], ['A', ' CG ', 151.051, 118.157, 111.953], ['A', ' CD ', 149.945, 117.201, 111.751], ['A', ' HA ', 150.801, 118.574, 109.088], ['A', ' HB ', 152.616, 117.076, 110.96], ['A', ' HB ', 152.582, 118.804, 110.582], ['A', ' HG ', 151.6, 117.999, 112.893], ['A', ' HG ', 150.703, 119.197, 111.945], ['A', ' HD ', 150.317, 116.239, 112.072], ['A', ' HD ', 149.095, 117.53, 112.31]] AA_SCO= 2.2384210526315793 CA_SCO= 1.2446842105263154
[['A', ' N ', 151.225, 115.343, 108.935], ['A', ' CA ', 151.736, 114.252, 108.148], ['A', ' C ', 150.736, 113.919, 107.07], ['A', ' O ', 151.076, 113.806, 105.904], ['A', ' CB ', 151.961, 113.02, 109.038], ['A', ' CG1', 152.413, 111.833, 108.226], ['A', ' CG2', 152.961, 113.354, 110.062], ['A', ' H ', 150.49, 115.111, 109.597], ['A', ' HA ', 152.679, 114.549, 107.687], ['A', ' HB ', 151.023, 112.746, 109.521], ['A', ' HG1', 152.56, 110.979, 108.894], ['A', ' HG1', 151.661, 111.582, 107.491], ['A', ' HG1', 153.352, 112.066, 107.722], ['A', ' HG2', 153.119, 112.49, 110.709], ['A', ' HG2', 153.894, 113.624, 109.57], ['A', ' HG2', 152.604, 114.193, 110.655]] AA_SCO= 2.2931578947368423 CA_SCO= 1.4514210526315787
[['A', ' N ', 149.473, 113.789, 107.426], ['A', ' CA ', 148.506, 113.36, 106.435], ['A', ' C ', 148.331, 114.369, 105.317], ['A', ' O ', 148.166, 113.994, 104.154], ['A', ' CB ', 147.173, 113.072, 107.105], ['A', ' CG ', 147.171, 111.852, 108.005], ['A', ' SD ', 147.495, 110.335, 107.1], ['A', ' CE ', 147.788, 109.167, 108.414], ['A', ' H ', 149.204, 113.952, 108.396], ['A', ' HA ', 148.873, 112.447, 105.989], ['A', ' HB ', 146.926, 113.921, 107.73], ['A', ' HB ', 146.387, 112.967, 106.359], ['A', ' HG ', 147.939, 111.971, 108.773], ['A', ' HG ', 146.2, 111.764, 108.499], ['A', ' HE ', 148.013, 108.195, 107.988], ['A', ' HE ', 148.636, 109.495, 109.021], ['A', ' HE ', 146.901, 109.088, 109.043]] AA_SCO= 2.3642105263157895 CA_SCO= 1.5004210526315784
[['A', ' N ', 148.484, 115.644, 105.633], ['A', ' CA ', 148.327, 116.675, 104.625], ['A', ' C ', 149.524, 116.706, 103.693], ['A', ' O ', 149.471, 117.326, 102.638], ['A', ' CB ', 148.15, 118.061, 105.242], ['A', ' CG1', 146.92, 118.049, 106.152], ['A', ' CG2', 149.45, 118.489, 105.943], ['A', ' H ', 148.644, 115.894, 106.613], ['A', ' HA ', 147.432, 116.446, 104.048], ['A', ' HB ', 147.936, 118.781, 104.458], ['A', ' HG1', 146.771, 119.038, 106.567], ['A', ' HG1', 146.045, 117.769, 105.564], ['A', ' HG1', 147.039, 117.347, 106.952], ['A', ' HG2', 149.312, 119.466, 106.36], ['A', ' HG2', 149.711, 117.811, 106.714], ['A', ' HG2', 150.27, 118.529, 105.235]] AA_SCO= 2.426315789473685 CA_SCO= 1.6774210526315787
[['A', ' N ', 150.618, 116.052, 104.051], ['A', ' CA ', 151.795, 116.099, 103.225], ['A', ' C ', 151.607, 115.326, 101.966], ['A', ' O ', 152.391, 115.5, 101.04], ['A', ' CB ', 153.016, 115.599, 103.938], ['A', ' CG ', 153.42, 116.473, 104.978], ['A', ' CD ', 154.554, 115.948, 105.704], ['A', ' OE1', 154.772, 114.73, 105.748], ['A', ' NE2', 155.313, 116.837, 106.277], ['A', ' H ', 150.63, 115.472, 104.889], ['A', ' HA ', 151.974, 117.137, 102.951], ['A', ' HB ', 152.825, 114.61, 104.352], ['A', ' HB ', 153.842, 115.511, 103.242], ['A', ' HG ', 153.705, 117.418, 104.539], ['A', ' HG ', 152.586, 116.607, 105.64], ['A', ' HE2', 156.127, 116.541, 106.793], ['A', ' HE2', 155.098, 117.802, 106.23]] AA_SCO= 2.421052631578948 CA_SCO= 1.57678947368421
[['A', ' N ', 150.613, 114.441, 101.916], ['A', ' CA ', 150.373, 113.761, 100.672], ['A', ' C ', 149.254, 114.364, 99.918], ['A', ' O ', 148.837, 113.765, 98.924], ['A', ' CB ', 150.178, 112.245, 100.735], ['A', ' CG ', 151.386, 111.476, 101.032], ['A', ' CD ', 152.36, 111.422, 99.906], ['A', ' NE ', 152.119, 110.469, 98.8], ['A', ' CZ ', 152.725, 109.261, 98.689], ['A', ' NH1', 153.566, 108.884, 99.594], ['A', ' NH2', 152.512, 108.509, 97.646], ['A', ' H ', 149.978, 114.288, 102.712], ['A', ' HA ', 151.237, 113.936, 100.052], ['A', ' HB ', 149.438, 112.003, 101.499], ['A', ' HB ', 149.808, 111.874, 99.788], ['A', ' HG ', 151.874, 111.868, 101.912], ['A', ' HG ', 151.07, 110.492, 101.148], ['A', ' HD ', 152.41, 112.356, 99.443], ['A', ' HD ', 153.306, 111.195, 100.348], ['A', ' HE ', 151.497, 110.748, 98.067], ['A', ' HH1', 153.758, 109.455, 100.384], ['A', ' HH1', 154.114, 108.021, 99.487], ['A', ' HH2', 151.894, 108.788, 96.921], ['A', ' HH2', 153.006, 107.625, 97.505]] AA_SCO= 2.4763157894736847 CA_SCO= 1.6085789473684209
[['A', ' N ', 148.802, 115.563, 100.293], ['A', ' CA ', 147.809, 116.123, 99.409], ['A', ' C ', 148.484, 116.182, 98.042], ['A', ' O ', 147.921, 115.625, 97.106], ['A', ' CB ', 147.368, 117.56, 99.801], ['A', ' CG1', 146.59, 117.572, 101.104], ['A', ' CG2', 146.539, 118.192, 98.634], ['A', ' CD1', 146.418, 118.953, 101.74], ['A', ' H ', 149.147, 116.067, 101.114], ['A', ' HA ', 146.945, 115.469, 99.347], ['A', ' HB ', 148.229, 118.142, 99.971], ['A', ' HG1', 145.603, 117.162, 100.925], ['A', ' HG1', 147.103, 116.949, 101.805], ['A', ' HG2', 146.258, 119.201, 98.891], ['A', ' HG2', 147.126, 118.225, 97.712], ['A', ' HG2', 145.64, 117.603, 98.454], ['A', ' HD1', 145.859, 118.856, 102.673], ['A', ' HD1', 147.403, 119.37, 101.954], ['A', ' HD1', 145.885, 119.624, 101.079]] AA_SCO= 2.4373684210526316 CA_SCO= 1.6123157894736841
[['A', ' N ', 149.742, 116.727, 97.954], ['A', ' CA ', 150.515, 116.816, 96.729], ['A', ' C ', 151.991, 116.717, 97.043], ['A', ' O ', 152.531, 117.48, 97.85], ['A', ' CB ', 150.196, 118.136, 95.997], ['A', ' SG ', 150.914, 118.297, 94.365], ['A', ' H ', 150.129, 117.128, 98.795], ['A', ' HA ', 150.276, 115.965, 96.096], ['A', ' HB ', 149.118, 118.261, 95.901], ['A', ' HB ', 150.539, 118.972, 96.595]] AA_SCO= 2.434736842105263 CA_SCO= 1.578578947368421
[['A', ' N ', 152.678, 115.859, 96.313], ['A', ' CA ', 154.096, 115.609, 96.515], ['A', ' C ', 154.925, 116.617, 95.788], ['A', ' O ', 156.151, 116.609, 95.838], ['A', ' H ', 152.189, 115.318, 95.597], ['A', ' HA ', 154.332, 115.656, 97.576], ['A', ' HA ', 154.337, 114.619, 96.17]] AA_SCO= 2.554210526315789 CA_SCO= 1.5784736842105263
[['A', ' N ', 154.235, 117.513, 95.132], ['A', ' CA ', 154.849, 118.55, 94.388], ['A', ' C ', 154.584, 119.876, 95.123], ['A', ' O ', 155.046, 120.928, 94.686], ['A', ' CB ', 154.35, 118.451, 92.944], ['A', ' CG1', 154.857, 119.538, 92.113], ['A', ' CG2', 154.784, 117.088, 92.4], ['A', ' H ', 153.227, 117.45, 95.144], ['A', ' HA ', 155.925, 118.385, 94.372], ['A', ' HB ', 153.282, 118.519, 92.917], ['A', ' HG1', 154.477, 119.395, 91.1], ['A', ' HG1', 154.519, 120.485, 92.487], ['A', ' HG1', 155.949, 119.517, 92.101], ['A', ' HG2', 154.428, 116.975, 91.375], ['A', ' HG2', 155.87, 117.014, 92.417], ['A', ' HG2', 154.364, 116.287, 93.003]] AA_SCO= 2.412105263157894 CA_SCO= 1.5797894736842106
[['A', ' N ', 153.802, 119.82, 96.228], ['A', ' CA ', 153.578, 120.973, 97.088], ['A', ' C ', 153.557, 120.609, 98.593], ['A', ' O ', 152.805, 121.23, 99.358], ['A', ' CB ', 152.245, 121.626, 96.767], ['A', ' SG ', 152.135, 122.2, 95.138], ['A', ' H ', 153.424, 118.928, 96.551], ['A', ' HA ', 154.379, 121.695, 96.92], ['A', ' HB ', 151.462, 120.918, 96.923], ['A', ' HB ', 152.061, 122.462, 97.444], ['A', ' HG ', 153.198, 121.493, 94.702]] AA_SCO= 2.3821052631578943 CA_SCO= 1.511368421052632
[['A', ' N ', 154.433, 119.703, 99.063], ['A', ' CA ', 154.573, 119.299, 100.414], ['A', ' C ', 155.243, 120.489, 100.893], ['A', ' O ', 155.749, 121.199, 100.044], ['A', ' CB ', 155.503, 118.141, 100.351], ['A', ' CG ', 156.355, 118.473, 99.171], ['A', ' CD ', 155.446, 119.105, 98.23], ['A', ' HA ', 153.597, 119.109, 100.889], ['A', ' HB ', 156.078, 118.061, 101.279], ['A', ' HB ', 154.943, 117.198, 100.224], ['A', ' HG ', 157.209, 119.102, 99.464], ['A', ' HG ', 156.772, 117.565, 98.724], ['A', ' HD ', 155.978, 119.817, 97.627], ['A', ' HD ', 155.046, 118.296, 97.709]] AA_SCO= 2.4036842105263156 CA_SCO= 1.511421052631579
[['A', ' N ', 155.297, 120.7, 102.177], ['A', ' CA ', 155.962, 121.837, 102.784], ['A', ' C ', 154.871, 122.88, 102.997], ['A', ' O ', 154.391, 122.918, 104.116], ['A', ' CB ', 157.237, 122.285, 102.047], ['A', ' CG1', 158.22, 121.142, 102.089], ['A', ' CG2', 157.771, 123.477, 102.777], ['A', ' CD1', 159.263, 121.246, 101.107], ['A', ' H ', 154.854, 120.022, 102.777], ['A', ' HA ', 156.313, 121.541, 103.77], ['A', ' HB ', 157.121, 122.562, 101.058], ['A', ' HG1', 158.688, 121.114, 103.054], ['A', ' HG1', 157.713, 120.205, 101.917], ['A', ' HG2', 158.692, 123.811, 102.324], ['A', ' HG2', 157.059, 124.275, 102.74], ['A', ' HG2', 157.948, 123.203, 103.816], ['A', ' HD1', 159.893, 120.383, 101.183], ['A', ' HD1', 158.801, 121.246, 100.136], ['A', ' HD1', 159.84, 122.147, 101.243]] AA_SCO= 2.3984210526315786 CA_SCO= 1.5063684210526316
[['A', ' N ', 154.334, 123.685, 102.044], ['A', ' CA ', 153.252, 124.562, 102.367], ['A', ' C ', 152.102, 123.821, 102.998], ['A', ' O ', 151.492, 124.324, 103.935], ['A', ' CB ', 152.812, 125.056, 101.019], ['A', ' CG ', 154.013, 124.995, 100.187], ['A', ' CD ', 154.742, 123.798, 100.647], ['A', ' HA ', 153.605, 125.356, 103.017], ['A', ' HB ', 151.971, 124.441, 100.638], ['A', ' HB ', 152.428, 126.066, 101.154], ['A', ' HG ', 153.705, 124.851, 99.151], ['A', ' HG ', 154.572, 125.904, 100.211], ['A', ' HD ', 154.382, 122.992, 100.05], ['A', ' HD ', 155.769, 124.008, 100.514]] AA_SCO= 2.4647368421052627 CA_SCO= 1.5042631578947367
[['A', ' N ', 151.873, 122.569, 102.606], ['A', ' CA ', 150.75, 121.893, 103.21], ['A', ' C ', 150.97, 121.623, 104.685], ['A', ' O ', 150.019, 121.647, 105.469], ['A', ' CB ', 150.472, 120.56, 102.534], ['A', ' CG ', 150.05, 120.673, 101.134], ['A', ' ND1', 149.356, 121.74, 100.649], ['A', ' CD2', 150.226, 119.84, 100.094], ['A', ' CE1', 149.131, 121.569, 99.384], ['A', ' NE2', 149.632, 120.419, 99.008], ['A', ' H ', 152.351, 122.141, 101.799], ['A', ' HA ', 149.862, 122.518, 103.113], ['A', ' HB ', 151.363, 119.936, 102.573], ['A', ' HB ', 149.687, 120.038, 103.076], ['A', ' HD1', 149.09, 122.618, 101.11], ['A', ' HD2', 150.72, 118.871, 99.999], ['A', ' HE1', 148.615, 122.326, 98.849]] AA_SCO= 2.382631578947368 CA_SCO= 1.666578947368421
[['A', ' N ', 152.208, 121.337, 105.079], ['A', ' CA ', 152.448, 120.987, 106.466], ['A', ' C ', 152.574, 122.262, 107.259], ['A', ' O ', 152.147, 122.342, 108.403], ['A', ' CB ', 153.692, 120.085, 106.638], ['A', ' OG1', 153.601, 119.403, 107.878], ['A', ' CG2', 154.997, 120.87, 106.659], ['A', ' H ', 152.985, 121.409, 104.435], ['A', ' HA ', 151.592, 120.436, 106.851], ['A', ' HB ', 153.72, 119.373, 105.832], ['A', ' HG1', 153.058, 118.58, 107.794], ['A', ' HG2', 155.823, 120.17, 106.792], ['A', ' HG2', 155.131, 121.393, 105.751], ['A', ' HG2', 155.003, 121.565, 107.482]] AA_SCO= 2.392105263157895 CA_SCO= 1.6579473684210526
[['A', ' N ', 153.137, 123.283, 106.64], ['A', ' CA ', 153.314, 124.544, 107.31], ['A', ' C ', 151.972, 125.207, 107.521], ['A', ' O ', 151.799, 125.941, 108.479], ['A', ' CB ', 154.234, 125.419, 106.477], ['A', ' CG ', 155.678, 124.975, 106.396], ['A', ' CD1', 156.328, 125.739, 105.373], ['A', ' CD2', 156.389, 125.245, 107.672], ['A', ' H ', 153.476, 123.165, 105.686], ['A', ' HA ', 153.751, 124.357, 108.285], ['A', ' HB ', 153.85, 125.424, 105.464], ['A', ' HB ', 154.205, 126.436, 106.867], ['A', ' HG ', 155.727, 123.916, 106.151], ['A', ' HD1', 157.37, 125.437, 105.3], ['A', ' HD1', 155.831, 125.561, 104.43], ['A', ' HD1', 156.28, 126.795, 105.626], ['A', ' HD2', 157.432, 124.935, 107.577], ['A', ' HD2', 156.345, 126.31, 107.876], ['A', ' HD2', 155.935, 124.709, 108.476]] AA_SCO= 2.3889473684210527 CA_SCO= 1.637263157894737
[['A', ' N ', 151.036, 124.993, 106.595], ['A', ' CA ', 149.688, 125.52, 106.701], ['A', ' C ', 148.797, 124.686, 107.649], ['A', ' O ', 147.917, 125.273, 108.288], ['A', ' CB ', 149.048, 125.61, 105.331], ['A', ' H ', 151.279, 124.462, 105.765], ['A', ' HA ', 149.759, 126.524, 107.118], ['A', ' HB ', 148.055, 126.044, 105.415], ['A', ' HB ', 149.642, 126.22, 104.668], ['A', ' HB ', 148.978, 124.614, 104.913]] AA_SCO= 2.277368421052632 CA_SCO= 1.6340000000000001
[['A', ' N ', 148.964, 123.333, 107.767], ['A', ' CA ', 148.102, 122.644, 108.751], ['A', ' C ', 148.644, 122.957, 110.15], ['A', ' O ', 147.882, 123.151, 111.104], ['A', ' CB ', 148.055, 121.153, 108.542], ['A', ' OG ', 149.243, 120.537, 108.91], ['A', ' H ', 149.6, 122.802, 107.168], ['A', ' HA ', 147.091, 123.038, 108.67], ['A', ' HB ', 147.229, 120.726, 109.106], ['A', ' HB ', 147.862, 120.965, 107.492], ['A', ' HG ', 149.188, 119.648, 108.541]] AA_SCO= 2.251052631578948 CA_SCO= 1.6647368421052635
[['A', ' N ', 149.958, 123.127, 110.241], ['A', ' CA ', 150.649, 123.593, 111.425], ['A', ' C ', 150.328, 125.037, 111.181], ['A', ' O ', 149.74, 125.293, 110.159], ['A', ' CB ', 152.146, 123.23, 111.416], ['A', ' CG1', 152.875, 123.823, 112.611], ['A', ' CG2', 152.26, 121.711, 111.454], ['A', ' H ', 150.533, 122.902, 109.426], ['A', ' HA ', 150.172, 123.244, 112.338], ['A', ' HB ', 152.607, 123.62, 110.512], ['A', ' HG1', 153.92, 123.535, 112.573], ['A', ' HG1', 152.817, 124.887, 112.605], ['A', ' HG1', 152.436, 123.467, 113.527], ['A', ' HG2', 153.295, 121.407, 111.431], ['A', ' HG2', 151.799, 121.349, 112.352], ['A', ' HG2', 151.748, 121.282, 110.593]] AA_SCO= 2.16 CA_SCO= 1.675789473684211
[['A', ' N ', 150.441, 125.936, 112.11], ['A', ' CA ', 149.979, 127.322, 111.845], ['A', ' C ', 148.441, 127.366, 111.976], ['A', ' O ', 147.921, 128.022, 112.873], ['A', ' CB ', 150.392, 127.882, 110.46], ['A', ' CG ', 150.15, 129.377, 110.271], ['A', ' CD ', 151.075, 130.254, 111.017], ['A', ' OE1', 152.149, 129.825, 111.318], ['A', ' OE2', 150.711, 131.371, 111.282], ['A', ' H ', 150.932, 125.69, 112.982], ['A', ' HA ', 150.413, 127.992, 112.575], ['A', ' HB ', 151.442, 127.671, 110.269], ['A', ' HB ', 149.809, 127.465, 109.653], ['A', ' HG ', 150.199, 129.617, 109.209], ['A', ' HG ', 149.153, 129.601, 110.624]] AA_SCO= 2.0410526315789475 CA_SCO= 1.6770000000000003
[['A', ' N ', 147.674, 126.608, 111.175], ['A', ' CA ', 146.228, 126.569, 111.429], ['A', ' C ', 145.999, 126.026, 112.832], ['A', ' O ', 145.138, 126.505, 113.575], ['A', ' CB ', 145.511, 125.729, 110.406], ['A', ' H ', 148.091, 126.078, 110.389], ['A', ' HA ', 145.843, 127.587, 111.386], ['A', ' HB ', 144.441, 125.734, 110.614], ['A', ' HB ', 145.697, 126.149, 109.426], ['A', ' HB ', 145.882, 124.711, 110.438]] AA_SCO= 1.9489473684210528 CA_SCO= 1.6781578947368423
[['A', ' N ', 146.813, 125.048, 113.213], ['A', ' CA ', 146.793, 124.49, 114.545], ['A', ' C ', 147.524, 125.437, 115.509], ['A', ' O ', 147.092, 125.597, 116.639], ['A', ' CB ', 147.303, 123.049, 114.612], ['A', ' CG1', 146.304, 122.143, 113.848], ['A', ' CG2', 147.403, 122.634, 116.075], ['A', ' CD1', 146.775, 120.726, 113.583], ['A', ' H ', 147.43, 124.633, 112.507], ['A', ' HA ', 145.757, 124.443, 114.864], ['A', ' HB ', 148.277, 122.965, 114.125], ['A', ' HG1', 145.377, 122.093, 114.416], ['A', ' HG1', 146.09, 122.61, 112.886], ['A', ' HG2', 147.735, 121.621, 116.166], ['A', ' HG2', 148.11, 123.275, 116.596], ['A', ' HG2', 146.42, 122.728, 116.541], ['A', ' HD1', 146.002, 120.188, 113.033], ['A', ' HD1', 147.691, 120.758, 112.983], ['A', ' HD1', 146.97, 120.209, 114.513]] AA_SCO= 2.043684210526316 CA_SCO= 1.6781578947368427
[['A', ' N ', 148.631, 126.097, 115.083], ['A', ' CA ', 149.368, 126.993, 116.011], ['A', ' C ', 148.394, 128.102, 116.433], ['A', ' O ', 148.555, 128.762, 117.458], ['A', ' CB ', 150.539, 127.816, 115.404], ['A', ' CG ', 151.748, 127.066, 114.75], ['A', ' OD1', 151.694, 125.871, 114.622], ['A', ' OD2', 152.685, 127.731, 114.305], ['A', ' H ', 148.966, 125.946, 114.143], ['A', ' HA ', 149.688, 126.436, 116.878], ['A', ' HB ', 150.128, 128.535, 114.699], ['A', ' HB ', 150.959, 128.415, 116.218]] AA_SCO= 1.9842105263157896 CA_SCO= 1.6417894736842111
[['A', ' N ', 147.426, 128.398, 115.568], ['A', ' CA ', 146.383, 129.352, 115.865], ['A', ' C ', 145.228, 128.709, 116.671], ['A', ' O ', 144.767, 129.291, 117.646], ['A', ' CB ', 145.877, 129.978, 114.56], ['A', ' CG ', 144.929, 131.166, 114.761], ['A', ' OD1', 145.126, 131.877, 115.713], ['A', ' OD2', 144.034, 131.388, 113.948], ['A', ' H ', 147.436, 127.963, 114.65], ['A', ' HA ', 146.814, 130.144, 116.478], ['A', ' HB ', 146.737, 130.312, 113.969], ['A', ' HB ', 145.381, 129.213, 113.965]] AA_SCO= 1.9452631578947366 CA_SCO= 1.6306842105263164
[['A', ' N ', 144.751, 127.495, 116.302], ['A', ' CA ', 143.604, 126.93, 117.032], ['A', ' C ', 143.954, 126.637, 118.486], ['A', ' O ', 143.1, 126.72, 119.372], ['A', ' CB ', 143.137, 125.638, 116.408], ['A', ' OG ', 144.031, 124.605, 116.666], ['A', ' H ', 145.11, 127.006, 115.481], ['A', ' HA ', 142.799, 127.654, 116.999], ['A', ' HB ', 142.154, 125.379, 116.785], ['A', ' HB ', 143.051, 125.777, 115.331], ['A', ' HG ', 143.694, 123.838, 116.203]] AA_SCO= 1.9794736842105263 CA_SCO= 1.630684210526316
[['A', ' N ', 145.208, 126.324, 118.726], ['A', ' CA ', 145.76, 126.125, 120.04], ['A', ' C ', 146.592, 127.352, 120.191], ['A', ' O ', 147.294, 127.677, 119.263], ['A', ' CB ', 146.666, 124.901, 120.049], ['A', ' CG ', 146.045, 123.577, 119.698], ['A', ' CD1', 147.14, 122.538, 119.611], ['A', ' CD2', 145.051, 123.21, 120.75], ['A', ' H ', 145.834, 126.203, 117.925], ['A', ' HA ', 144.988, 126.105, 120.804], ['A', ' HB ', 147.434, 125.081, 119.305], ['A', ' HB ', 147.142, 124.815, 121.028], ['A', ' HG ', 145.544, 123.638, 118.731], ['A', ' HD1', 146.71, 121.565, 119.368], ['A', ' HD1', 147.841, 122.82, 118.847], ['A', ' HD1', 147.657, 122.489, 120.548], ['A', ' HD2', 144.611, 122.259, 120.509], ['A', ' HD2', 145.539, 123.145, 121.726], ['A', ' HD2', 144.281, 123.96, 120.784]] AA_SCO= 2.0047368421052636 CA_SCO= 1.2684736842105262
[['A', ' N ', 146.662, 127.992, 121.325], ['A', ' CA ', 147.487, 129.195, 121.304], ['A', ' C ', 148.961, 128.887, 121.503], ['A', ' O ', 149.466, 128.863, 122.627], ['A', ' CB ', 146.973, 130.172, 122.355], ['A', ' CG ', 145.606, 130.725, 121.955], ['A', ' OD1', 145.471, 131.221, 120.857], ['A', ' OD2', 144.654, 130.617, 122.708], ['A', ' H ', 146.118, 127.72, 122.13], ['A', ' HA ', 147.378, 129.669, 120.325], ['A', ' HB ', 146.893, 129.671, 123.32], ['A', ' HB ', 147.677, 130.997, 122.465]] AA_SCO= 1.9900000000000002 CA_SCO= 1.2667368421052632
[['A', ' N ', 149.651, 128.636, 120.392], ['A', ' CA ', 151.045, 128.229, 120.431], ['A', ' C ', 151.982, 129.308, 119.924], ['A', ' O ', 151.896, 129.726, 118.771], ['A', ' CB ', 151.235, 126.967, 119.584], ['A', ' CG1', 150.356, 125.862, 120.151], ['A', ' CG2', 152.668, 126.544, 119.556], ['A', ' CD1', 150.264, 124.598, 119.33], ['A', ' H ', 149.15, 128.672, 119.482], ['A', ' HA ', 151.312, 128.004, 121.463], ['A', ' HB ', 150.911, 127.176, 118.581], ['A', ' HG1', 150.724, 125.623, 121.11], ['A', ' HG1', 149.355, 126.245, 120.262], ['A', ' HG2', 152.782, 125.667, 118.942], ['A', ' HG2', 153.296, 127.33, 119.14], ['A', ' HG2', 152.971, 126.326, 120.572], ['A', ' HD1', 149.624, 123.908, 119.847], ['A', ' HD1', 149.852, 124.804, 118.355], ['A', ' HD1', 151.233, 124.14, 119.212]] AA_SCO= 2.128421052631579 CA_SCO= 1.2650526315789474
[['A', ' N ', 152.904, 129.74, 120.774], ['A', ' CA ', 153.852, 130.76, 120.366], ['A', ' C ', 155.182, 130.154, 119.978], ['A', ' O ', 155.906, 129.607, 120.81], ['A', ' CB ', 154.087, 131.785, 121.466], ['A', ' CG ', 155.067, 132.888, 121.056], ['A', ' CD ', 155.294, 133.915, 122.112], ['A', ' OE1', 154.677, 133.835, 123.144], ['A', ' OE2', 156.093, 134.792, 121.884], ['A', ' H ', 152.929, 129.365, 121.714], ['A', ' HA ', 153.45, 131.28, 119.496], ['A', ' HB ', 153.14, 132.25, 121.742], ['A', ' HB ', 154.485, 131.291, 122.351], ['A', ' HG ', 156.032, 132.442, 120.808], ['A', ' HG ', 154.687, 133.375, 120.162]] AA_SCO= 2.1484210526315795 CA_SCO= 1.1014736842105262
[['A', ' N ', 155.511, 130.275, 118.712], ['A', ' CA ', 156.723, 129.701, 118.18], ['A', ' C ', 157.826, 130.772, 118.169], ['A', ' O ', 157.599, 131.833, 117.597], ['A', ' CB ', 156.447, 129.191, 116.769], ['A', ' CG1', 157.694, 128.617, 116.191], ['A', ' CG2', 155.318, 128.156, 116.827], ['A', ' H ', 154.865, 130.751, 118.097], ['A', ' HA ', 156.982, 128.853, 118.799], ['A', ' HB ', 156.147, 130.024, 116.136], ['A', ' HG1', 157.505, 128.273, 115.179], ['A', ' HG1', 158.464, 129.373, 116.171], ['A', ' HG1', 158.034, 127.772, 116.797], ['A', ' HG2', 155.096, 127.783, 115.828], ['A', ' HG2', 155.618, 127.332, 117.459], ['A', ' HG2', 154.414, 128.603, 117.236]] AA_SCO= 1.9457894736842105 CA_SCO= 1.075842105263158
[['A', ' N ', 158.987, 130.547, 118.808], ['A', ' CA ', 160.111, 131.469, 118.935], ['A', ' C ', 160.864, 131.634, 117.633], ['A', ' O ', 160.797, 130.754, 116.775], ['A', ' CB ', 160.984, 130.786, 119.988], ['A', ' CG ', 160.69, 129.326, 119.837], ['A', ' CD ', 159.225, 129.247, 119.472], ['A', ' HA ', 159.739, 132.441, 119.296], ['A', ' HB ', 162.05, 131.008, 119.795], ['A', ' HB ', 160.748, 131.172, 120.989], ['A', ' HG ', 161.339, 128.891, 119.058], ['A', ' HG ', 160.926, 128.784, 120.768], ['A', ' HD ', 159.113, 128.404, 118.777], ['A', ' HD ', 158.598, 129.139, 120.378]] AA_SCO= 1.9131578947368422 CA_SCO= 1.0908947368421054
[['A', ' N ', 161.651, 132.696, 117.493], ['A', ' CA ', 162.424, 132.789, 116.268], ['A', ' C ', 163.611, 131.858, 116.279], ['A', ' O ', 164.567, 131.987, 117.038], ['A', ' CB ', 162.865, 134.21, 115.984], ['A', ' CG ', 161.733, 135.122, 115.598], ['A', ' CD ', 162.241, 136.51, 115.266], ['A', ' CE ', 161.109, 137.428, 114.83], ['A', ' NZ ', 161.599, 138.798, 114.503], ['A', ' H ', 161.708, 133.412, 118.206], ['A', ' HA ', 161.793, 132.481, 115.441], ['A', ' HB ', 163.352, 134.623, 116.866], ['A', ' HB ', 163.595, 134.21, 115.18], ['A', ' HG ', 161.23, 134.709, 114.72], ['A', ' HG ', 161.013, 135.18, 116.413], ['A', ' HD ', 162.726, 136.939, 116.144], ['A', ' HD ', 162.974, 136.45, 114.463], ['A', ' HE ', 160.628, 137.005, 113.948], ['A', ' HE ', 160.375, 137.497, 115.633], ['A', ' HZ ', 160.823, 139.379, 114.217], ['A', ' HZ ', 162.038, 139.204, 115.319], ['A', ' HZ ', 162.272, 138.746, 113.752]] AA_SCO= 1.7726315789473683 CA_SCO= 1.0903684210526314
[['A', ' N ', 163.463, 130.914, 115.389], ['A', ' CA ', 164.251, 129.762, 115.035], ['A', ' C ', 163.184, 128.855, 114.489], ['A', ' O ', 163.036, 128.665, 113.286], ['A', ' CB ', 165.0, 129.154, 116.207], ['A', ' H ', 162.608, 131.005, 114.866], ['A', ' HA ', 164.952, 130.011, 114.241], ['A', ' HB ', 165.523, 128.256, 115.874], ['A', ' HB ', 165.73, 129.867, 116.579], ['A', ' HB ', 164.317, 128.892, 117.015]] AA_SCO= 1.84 CA_SCO= 1.109473684210526
[['A', ' N ', 162.264, 128.497, 115.366], ['A', ' CA ', 161.081, 127.747, 114.979], ['A', ' C ', 160.247, 128.559, 114.009], ['A', ' O ', 159.674, 128.026, 113.079], ['A', ' H ', 162.413, 128.707, 116.345], ['A', ' HA ', 161.368, 126.809, 114.511], ['A', ' HA ', 160.497, 127.498, 115.864]] AA_SCO= 1.844736842105263 CA_SCO= 1.119315789473684
[['A', ' N ', 160.246, 129.879, 114.175], ['A', ' CA ', 159.501, 130.791, 113.315], ['A', ' C ', 160.371, 131.328, 112.173], ['A', ' O ', 159.956, 132.227, 111.455], ['A', ' CB ', 158.964, 131.972, 114.139], ['A', ' CG ', 157.949, 132.926, 113.449], ['A', ' CD ', 157.61, 134.096, 114.293], ['A', ' NE ', 156.813, 133.757, 115.462], ['A', ' CZ ', 156.565, 134.598, 116.495], ['A', ' NH1', 157.064, 135.817, 116.501], ['A', ' NH2', 155.811, 134.207, 117.502], ['A', ' H ', 160.693, 130.233, 115.018], ['A', ' HA ', 158.656, 130.252, 112.891], ['A', ' HB ', 158.5, 131.594, 115.047], ['A', ' HB ', 159.79, 132.589, 114.445], ['A', ' HG ', 158.312, 133.353, 112.536], ['A', ' HG ', 157.032, 132.377, 113.247], ['A', ' HD ', 158.541, 134.549, 114.633], ['A', ' HD ', 157.052, 134.815, 113.696], ['A', ' HE ', 156.408, 132.83, 115.504], ['A', ' HH1', 157.637, 136.131, 115.739], ['A', ' HH1', 156.872, 136.436, 117.277], ['A', ' HH2', 155.418, 133.28, 117.5], ['A', ' HH2', 155.622, 134.842, 118.265]] AA_SCO= 1.893684210526316 CA_SCO= 1.145052631578947
[['A', ' N ', 161.607, 130.857, 112.035], ['A', ' CA ', 162.445, 131.333, 110.938], ['A', ' C ', 162.54, 130.252, 109.919], ['A', ' O ', 162.319, 130.474, 108.747], ['A', ' CB ', 163.849, 131.689, 111.4], ['A', ' CG ', 163.974, 132.793, 112.421], ['A', ' CD1', 165.425, 132.915, 112.811], ['A', ' CD2', 163.464, 134.099, 111.864], ['A', ' H ', 161.933, 130.093, 112.619], ['A', ' HA ', 161.978, 132.188, 110.456], ['A', ' HB ', 164.304, 130.795, 111.819], ['A', ' HB ', 164.422, 131.98, 110.527], ['A', ' HG ', 163.403, 132.544, 113.288], ['A', ' HD1', 165.534, 133.696, 113.562], ['A', ' HD1', 165.776, 131.975, 113.222], ['A', ' HD1', 166.016, 133.171, 111.931], ['A', ' HD2', 163.575, 134.877, 112.615], ['A', ' HD2', 164.036, 134.373, 110.976], ['A', ' HD2', 162.411, 134.017, 111.602]] AA_SCO= 1.7342105263157892 CA_SCO= 1.1441052631578947
[['A', ' N ', 162.612, 129.022, 110.381], ['A', ' CA ', 162.804, 127.839, 109.562], ['A', ' C ', 161.461, 127.293, 109.05], ['A', ' O ', 161.256, 126.089, 108.899], ['A', ' CB ', 163.451, 126.794, 110.469], ['A', ' CG ', 164.796, 127.165, 111.126], ['A', ' CD1', 165.221, 126.042, 112.073], ['A', ' CD2', 165.802, 127.407, 110.1], ['A', ' H ', 162.688, 128.894, 111.385], ['A', ' HA ', 163.426, 128.088, 108.704], ['A', ' HB ', 162.748, 126.557, 111.279], ['A', ' HB ', 163.608, 125.924, 109.9], ['A', ' HG ', 164.692, 128.065, 111.71], ['A', ' HD1', 166.16, 126.308, 112.551], ['A', ' HD1', 164.455, 125.903, 112.843], ['A', ' HD1', 165.345, 125.113, 111.521], ['A', ' HD2', 166.718, 127.643, 110.568], ['A', ' HD2', 165.932, 126.539, 109.518], ['A', ' HD2', 165.508, 128.232, 109.468]] AA_SCO= 1.7657894736842104 CA_SCO= 1.1490000000000002
[['A', ' N ', 160.532, 128.208, 108.824], ['A', ' CA ', 159.193, 127.96, 108.331], ['A', ' C ', 159.24, 128.645, 107.007], ['A', ' O ', 158.484, 128.344, 106.092], ['A', ' CB ', 158.149, 128.569, 109.234], ['A', ' CG ', 158.219, 128.072, 110.629], ['A', ' CD ', 157.688, 126.686, 110.885], ['A', ' NE ', 156.231, 126.637, 110.746], ['A', ' CZ ', 155.341, 126.976, 111.721], ['A', ' NH1', 155.719, 127.376, 112.894], ['A', ' NH2', 154.056, 126.926, 111.531], ['A', ' H ', 160.867, 129.168, 108.855], ['A', ' HA ', 159.022, 126.895, 108.187], ['A', ' HB ', 158.271, 129.652, 109.251], ['A', ' HB ', 157.165, 128.348, 108.858], ['A', ' HG ', 159.264, 128.049, 110.85], ['A', ' HG ', 157.72, 128.769, 111.289], ['A', ' HD ', 158.124, 125.981, 110.175], ['A', ' HD ', 157.958, 126.371, 111.895], ['A', ' HE ', 155.855, 126.343, 109.859], ['A', ' HH1', 156.703, 127.456, 113.114], ['A', ' HH1', 154.966, 127.609, 113.579], ['A', ' HH2', 153.654, 126.634, 110.642], ['A', ' HH2', 153.452, 127.216, 112.33]] AA_SCO= 1.7463157894736838 CA_SCO= 1.1481578947368423
[['A', ' N ', 160.144, 129.617, 106.958], ['A', ' CA ', 160.499, 130.322, 105.757], ['A', ' C ', 161.885, 129.716, 105.664], ['A', ' O ', 162.157, 128.862, 106.501], ['A', ' CB ', 160.353, 131.842, 105.808], ['A', ' CG ', 161.059, 132.582, 106.858], ['A', ' CD ', 160.862, 134.06, 106.678], ['A', ' OE1', 160.611, 134.463, 105.569], ['A', ' OE2', 160.959, 134.791, 107.625], ['A', ' H ', 160.713, 129.818, 107.783], ['A', ' HA ', 159.909, 129.97, 104.912], ['A', ' HB ', 160.672, 132.253, 104.85], ['A', ' HB ', 159.301, 132.084, 105.915], ['A', ' HG ', 160.656, 132.288, 107.832], ['A', ' HG ', 162.108, 132.335, 106.842]] AA_SCO= 1.833157894736842 CA_SCO= 1.1398947368421053
[['A', ' N ', 162.718, 130.007, 104.661], ['A', ' CA ', 163.974, 129.227, 104.42], ['A', ' C ', 163.511, 127.903, 103.808], ['A', ' O ', 163.81, 127.586, 102.664], ['A', ' CB ', 164.855, 128.949, 105.641], ['A', ' CG ', 166.12, 128.107, 105.354], ['A', ' CD1', 167.031, 128.813, 104.382], ['A', ' CD2', 166.825, 127.847, 106.642], ['A', ' H ', 162.464, 130.745, 104.028], ['A', ' HA ', 164.559, 129.764, 103.684], ['A', ' HB ', 165.149, 129.88, 106.048], ['A', ' HB ', 164.335, 128.394, 106.392], ['A', ' HG ', 165.832, 127.155, 104.916], ['A', ' HD1', 167.911, 128.2, 104.206], ['A', ' HD1', 166.537, 128.965, 103.444], ['A', ' HD1', 167.327, 129.768, 104.789], ['A', ' HD2', 167.701, 127.235, 106.45], ['A', ' HD2', 167.129, 128.787, 107.103], ['A', ' HD2', 166.15, 127.317, 107.294]] AA_SCO= 1.8631578947368421 CA_SCO= 1.1393684210526316
[['A', ' N ', 162.735, 127.186, 104.601], ['A', ' CA ', 161.873, 126.104, 104.243], ['A', ' C ', 160.92, 126.926, 103.368], ['A', ' O ', 160.792, 128.119, 103.601], ['A', ' CB ', 161.136, 125.573, 105.494], ['A', ' OG1', 162.069, 125.162, 106.502], ['A', ' CG2', 160.327, 124.414, 105.139], ['A', ' H ', 162.676, 127.494, 105.562], ['A', ' HA ', 162.383, 125.333, 103.667], ['A', ' HB ', 160.507, 126.37, 105.896], ['A', ' HG1', 161.647, 125.249, 107.412], ['A', ' HG2', 159.811, 124.057, 106.027], ['A', ' HG2', 159.613, 124.708, 104.405], ['A', ' HG2', 160.97, 123.627, 104.742]] AA_SCO= 1.795263157894737 CA_SCO= 1.0716315789473683
[['A', ' N ', 160.378, 126.394, 102.3], ['A', ' CA ', 159.51, 127.157, 101.365], ['A', ' C ', 160.29, 128.045, 100.456], ['A', ' O ', 160.09, 128.036, 99.251], ['A', ' CB ', 158.497, 128.117, 101.978], ['A', ' CG ', 157.426, 127.576, 102.688], ['A', ' CD1', 156.742, 128.676, 103.333], ['A', ' CD2', 156.473, 126.891, 101.75], ['A', ' H ', 160.587, 125.416, 102.13], ['A', ' HA ', 158.966, 126.454, 100.768], ['A', ' HB ', 158.958, 128.877, 102.575], ['A', ' HB ', 158.049, 128.648, 101.137], ['A', ' HG ', 157.798, 126.895, 103.433], ['A', ' HD1', 155.918, 128.292, 103.905], ['A', ' HD1', 157.448, 129.17, 103.992], ['A', ' HD1', 156.381, 129.373, 102.586], ['A', ' HD2', 155.644, 126.511, 102.315], ['A', ' HD2', 156.111, 127.612, 101.016], ['A', ' HD2', 156.937, 126.07, 101.238]] AA_SCO= 1.849473684210526 CA_SCO= 1.2085263157894737
[['A', ' N ', 161.133, 128.894, 100.994], ['A', ' CA ', 161.9, 129.701, 100.075], ['A', ' C ', 162.709, 128.7, 99.223], ['A', ' O ', 162.709, 128.723, 97.979], ['A', ' CB ', 162.729, 130.682, 100.856], ['A', ' H ', 161.228, 128.91, 102.009], ['A', ' HA ', 161.222, 130.245, 99.416], ['A', ' HB ', 163.307, 131.266, 100.191], ['A', ' HB ', 162.071, 131.328, 101.433], ['A', ' HB ', 163.378, 130.137, 101.521]] AA_SCO= 1.8431578947368419 CA_SCO= 1.2193157894736841
[['A', ' N ', 163.269, 127.712, 99.91], ['A', ' CA ', 163.868, 126.573, 99.289], ['A', ' C ', 162.696, 125.629, 99.241], ['A', ' O ', 162.163, 125.24, 100.271], ['A', ' CB ', 165.046, 126.047, 100.063], ['A', ' H ', 163.281, 127.743, 100.927], ['A', ' HA ', 164.167, 126.815, 98.275], ['A', ' HB ', 165.424, 125.148, 99.582], ['A', ' HB ', 165.821, 126.814, 100.086], ['A', ' HB ', 164.733, 125.812, 101.075]] AA_SCO= 1.7752631578947367 CA_SCO= 1.2178947368421054
[['A', ' N ', 162.223, 125.388, 98.055], ['A', ' CA ', 161.008, 124.663, 97.735], ['A', ' C ', 160.324, 125.438, 96.65], ['A', ' O ', 160.038, 124.883, 95.593], ['A', ' CB ', 160.062, 124.451, 98.874], ['A', ' CG ', 158.869, 123.857, 98.419], ['A', ' ND1', 158.835, 122.607, 97.897], ['A', ' CD2', 157.617, 124.321, 98.379], ['A', ' CE1', 157.62, 122.32, 97.544], ['A', ' NE2', 156.845, 123.344, 97.826], ['A', ' H ', 162.757, 125.782, 97.303], ['A', ' HA ', 161.251, 123.685, 97.362], ['A', ' HB ', 160.481, 123.784, 99.619], ['A', ' HB ', 159.845, 125.36, 99.293], ['A', ' HD1', 159.603, 121.979, 97.786], ['A', ' HD2', 157.175, 125.267, 98.683], ['A', ' HE1', 157.407, 121.368, 97.087]] AA_SCO= 1.786315789473684 CA_SCO= 1.6087368421052632
[['A', ' N ', 160.138, 126.743, 96.839], ['A', ' CA ', 159.6, 127.519, 95.755], ['A', ' C ', 160.582, 127.411, 94.634], ['A', ' O ', 160.227, 127.003, 93.535], ['A', ' CB ', 159.461, 128.997, 96.101], ['A', ' CG ', 158.377, 129.348, 96.995], ['A', ' ND1', 158.098, 130.64, 97.297], ['A', ' CD2', 157.491, 128.608, 97.673], ['A', ' CE1', 157.069, 130.692, 98.091], ['A', ' NE2', 156.675, 129.481, 98.343], ['A', ' H ', 160.301, 127.19, 97.738], ['A', ' HA ', 158.648, 127.121, 95.431], ['A', ' HB ', 160.38, 129.324, 96.58], ['A', ' HB ', 159.348, 129.585, 95.187], ['A', ' HD2', 157.437, 127.527, 97.673], ['A', ' HE1', 156.612, 131.595, 98.479], ['A', ' HE2', 155.872, 129.279, 98.947]] AA_SCO= 1.8173684210526317 CA_SCO= 1.610578947368421
[['A', ' N ', 161.867, 127.524, 94.935], ['A', ' CA ', 162.836, 127.401, 93.857], ['A', ' C ', 162.709, 126.015, 93.215], ['A', ' O ', 162.772, 125.884, 91.993], ['A', ' CB ', 164.279, 127.62, 94.376], ['A', ' CG1', 165.322, 127.291, 93.275], ['A', ' CG2', 164.444, 129.074, 94.828], ['A', ' H ', 162.135, 127.838, 95.877], ['A', ' HA ', 162.618, 128.156, 93.105], ['A', ' HB ', 164.465, 126.948, 95.215], ['A', ' HG1', 166.331, 127.446, 93.667], ['A', ' HG1', 165.238, 126.249, 92.949], ['A', ' HG1', 165.168, 127.945, 92.421], ['A', ' HG2', 165.454, 129.218, 95.202], ['A', ' HG2', 164.269, 129.747, 93.984], ['A', ' HG2', 163.734, 129.305, 95.623]] AA_SCO= 1.8157894736842106 CA_SCO= 1.6123157894736841
[['A', ' N ', 162.528, 124.998, 94.047], ['A', ' CA ', 162.435, 123.61, 93.616], ['A', ' C ', 161.131, 123.286, 92.896], ['A', ' O ', 161.064, 122.284, 92.187], ['A', ' CB ', 162.495, 122.673, 94.797], ['A', ' CG ', 163.773, 122.734, 95.53], ['A', ' OD1', 164.733, 123.313, 95.046], ['A', ' ND2', 163.8, 122.15, 96.701], ['A', ' H ', 162.484, 125.217, 95.025], ['A', ' HA ', 163.257, 123.411, 92.932], ['A', ' HB ', 161.675, 122.864, 95.443], ['A', ' HB ', 162.366, 121.653, 94.437], ['A', ' HD2', 164.641, 122.149, 97.266], ['A', ' HD2', 162.989, 121.687, 97.044]] AA_SCO= 1.769473684210526 CA_SCO= 1.8479473684210528
[['A', ' N ', 160.08, 124.071, 93.145], ['A', ' CA ', 158.775, 123.856, 92.553], ['A', ' C ', 158.655, 124.612, 91.258], ['A', ' O ', 157.889, 124.215, 90.374], ['A', ' CB ', 157.707, 124.316, 93.49], ['A', ' OG ', 157.712, 123.557, 94.647], ['A', ' H ', 160.179, 124.874, 93.761], ['A', ' HA ', 158.651, 122.792, 92.348], ['A', ' HB ', 157.886, 125.358, 93.738], ['A', ' HB ', 156.737, 124.248, 93.004], ['A', ' HG ', 158.495, 123.873, 95.145]] AA_SCO= 1.9736842105263157 CA_SCO= 1.8732105263157894
[['A', ' N ', 159.395, 125.71, 91.136], ['A', ' CA ', 159.397, 126.432, 89.889], ['A', ' C ', 160.306, 125.601, 88.983], ['A', ' O ', 160.004, 125.371, 87.812], ['A', ' CB ', 159.836, 127.848, 90.093], ['A', ' CG ', 158.864, 128.62, 90.915], ['A', ' ND1', 157.528, 128.681, 90.607], ['A', ' CD2', 159.029, 129.377, 92.017], ['A', ' CE1', 156.915, 129.439, 91.492], ['A', ' NE2', 157.802, 129.867, 92.351], ['A', ' H ', 159.928, 126.046, 91.936], ['A', ' HA ', 158.401, 126.449, 89.453], ['A', ' HB ', 160.77, 127.813, 90.619], ['A', ' HB ', 159.975, 128.347, 89.138], ['A', ' HD2', 159.964, 129.57, 92.544], ['A', ' HE1', 155.849, 129.679, 91.514], ['A', ' HE2', 157.586, 130.492, 93.143]] AA_SCO= 2.0436842105263153 CA_SCO= 1.791315789473684
[['A', ' N ', 161.358, 125.03, 89.567], ['A', ' CA ', 162.128, 124.018, 88.883], ['A', ' C ', 161.061, 122.935, 88.824], ['A', ' O ', 160.06, 123.102, 89.477], ['A', ' CB ', 163.387, 123.619, 89.626], ['A', ' H ', 161.649, 125.321, 90.5], ['A', ' HA ', 162.377, 124.343, 87.873], ['A', ' HB ', 163.887, 122.812, 89.11], ['A', ' HB ', 164.057, 124.479, 89.692], ['A', ' HB ', 163.124, 123.297, 90.619]] AA_SCO= 2.178421052631579 CA_SCO= 1.6744736842105261
[['A', ' N ', 161.137, 121.939, 87.985], ['A', ' CA ', 160.001, 120.998, 87.828], ['A', ' C ', 158.958, 121.713, 86.953], ['A', ' O ', 158.727, 121.302, 85.826], ['A', ' CB ', 159.331, 120.465, 89.129], ['A', ' CG1', 160.365, 119.72, 90.032], ['A', ' CG2', 158.169, 119.532, 88.729], ['A', ' CD1', 161.05, 118.493, 89.422], ['A', ' H ', 161.984, 121.829, 87.45], ['A', ' HA ', 160.34, 120.122, 87.302], ['A', ' HB ', 158.877, 121.243, 89.719], ['A', ' HG1', 161.121, 120.436, 90.323], ['A', ' HG1', 159.843, 119.397, 90.933], ['A', ' HG2', 157.687, 119.149, 89.628], ['A', ' HG2', 157.432, 120.076, 88.144], ['A', ' HG2', 158.536, 118.708, 88.137], ['A', ' HD1', 161.721, 118.065, 90.155], ['A', ' HD1', 160.325, 117.767, 89.167], ['A', ' HD1', 161.613, 118.766, 88.541]] AA_SCO= 2.196315789473684 CA_SCO= 1.6453157894736843
[['A', ' N ', 158.399, 122.841, 87.356], ['A', ' CA ', 157.518, 123.528, 86.409], ['A', ' C ', 158.297, 123.837, 85.127], ['A', ' O ', 157.83, 123.582, 84.017], ['A', ' CB ', 156.943, 124.795, 86.982], ['A', ' CG ', 156.172, 125.576, 86.037], ['A', ' ND1', 154.978, 125.175, 85.538], ['A', ' CD2', 156.413, 126.778, 85.533], ['A', ' CE1', 154.484, 126.12, 84.774], ['A', ' NE2', 155.326, 127.135, 84.768], ['A', ' H ', 158.556, 123.2, 88.316], ['A', ' HA ', 156.683, 122.881, 86.149], ['A', ' HB ', 156.302, 124.548, 87.832], ['A', ' HB ', 157.715, 125.423, 87.348], ['A', ' HD1', 154.469, 124.309, 85.777], ['A', ' HD2', 157.245, 127.471, 85.666], ['A', ' HE1', 153.513, 125.985, 84.29]] AA_SCO= 2.0784210526315787 CA_SCO= 1.6445263157894738
[['A', ' N ', 159.543, 124.281, 85.274], ['A', ' CA ', 160.409, 124.628, 84.153], ['A', ' C ', 161.169, 123.396, 83.634], ['A', ' O ', 162.201, 123.512, 82.982], ['A', ' CB ', 161.418, 125.721, 84.54], ['A', ' CG ', 160.809, 127.061, 84.866], ['A', ' ND1', 160.224, 127.863, 83.916], ['A', ' CD2', 160.733, 127.742, 86.026], ['A', ' CE1', 159.791, 128.972, 84.484], ['A', ' NE2', 160.079, 128.915, 85.769], ['A', ' H ', 159.853, 124.49, 86.225], ['A', ' HA ', 159.801, 125.011, 83.335], ['A', ' HB ', 161.984, 125.393, 85.414], ['A', ' HB ', 162.128, 125.866, 83.729], ['A', ' HD1', 160.161, 127.668, 82.938], ['A', ' HD2', 161.071, 127.522, 87.028], ['A', ' HE1', 159.28, 129.742, 83.89]] AA_SCO= 2.1042105263157893 CA_SCO= 1.6444210526315792
[['A', ' N ', 160.656, 122.217, 83.961], ['A', ' CA ', 161.094, 120.91, 83.488], ['A', ' C ', 159.967, 120.36, 82.63], ['A', ' O ', 160.18, 119.907, 81.511], ['A', ' CB ', 161.355, 119.976, 84.651], ['A', ' CG ', 161.687, 118.614, 84.329], ['A', ' CD1', 162.857, 118.257, 83.721], ['A', ' CD2', 160.776, 117.629, 84.676], ['A', ' CE1', 163.098, 116.936, 83.447], ['A', ' CE2', 161.026, 116.326, 84.41], ['A', ' CZ ', 162.185, 115.978, 83.792], ['A', ' H ', 159.839, 122.219, 84.558], ['A', ' HA ', 161.992, 121.021, 82.879], ['A', ' HB ', 162.116, 120.381, 85.299], ['A', ' HB ', 160.472, 119.911, 85.193], ['A', ' HD1', 163.585, 119.023, 83.445], ['A', ' HD2', 159.843, 117.911, 85.168], ['A', ' HE1', 164.013, 116.641, 82.951], ['A', ' HE2', 160.301, 115.561, 84.684], ['A', ' HZ ', 162.385, 114.941, 83.572]] AA_SCO= 2.2468421052631578 CA_SCO= 1.6490526315789475
[['A', ' N ', 158.759, 120.426, 83.19], ['A', ' CA ', 157.514, 119.989, 82.586], ['A', ' C ', 157.068, 120.877, 81.445], ['A', ' O ', 156.522, 120.401, 80.458], ['A', ' CB ', 156.42, 120.035, 83.645], ['A', ' CG ', 156.48, 119.028, 84.763], ['A', ' CD1', 155.473, 119.429, 85.804], ['A', ' CD2', 156.131, 117.667, 84.226], ['A', ' H ', 158.702, 120.781, 84.131], ['A', ' HA ', 157.648, 118.984, 82.207], ['A', ' HB ', 156.443, 121.026, 84.103], ['A', ' HB ', 155.458, 119.921, 83.147], ['A', ' HG ', 157.472, 119.015, 85.212], ['A', ' HD1', 155.482, 118.713, 86.626], ['A', ' HD1', 155.716, 120.423, 86.188], ['A', ' HD1', 154.48, 119.449, 85.353], ['A', ' HD2', 156.127, 116.945, 85.007], ['A', ' HD2', 155.138, 117.702, 83.803], ['A', ' HD2', 156.834, 117.348, 83.467]] AA_SCO= 2.183684210526316 CA_SCO= 1.6488947368421056
[['A', ' N ', 157.31, 122.17, 81.535], ['A', ' CA ', 156.856, 123.065, 80.488], ['A', ' C ', 157.981, 123.304, 79.502], ['A', ' O ', 157.755, 123.655, 78.337], ['A', ' CB ', 156.332, 124.396, 81.046], ['A', ' CG1', 154.941, 124.288, 81.614], ['A', ' CG2', 156.222, 125.385, 79.925], ['A', ' CD1', 154.653, 123.202, 82.633], ['A', ' H ', 157.735, 122.561, 82.38], ['A', ' HA ', 156.038, 122.588, 79.947], ['A', ' HB ', 156.988, 124.77, 81.828], ['A', ' HG1', 154.73, 125.24, 82.087], ['A', ' HG1', 154.285, 124.176, 80.793], ['A', ' HG2', 155.814, 126.299, 80.306], ['A', ' HG2', 157.182, 125.585, 79.507], ['A', ' HG2', 155.551, 124.996, 79.149], ['A', ' HD1', 153.627, 123.298, 82.95], ['A', ' HD1', 154.785, 122.223, 82.206], ['A', ' HD1', 155.305, 123.316, 83.493]] AA_SCO= 2.1536842105263156 CA_SCO= 1.6497368421052634
[['A', ' N ', 159.201, 123.081, 79.941], ['A', ' CA ', 160.336, 123.316, 79.093], ['A', ' C ', 160.203, 122.703, 77.694], ['A', ' O ', 160.493, 123.415, 76.75], ['A', ' CB ', 161.591, 122.816, 79.763], ['A', ' H ', 159.354, 122.787, 80.899], ['A', ' HA ', 160.432, 124.393, 78.965], ['A', ' HB ', 162.446, 123.038, 79.15], ['A', ' HB ', 161.691, 123.315, 80.699], ['A', ' HB ', 161.558, 121.76, 79.935]] AA_SCO= 2.0352631578947364 CA_SCO= 1.5956842105263165
[['A', ' N ', 159.685, 121.482, 77.439], ['A', ' CA ', 159.596, 120.929, 76.101], ['A', ' C ', 158.758, 121.8, 75.15], ['A', ' O ', 158.832, 121.624, 73.935], ['A', ' CB ', 158.947, 119.57, 76.331], ['A', ' CG ', 159.274, 119.24, 77.756], ['A', ' CD ', 159.232, 120.556, 78.467], ['A', ' HA ', 160.615, 120.811, 75.703], ['A', ' HB ', 157.879, 119.637, 76.125], ['A', ' HB ', 159.362, 118.837, 75.621], ['A', ' HG ', 158.548, 118.521, 78.16], ['A', ' HG ', 160.25, 118.759, 77.822], ['A', ' HD ', 158.206, 120.749, 78.736], ['A', ' HD ', 159.882, 120.531, 79.3]] AA_SCO= 1.8973684210526311 CA_SCO= 1.593789473684211
[['A', ' N ', 157.928, 122.706, 75.685], ['A', ' CA ', 157.125, 123.554, 74.825], ['A', ' C ', 157.873, 124.826, 74.445], ['A', ' O ', 157.614, 125.402, 73.386], ['A', ' CB ', 155.833, 123.963, 75.513], ['A', ' CG ', 154.955, 122.794, 75.822], ['A', ' OD1', 154.805, 121.908, 75.002], ['A', ' OD2', 154.435, 122.772, 76.912], ['A', ' H ', 157.868, 122.852, 76.69], ['A', ' HA ', 156.887, 123.005, 73.915], ['A', ' HB ', 156.076, 124.479, 76.447], ['A', ' HB ', 155.302, 124.668, 74.889]] AA_SCO= 1.9131578947368415 CA_SCO= 1.5761578947368426
[['A', ' N ', 158.771, 125.297, 75.316], ['A', ' CA ', 159.469, 126.556, 75.006], ['A', ' C ', 160.961, 126.436, 74.723], ['A', ' O ', 161.559, 127.339, 74.137], ['A', ' CB ', 159.243, 127.593, 76.095], ['A', ' CG ', 157.824, 127.985, 76.203], ['A', ' CD1', 157.106, 127.651, 77.293], ['A', ' CD2', 157.194, 128.678, 75.175], ['A', ' CE1', 155.785, 127.99, 77.399], ['A', ' CE2', 155.871, 129.024, 75.271], ['A', ' CZ ', 155.166, 128.677, 76.392], ['A', ' H ', 158.95, 124.762, 76.179], ['A', ' HA ', 159.021, 126.957, 74.099], ['A', ' HB ', 159.566, 127.192, 77.055], ['A', ' HB ', 159.835, 128.48, 75.891], ['A', ' HD1', 157.596, 127.112, 78.09], ['A', ' HD2', 157.755, 128.953, 74.273], ['A', ' HE1', 155.225, 127.71, 78.29], ['A', ' HE2', 155.387, 129.567, 74.456], ['A', ' HZ ', 154.119, 128.942, 76.482]] AA_SCO= 1.921578947368421 CA_SCO= 1.5760526315789478
[['A', ' N ', 161.559, 125.349, 75.145], ['A', ' CA ', 162.97, 125.11, 74.984], ['A', ' C ', 163.175, 124.252, 73.736], ['A', ' O ', 162.604, 123.171, 73.654], ['A', ' CB ', 163.518, 124.378, 76.218], ['A', ' CG1', 164.967, 124.05, 76.046], ['A', ' CG2', 163.351, 125.233, 77.444], ['A', ' H ', 161.013, 124.642, 75.619], ['A', ' HA ', 163.475, 126.061, 74.922], ['A', ' HB ', 162.971, 123.465, 76.339], ['A', ' HG1', 165.325, 123.523, 76.915], ['A', ' HG1', 165.103, 123.417, 75.183], ['A', ' HG1', 165.529, 124.969, 75.921], ['A', ' HG2', 163.726, 124.704, 78.313], ['A', ' HG2', 163.905, 126.134, 77.329], ['A', ' HG2', 162.301, 125.465, 77.587]] AA_SCO= 1.9157894736842105 CA_SCO= 1.576368421052632
[['A', ' N ', 163.967, 124.682, 72.75], ['A', ' CA ', 164.247, 123.938, 71.543], ['A', ' C ', 164.812, 122.618, 71.979], ['A', ' O ', 165.543, 122.579, 72.963], ['A', ' CB ', 165.295, 124.795, 70.84], ['A', ' CG ', 165.05, 126.189, 71.363], ['A', ' CD ', 164.595, 126.005, 72.796], ['A', ' HA ', 163.327, 123.812, 70.948], ['A', ' HB ', 166.298, 124.414, 71.067], ['A', ' HB ', 165.167, 124.724, 69.75], ['A', ' HG ', 165.966, 126.794, 71.284], ['A', ' HG ', 164.287, 126.692, 70.747], ['A', ' HD ', 165.431, 126.011, 73.491], ['A', ' HD ', 163.859, 126.801, 72.996]] AA_SCO= 1.9121052631578948 CA_SCO= 1.5647368421052636
[['A', ' N ', 164.592, 121.55, 71.229], ['A', ' CA ', 165.081, 120.253, 71.683], ['A', ' C ', 166.59, 120.221, 71.87], ['A', ' O ', 167.092, 119.518, 72.746], ['A', ' CB ', 164.635, 119.142, 70.72], ['A', ' CG ', 165.14, 119.239, 69.26], ['A', ' CD ', 164.273, 120.104, 68.371], ['A', ' OE1', 163.616, 120.988, 68.884], ['A', ' OE2', 164.266, 119.881, 67.187], ['A', ' H ', 164.021, 121.606, 70.379], ['A', ' HA ', 164.615, 120.043, 72.641], ['A', ' HB ', 164.967, 118.18, 71.111], ['A', ' HB ', 163.546, 119.116, 70.687], ['A', ' HG ', 166.157, 119.611, 69.229], ['A', ' HG ', 165.156, 118.232, 68.847]] AA_SCO= 1.881052631578947 CA_SCO= 1.5677894736842106
[['A', ' N ', 167.306, 121.077, 71.158], ['A', ' CA ', 168.751, 121.149, 71.23], ['A', ' C ', 169.237, 121.634, 72.584], ['A', ' O ', 170.398, 121.436, 72.941], ['A', ' CB ', 169.256, 122.081, 70.163], ['A', ' CG ', 169.119, 121.508, 68.813], ['A', ' OD1', 169.04, 120.289, 68.626], ['A', ' ND2', 169.074, 122.368, 67.837], ['A', ' H ', 166.831, 121.646, 70.471], ['A', ' HA ', 169.157, 120.149, 71.071], ['A', ' HB ', 168.698, 123.018, 70.209], ['A', ' HB ', 170.304, 122.314, 70.347], ['A', ' HD2', 168.977, 122.047, 66.894], ['A', ' HD2', 169.139, 123.348, 68.026]] AA_SCO= 1.8257894736842104 CA_SCO= 1.5677894736842106
[['A', ' N ', 168.373, 122.332, 73.309], ['A', ' CA ', 168.7, 122.895, 74.598], ['A', ' C ', 168.137, 122.08, 75.743], ['A', ' O ', 168.331, 122.456, 76.901], ['A', ' CB ', 168.148, 124.317, 74.729], ['A', ' CG ', 168.981, 125.479, 74.18], ['A', ' CD1', 169.031, 125.42, 72.65], ['A', ' CD2', 168.351, 126.798, 74.673], ['A', ' H ', 167.414, 122.443, 72.976], ['A', ' HA ', 169.784, 122.923, 74.699], ['A', ' HB ', 167.195, 124.338, 74.203], ['A', ' HB ', 167.966, 124.518, 75.781], ['A', ' HG ', 170.004, 125.406, 74.553], ['A', ' HD1', 169.622, 126.256, 72.279], ['A', ' HD1', 169.491, 124.503, 72.324], ['A', ' HD1', 168.029, 125.486, 72.253], ['A', ' HD2', 168.936, 127.641, 74.307], ['A', ' HD2', 167.339, 126.886, 74.311], ['A', ' HD2', 168.345, 126.812, 75.762]] AA_SCO= 1.8305263157894738 CA_SCO= 1.5247368421052634
[['A', ' N ', 167.408, 120.998, 75.466], ['A', ' CA ', 166.802, 120.279, 76.573], ['A', ' C ', 167.795, 119.628, 77.496], ['A', ' O ', 167.559, 119.555, 78.694], ['A', ' CB ', 165.792, 119.262, 76.084], ['A', ' CG ', 164.485, 119.865, 75.599], ['A', ' SD ', 163.602, 120.79, 76.881], ['A', ' CE ', 163.181, 119.551, 78.072], ['A', ' H ', 167.29, 120.665, 74.503], ['A', ' HA ', 166.256, 121.007, 77.165], ['A', ' HB ', 166.221, 118.73, 75.233], ['A', ' HB ', 165.598, 118.523, 76.856], ['A', ' HG ', 164.714, 120.571, 74.804], ['A', ' HG ', 163.825, 119.096, 75.202], ['A', ' HE ', 162.623, 119.997, 78.886], ['A', ' HE ', 162.577, 118.785, 77.598], ['A', ' HE ', 164.082, 119.107, 78.469]] AA_SCO= 1.8626315789473684 CA_SCO= 1.5200000000000002
[['A', ' N ', 168.927, 119.145, 77.0], ['A', ' CA ', 169.843, 118.526, 77.946], ['A', ' C ', 170.324, 119.566, 78.939], ['A', ' O ', 170.435, 119.291, 80.133], ['A', ' CB ', 171.025, 117.912, 77.236], ['A', ' H ', 169.132, 119.192, 76.011], ['A', ' HA ', 169.304, 117.752, 78.493], ['A', ' HB ', 171.687, 117.452, 77.971], ['A', ' HB ', 170.678, 117.155, 76.534], ['A', ' HB ', 171.568, 118.69, 76.697]] AA_SCO= 1.8515789473684214 CA_SCO= 1.5203684210526316
[['A', ' N ', 170.555, 120.782, 78.453], ['A', ' CA ', 171.043, 121.836, 79.31], ['A', ' C ', 169.945, 122.362, 80.201], ['A', ' O ', 170.197, 122.71, 81.357], ['A', ' CB ', 171.583, 122.983, 78.473], ['A', ' CG ', 172.87, 122.658, 77.738], ['A', ' OD1', 173.557, 121.731, 78.094], ['A', ' OD2', 173.157, 123.36, 76.807], ['A', ' H ', 170.452, 120.946, 77.46], ['A', ' HA ', 171.842, 121.438, 79.933], ['A', ' HB ', 170.827, 123.272, 77.735], ['A', ' HB ', 171.757, 123.847, 79.114]] AA_SCO= 1.8247368421052632 CA_SCO= 1.6022105263157895
[['A', ' N ', 168.725, 122.46, 79.673], ['A', ' CA ', 167.629, 122.964, 80.47], ['A', ' C ', 167.338, 122.01, 81.603], ['A', ' O ', 167.1, 122.443, 82.733], ['A', ' CB ', 166.393, 123.158, 79.619], ['A', ' H ', 168.57, 122.21, 78.696], ['A', ' HA ', 167.926, 123.922, 80.893], ['A', ' HB ', 165.581, 123.552, 80.23], ['A', ' HB ', 166.625, 123.857, 78.82], ['A', ' HB ', 166.096, 122.202, 79.195]] AA_SCO= 1.8226315789473686 CA_SCO= 1.721684210526316
[['A', ' N ', 167.424, 120.709, 81.323], ['A', ' CA ', 167.175, 119.72, 82.339], ['A', ' C ', 168.284, 119.746, 83.346], ['A', ' O ', 168.032, 119.711, 84.55], ['A', ' CB ', 167.042, 118.31, 81.789], ['A', ' CG1', 165.787, 118.218, 80.935], ['A', ' CG2', 166.969, 117.351, 82.976], ['A', ' CD1', 165.704, 116.957, 80.102], ['A', ' H ', 167.617, 120.4, 80.365], ['A', ' HA ', 166.239, 119.959, 82.824], ['A', ' HB ', 167.898, 118.068, 81.149], ['A', ' HG1', 164.924, 118.274, 81.572], ['A', ' HG1', 165.761, 119.07, 80.266], ['A', ' HG2', 166.854, 116.348, 82.631], ['A', ' HG2', 167.868, 117.394, 83.586], ['A', ' HG2', 166.119, 117.631, 83.587], ['A', ' HD1', 164.788, 116.977, 79.514], ['A', ' HD1', 166.564, 116.915, 79.427], ['A', ' HD1', 165.696, 116.076, 80.73]] AA_SCO= 1.6205263157894736 CA_SCO= 1.7507894736842105
[['A', ' N ', 169.523, 119.794, 82.883], ['A', ' CA ', 170.603, 119.793, 83.824], ['A', ' C ', 170.565, 121.055, 84.667], ['A', ' O ', 170.909, 121.009, 85.851], ['A', ' CB ', 171.913, 119.668, 83.095], ['A', ' CG ', 172.112, 118.304, 82.533], ['A', ' OD1', 171.509, 117.326, 82.978], ['A', ' ND2', 172.956, 118.206, 81.547], ['A', ' H ', 169.725, 119.781, 81.878], ['A', ' HA ', 170.484, 118.942, 84.493], ['A', ' HB ', 171.939, 120.393, 82.279], ['A', ' HB ', 172.734, 119.9, 83.77], ['A', ' HD2', 173.127, 117.318, 81.125], ['A', ' HD2', 173.417, 119.019, 81.197]] AA_SCO= 1.742631578947368 CA_SCO= 1.7533157894736844
[['A', ' N ', 170.106, 122.171, 84.092], ['A', ' CA ', 170.034, 123.405, 84.844], ['A', ' C ', 168.997, 123.305, 85.938], ['A', ' O ', 169.302, 123.664, 87.074], ['A', ' CB ', 169.695, 124.562, 83.932], ['A', ' OG ', 170.728, 124.8, 83.015], ['A', ' H ', 169.878, 122.178, 83.098], ['A', ' HA ', 171.005, 123.588, 85.302], ['A', ' HB ', 168.773, 124.348, 83.398], ['A', ' HB ', 169.525, 125.454, 84.534], ['A', ' HG ', 170.675, 124.069, 82.364]] AA_SCO= 1.7236842105263157 CA_SCO= 1.753578947368421
[['A', ' N ', 167.814, 122.736, 85.647], ['A', ' CA ', 166.809, 122.624, 86.7], ['A', ' C ', 167.243, 121.628, 87.749], ['A', ' O ', 166.867, 121.766, 88.908], ['A', ' CB ', 165.388, 122.283, 86.195], ['A', ' CG1', 164.87, 123.399, 85.348], ['A', ' CG2', 165.389, 121.027, 85.41], ['A', ' H ', 167.617, 122.463, 84.677], ['A', ' HA ', 166.716, 123.594, 87.17], ['A', ' HB ', 164.732, 122.179, 87.04], ['A', ' HG1', 163.861, 123.171, 85.009], ['A', ' HG1', 164.854, 124.311, 85.942], ['A', ' HG1', 165.517, 123.535, 84.483], ['A', ' HG2', 164.393, 120.815, 85.059], ['A', ' HG2', 166.025, 121.18, 84.586], ['A', ' HG2', 165.743, 120.186, 85.989]] AA_SCO= 1.7984210526315791 CA_SCO= 1.7536315789473682
[['A', ' N ', 167.998, 120.6, 87.363], ['A', ' CA ', 168.486, 119.661, 88.346], ['A', ' C ', 169.497, 120.34, 89.249], ['A', ' O ', 169.394, 120.282, 90.471], ['A', ' CB ', 169.162, 118.502, 87.655], ['A', ' OG ', 168.251, 117.741, 86.928], ['A', ' H ', 168.208, 120.457, 86.368], ['A', ' HA ', 167.648, 119.309, 88.943], ['A', ' HB ', 169.915, 118.891, 86.981], ['A', ' HB ', 169.677, 117.883, 88.374], ['A', ' HG ', 168.788, 117.173, 86.355]] AA_SCO= 1.8142105263157895 CA_SCO= 1.754631578947368
[['A', ' N ', 170.4, 121.126, 88.693], ['A', ' CA ', 171.411, 121.74, 89.537], ['A', ' C ', 170.803, 122.71, 90.521], ['A', ' O ', 171.198, 122.747, 91.696], ['A', ' CB ', 172.446, 122.469, 88.683], ['A', ' CG ', 173.584, 123.15, 89.468], ['A', ' CD ', 174.454, 122.184, 90.235], ['A', ' OE1', 174.433, 121.012, 89.936], ['A', ' OE2', 175.152, 122.628, 91.117], ['A', ' H ', 170.464, 121.206, 87.673], ['A', ' HA ', 171.911, 120.95, 90.099], ['A', ' HB ', 172.89, 121.766, 87.977], ['A', ' HB ', 171.94, 123.238, 88.094], ['A', ' HG ', 174.207, 123.694, 88.761], ['A', ' HG ', 173.159, 123.879, 90.159]] AA_SCO= 2.007894736842105 CA_SCO= 1.7543684210526316
[['A', ' N ', 169.789, 123.451, 90.083], ['A', ' CA ', 169.241, 124.463, 90.957], ['A', ' C ', 168.09, 123.943, 91.777], ['A', ' O ', 167.374, 124.725, 92.393], ['A', ' CB ', 168.784, 125.716, 90.182], ['A', ' CG1', 167.612, 125.399, 89.296], ['A', ' CG2', 169.975, 126.248, 89.311], ['A', ' CD1', 166.969, 126.572, 88.663], ['A', ' H ', 169.481, 123.368, 89.107], ['A', ' HA ', 170.018, 124.746, 91.652], ['A', ' HB ', 168.47, 126.46, 90.894], ['A', ' HG1', 167.93, 124.757, 88.55], ['A', ' HG1', 166.843, 124.894, 89.877], ['A', ' HG2', 169.703, 127.145, 88.774], ['A', ' HG2', 170.817, 126.475, 89.929], ['A', ' HG2', 170.271, 125.485, 88.595], ['A', ' HD1', 166.135, 126.222, 88.055], ['A', ' HD1', 166.615, 127.232, 89.439], ['A', ' HD1', 167.661, 127.099, 88.033]] AA_SCO= 2.068421052631579 CA_SCO= 1.8174736842105261
[['A', ' N ', 167.882, 122.636, 91.746], ['A', ' CA ', 166.885, 122.005, 92.568], ['A', ' C ', 167.636, 121.175, 93.59], ['A', ' O ', 167.228, 121.107, 94.742], ['A', ' CB ', 165.934, 121.187, 91.731], ['A', ' CG ', 164.783, 120.574, 92.477], ['A', ' CD ', 163.786, 119.944, 91.583], ['A', ' NE ', 164.304, 118.763, 90.88], ['A', ' CZ ', 164.644, 118.707, 89.572], ['A', ' NH1', 164.558, 119.759, 88.804], ['A', ' NH2', 165.074, 117.581, 89.056], ['A', ' H ', 168.47, 122.044, 91.165], ['A', ' HA ', 166.316, 122.769, 93.091], ['A', ' HB ', 165.496, 121.84, 90.988], ['A', ' HB ', 166.486, 120.432, 91.2], ['A', ' HG ', 165.138, 119.843, 93.175], ['A', ' HG ', 164.292, 121.346, 93.014], ['A', ' HD ', 162.937, 119.627, 92.191], ['A', ' HD ', 163.44, 120.672, 90.863], ['A', ' HE ', 164.357, 117.891, 91.41], ['A', ' HH1', 164.253, 120.642, 89.182], ['A', ' HH1', 164.836, 119.688, 87.829], ['A', ' HH2', 165.175, 116.739, 89.639], ['A', ' HH2', 165.32, 117.546, 88.078]] AA_SCO= 2.2536842105263153 CA_SCO= 1.819894736842105
[['A', ' N ', 168.771, 120.577, 93.184], ['A', ' CA ', 169.619, 119.816, 94.09], ['A', ' C ', 170.11, 120.797, 95.142], ['A', ' O ', 169.955, 120.599, 96.352], ['A', ' CB ', 170.767, 119.19, 93.307], ['A', ' CG ', 171.711, 118.337, 94.103], ['A', ' CD ', 172.712, 117.578, 93.201], ['A', ' CE ', 173.757, 118.504, 92.556], ['A', ' NZ ', 174.834, 117.73, 91.836], ['A', ' H ', 169.037, 120.615, 92.207], ['A', ' HA ', 169.038, 119.042, 94.577], ['A', ' HB ', 170.375, 118.606, 92.494], ['A', ' HB ', 171.345, 119.996, 92.855], ['A', ' HG ', 172.271, 118.98, 94.756], ['A', ' HG ', 171.148, 117.628, 94.711], ['A', ' HD ', 173.232, 116.828, 93.798], ['A', ' HD ', 172.174, 117.065, 92.406], ['A', ' HE ', 173.271, 119.162, 91.835], ['A', ' HE ', 174.22, 119.112, 93.334], ['A', ' HZ ', 175.501, 118.369, 91.431], ['A', ' HZ ', 175.309, 117.12, 92.478], ['A', ' HZ ', 174.443, 117.145, 91.071]] AA_SCO= 2.2584210526315793 CA_SCO= 1.9053157894736839
[['A', ' N ', 170.607, 121.934, 94.693], ['A', ' CA ', 170.941, 122.958, 95.642], ['A', ' C ', 169.626, 123.618, 95.924], ['A', ' O ', 168.972, 124.116, 95.024], ['A', ' CB ', 172.026, 123.867, 95.151], ['A', ' CG ', 173.315, 123.167, 95.171], ['A', ' OD1', 173.629, 122.583, 96.227], ['A', ' ND2', 174.049, 123.19, 94.094], ['A', ' H ', 170.748, 122.087, 93.69], ['A', ' HA ', 171.283, 122.506, 96.566], ['A', ' HB ', 171.803, 124.167, 94.135], ['A', ' HB ', 172.09, 124.758, 95.773], ['A', ' HD2', 174.931, 122.72, 94.065], ['A', ' HD2', 173.739, 123.691, 93.278]] AA_SCO= 2.241052631578947 CA_SCO= 1.9053157894736839
[['A', ' N ', 169.235, 123.542, 97.189], ['A', ' CA ', 167.93, 123.922, 97.747], ['A', ' C ', 167.128, 122.654, 98.067], ['A', ' O ', 166.155, 122.7, 98.831], ['A', ' CB ', 167.11, 124.809, 96.807], ['A', ' H ', 169.928, 123.155, 97.809], ['A', ' HA ', 168.107, 124.471, 98.666], ['A', ' HB ', 166.172, 125.068, 97.282], ['A', ' HB ', 167.66, 125.721, 96.578], ['A', ' HB ', 166.878, 124.283, 95.885]] AA_SCO= 2.2673684210526317 CA_SCO= 1.8963684210526315
[['A', ' N ', 167.574, 121.494, 97.563], ['A', ' CA ', 167.005, 120.233, 98.018], ['A', ' C ', 167.55, 120.048, 99.38], ['A', ' O ', 166.833, 119.692, 100.306], ['A', ' CB ', 167.458, 119.019, 97.203], ['A', ' CG ', 166.808, 117.708, 97.6], ['A', ' CD ', 165.366, 117.707, 97.326], ['A', ' OE1', 165.017, 117.957, 96.172], ['A', ' NE2', 164.519, 117.414, 98.316], ['A', ' H ', 168.373, 121.467, 96.929], ['A', ' HA ', 165.919, 120.299, 98.057], ['A', ' HB ', 167.252, 119.18, 96.163], ['A', ' HB ', 168.528, 118.88, 97.31], ['A', ' HG ', 167.263, 116.9, 97.036], ['A', ' HG ', 166.951, 117.536, 98.667], ['A', ' HE2', 163.534, 117.391, 98.131], ['A', ' HE2', 164.865, 117.185, 99.27]] AA_SCO= 2.2468421052631578 CA_SCO= 1.9051578947368417
[['A', ' N ', 168.828, 120.411, 99.507], ['A', ' CA ', 169.556, 120.253, 100.747], ['A', ' C ', 169.009, 121.185, 101.776], ['A', ' O ', 168.941, 120.849, 102.944], ['A', ' CB ', 171.026, 120.588, 100.571], ['A', ' CG ', 171.753, 119.658, 99.714], ['A', ' CD1', 172.121, 120.062, 98.469], ['A', ' CD2', 172.06, 118.4, 100.153], ['A', ' CE1', 172.795, 119.226, 97.645], ['A', ' CE2', 172.744, 117.545, 99.323], ['A', ' CZ ', 173.113, 117.961, 98.066], ['A', ' OH ', 173.793, 117.105, 97.226], ['A', ' H ', 169.305, 120.687, 98.645], ['A', ' HA ', 169.442, 119.23, 101.101], ['A', ' HB ', 171.127, 121.59, 100.155], ['A', ' HB ', 171.51, 120.591, 101.548], ['A', ' HD1', 171.878, 121.057, 98.131], ['A', ' HD2', 171.765, 118.077, 101.153], ['A', ' HE1', 173.083, 119.571, 96.662], ['A', ' HE2', 172.991, 116.538, 99.662], ['A', ' HH ', 173.818, 116.231, 97.616]] AA_SCO= 2.274736842105263 CA_SCO= 1.889157894736842
[['A', ' N ', 168.572, 122.354, 101.371], ['A', ' CA ', 168.064, 123.239, 102.386], ['A', ' C ', 166.856, 122.652, 102.985], ['A', ' O ', 166.749, 122.639, 104.207], ['A', ' CB ', 167.709, 124.609, 101.849], ['A', ' CG1', 166.973, 125.437, 102.914], ['A', ' CG2', 168.925, 125.316, 101.474], ['A', ' H ', 168.629, 122.603, 100.4], ['A', ' HA ', 168.793, 123.344, 103.175], ['A', ' HB ', 167.076, 124.489, 100.997], ['A', ' HG1', 166.731, 126.417, 102.504], ['A', ' HG1', 166.04, 124.956, 103.218], ['A', ' HG1', 167.61, 125.561, 103.788], ['A', ' HG2', 168.635, 126.265, 101.102], ['A', ' HG2', 169.547, 125.448, 102.342], ['A', ' HG2', 169.471, 124.769, 100.716]] AA_SCO= 2.2863157894736843 CA_SCO= 1.883894736842105
[['A', ' N ', 165.941, 122.146, 102.174], ['A', ' CA ', 164.789, 121.622, 102.841], ['A', ' C ', 165.168, 120.347, 103.566], ['A', ' O ', 164.87, 120.188, 104.743], ['A', ' CB ', 163.635, 121.322, 101.932], ['A', ' CG1', 162.545, 120.695, 102.781], ['A', ' CG2', 163.177, 122.567, 101.286], ['A', ' H ', 166.041, 122.179, 101.151], ['A', ' HA ', 164.432, 122.365, 103.532], ['A', ' HB ', 163.938, 120.595, 101.174], ['A', ' HG1', 161.734, 120.463, 102.166], ['A', ' HG1', 162.88, 119.788, 103.267], ['A', ' HG1', 162.233, 121.404, 103.546], ['A', ' HG2', 162.33, 122.356, 100.641], ['A', ' HG2', 162.878, 123.28, 102.053], ['A', ' HG2', 163.984, 122.994, 100.693]] AA_SCO= 2.340526315789474 CA_SCO= 1.9257894736842103
[['A', ' N ', 165.899, 119.446, 102.913], ['A', ' CA ', 166.191, 118.184, 103.561], ['A', ' C ', 166.902, 118.371, 104.879], ['A', ' O ', 166.66, 117.583, 105.785], ['A', ' CB ', 167.079, 117.254, 102.706], ['A', ' CG ', 166.415, 116.589, 101.441], ['A', ' OD1', 165.23, 116.7, 101.252], ['A', ' OD2', 167.091, 115.889, 100.728], ['A', ' H ', 166.178, 119.6, 101.949], ['A', ' HA ', 165.242, 117.688, 103.762], ['A', ' HB ', 167.931, 117.838, 102.359], ['A', ' HB ', 167.477, 116.474, 103.34]] AA_SCO= 2.371052631578948 CA_SCO= 1.9260000000000002
[['A', ' N ', 167.79, 119.364, 104.988], ['A', ' CA ', 168.506, 119.644, 106.22], ['A', ' C ', 167.672, 120.377, 107.268], ['A', ' O ', 167.907, 120.191, 108.454], ['A', ' CB ', 169.733, 120.503, 105.932], ['A', ' CG ', 170.852, 119.856, 105.134], ['A', ' SD ', 171.593, 118.549, 105.952], ['A', ' CE ', 172.501, 117.732, 104.631], ['A', ' H ', 167.991, 119.943, 104.176], ['A', ' HA ', 168.814, 118.694, 106.647], ['A', ' HB ', 169.4, 121.355, 105.355], ['A', ' HB ', 170.147, 120.887, 106.868], ['A', ' HG ', 170.471, 119.486, 104.191], ['A', ' HG ', 171.618, 120.59, 104.934], ['A', ' HE ', 173.037, 116.867, 105.039], ['A', ' HE ', 171.805, 117.398, 103.862], ['A', ' HE ', 173.219, 118.428, 104.193]] AA_SCO= 2.377894736842105 CA_SCO= 1.9238947368421053
[['A', ' N ', 166.731, 121.231, 106.864], ['A', ' CA ', 165.947, 121.98, 107.848], ['A', ' C ', 164.713, 121.243, 108.311], ['A', ' O ', 164.301, 121.36, 109.456], ['A', ' CB ', 165.56, 123.375, 107.319], ['A', ' CG1', 164.523, 123.345, 106.266], ['A', ' CG2', 165.024, 124.183, 108.417], ['A', ' H ', 166.582, 121.388, 105.861], ['A', ' HA ', 166.583, 122.138, 108.719], ['A', ' HB ', 166.452, 123.816, 106.881], ['A', ' HG1', 164.346, 124.356, 105.912], ['A', ' HG1', 164.865, 122.767, 105.505], ['A', ' HG1', 163.591, 122.942, 106.629], ['A', ' HG2', 164.782, 125.172, 108.035], ['A', ' HG2', 164.129, 123.724, 108.804], ['A', ' HG2', 165.75, 124.253, 109.21]] AA_SCO= 2.3221052631578947 CA_SCO= 1.9151052631578949
[['A', ' N ', 164.079, 120.551, 107.401], ['A', ' CA ', 162.852, 119.856, 107.645], ['A', ' C ', 163.028, 118.507, 107.011], ['A', ' O ', 162.704, 118.303, 105.842], ['A', ' CB ', 161.677, 120.633, 107.096], ['A', ' H ', 164.478, 120.495, 106.468], ['A', ' HA ', 162.738, 119.727, 108.711], ['A', ' HB ', 160.764, 120.108, 107.301], ['A', ' HB ', 161.64, 121.602, 107.578], ['A', ' HB ', 161.801, 120.765, 106.024]] AA_SCO= 2.3236842105263156 CA_SCO= 1.903105263157895
[['A', ' N ', 163.604, 117.619, 107.802], ['A', ' CA ', 164.126, 116.346, 107.355], ['A', ' C ', 163.303, 115.643, 106.317], ['A', ' O ', 162.151, 115.287, 106.548], ['A', ' H ', 163.781, 117.909, 108.753], ['A', ' HA ', 165.133, 116.469, 106.996], ['A', ' HA ', 164.213, 115.695, 108.223]] AA_SCO= 2.511578947368421 CA_SCO= 1.9034210526315793
[['A', ' N ', 163.975, 115.362, 105.196], ['A', ' CA ', 163.401, 114.663, 104.034], ['A', ' C ', 162.382, 115.54, 103.334], ['A', ' O ', 161.183, 115.377, 103.54], ['A', ' CB ', 162.727, 113.34, 104.431], ['A', ' CG ', 163.637, 112.444, 105.179], ['A', ' CD ', 163.194, 111.046, 105.336], ['A', ' OE1', 162.126, 110.708, 104.911], ['A', ' OE2', 163.973, 110.293, 105.886], ['A', ' H ', 164.919, 115.76, 105.163], ['A', ' HA ', 164.206, 114.454, 103.326], ['A', ' HB ', 161.823, 113.506, 105.009], ['A', ' HB ', 162.429, 112.812, 103.527], ['A', ' HG ', 164.548, 112.465, 104.688], ['A', ' HG ', 163.794, 112.858, 106.169]] AA_SCO= 2.496315789473684 CA_SCO= 1.8947894736842108
[['A', ' N ', 162.845, 116.423, 102.466], ['A', ' CA ', 162.018, 117.437, 101.861], ['A', ' C ', 160.826, 117.006, 101.027], ['A', ' O ', 159.912, 117.804, 100.848], ['A', ' H ', 163.839, 116.46, 102.241], ['A', ' HA ', 161.635, 118.047, 102.672], ['A', ' HA ', 162.661, 118.084, 101.265]] AA_SCO= 2.480526315789473 CA_SCO= 1.7345789473684214
[['A', ' N ', 160.761, 115.784, 100.514], ['A', ' CA ', 159.559, 115.499, 99.749], ['A', ' C ', 158.361, 115.484, 100.711], ['A', ' O ', 157.318, 116.01, 100.383], ['A', ' CB ', 159.63, 114.205, 98.953], ['A', ' CG1', 160.701, 114.311, 97.893], ['A', ' CG2', 158.272, 114.053, 98.219], ['A', ' CD1', 161.045, 112.998, 97.258], ['A', ' H ', 161.505, 115.114, 100.63], ['A', ' HA ', 159.4, 116.307, 99.035], ['A', ' HB ', 159.834, 113.366, 99.599], ['A', ' HG1', 160.362, 114.991, 97.11], ['A', ' HG1', 161.611, 114.722, 98.332], ['A', ' HG2', 158.235, 113.166, 97.605], ['A', ' HG2', 157.49, 114.003, 98.918], ['A', ' HG2', 158.11, 114.925, 97.58], ['A', ' HD1', 161.814, 113.153, 96.508], ['A', ' HD1', 161.41, 112.32, 98.014], ['A', ' HD1', 160.184, 112.573, 96.789]] AA_SCO= 2.488947368421052 CA_SCO= 1.7151052631578945
[['A', ' N ', 158.47, 114.845, 101.868], ['A', ' CA ', 157.372, 114.845, 102.84], ['A', ' C ', 157.987, 115.033, 104.215], ['A', ' O ', 158.146, 114.054, 104.934], ['A', ' CB ', 156.517, 113.576, 102.802], ['A', ' CG ', 155.922, 113.343, 101.486], ['A', ' ND1', 154.934, 114.135, 100.944], ['A', ' CD2', 156.139, 112.38, 100.612], ['A', ' CE1', 154.629, 113.687, 99.779], ['A', ' NE2', 155.34, 112.613, 99.549], ['A', ' H ', 159.356, 114.418, 102.11], ['A', ' HA ', 156.692, 115.667, 102.642], ['A', ' HB ', 157.131, 112.711, 103.061], ['A', ' HB ', 155.715, 113.646, 103.534], ['A', ' HD1', 154.422, 114.926, 101.323], ['A', ' HD2', 156.783, 111.536, 100.618], ['A', ' HE1', 153.869, 114.193, 99.198]] AA_SCO= 2.5031578947368422 CA_SCO= 1.7111052631578945
[['A', ' N ', 158.354, 116.261, 104.6], ['A', ' CA ', 159.181, 116.567, 105.749], ['A', ' C ', 158.715, 115.957, 107.056], ['A', ' O ', 157.554, 116.073, 107.44], ['A', ' CB ', 159.041, 118.071, 105.828], ['A', ' CG ', 158.776, 118.504, 104.441], ['A', ' CD ', 157.921, 117.441, 103.849], ['A', ' HA ', 160.221, 116.289, 105.538], ['A', ' HB ', 158.268, 118.354, 106.564], ['A', ' HB ', 159.98, 118.456, 106.181], ['A', ' HG ', 158.269, 119.462, 104.48], ['A', ' HG ', 159.717, 118.653, 103.897], ['A', ' HD ', 156.861, 117.645, 104.009], ['A', ' HD ', 158.179, 117.372, 102.784]] AA_SCO= 2.4699999999999998 CA_SCO= 1.6610526315789471
[['A', ' N ', 159.64, 115.37, 107.789], ['A', ' CA ', 159.321, 114.742, 109.05], ['A', ' C ', 159.367, 115.702, 110.225], ['A', ' O ', 158.741, 115.451, 111.259], ['A', ' CB ', 160.271, 113.612, 109.251], ['A', ' OG ', 161.576, 114.091, 109.383], ['A', ' H ', 160.594, 115.3, 107.43], ['A', ' HA ', 158.313, 114.334, 108.975], ['A', ' HB ', 159.979, 113.064, 110.136], ['A', ' HB ', 160.21, 112.932, 108.4], ['A', ' HG ', 162.145, 113.333, 109.214]] AA_SCO= 2.4584210526315786 CA_SCO= 1.6546842105263155
[['A', ' N ', 160.092, 116.807, 110.068], ['A', ' CA ', 160.15, 117.835, 111.092], ['A', ' C ', 158.995, 118.771, 110.759], ['A', ' O ', 158.29, 118.52, 109.791], ['A', ' CB ', 161.52, 118.523, 111.17], ['A', ' CG ', 161.82, 119.189, 112.578], ['A', ' OD1', 160.863, 119.576, 113.199], ['A', ' OD2', 162.948, 119.31, 112.997], ['A', ' H ', 160.627, 116.916, 109.219], ['A', ' HA ', 159.947, 117.398, 112.061], ['A', ' HB ', 162.308, 117.813, 110.922], ['A', ' HB ', 161.536, 119.31, 110.439]] AA_SCO= 2.4484210526315793 CA_SCO= 1.6545263157894734
[['A', ' N ', 158.836, 119.809, 111.561], ['A', ' CA ', 157.747, 120.779, 111.533], ['A', ' C ', 156.57, 120.071, 112.164], ['A', ' O ', 155.669, 119.61, 111.47], ['A', ' CB ', 157.35, 121.271, 110.124], ['A', ' CG1', 156.245, 122.328, 110.25], ['A', ' CG2', 158.537, 121.867, 109.422], ['A', ' H ', 159.515, 119.863, 112.302], ['A', ' HA ', 158.006, 121.643, 112.138], ['A', ' HB ', 156.943, 120.443, 109.545], ['A', ' HG1', 155.966, 122.646, 109.267], ['A', ' HG1', 155.381, 121.919, 110.735], ['A', ' HG1', 156.61, 123.178, 110.82], ['A', ' HG2', 158.242, 122.216, 108.433], ['A', ' HG2', 158.888, 122.693, 110.008], ['A', ' HG2', 159.325, 121.129, 109.316]] AA_SCO= 2.4463157894736844 CA_SCO= 1.5940526315789474
[['A', ' N ', 156.572, 119.958, 113.484], ['A', ' CA ', 155.515, 119.224, 114.139], ['A', ' C ', 154.765, 119.991, 115.213], ['A', ' O ', 155.171, 119.972, 116.375], ['A', ' CB ', 156.089, 117.974, 114.783], ['A', ' CG ', 156.764, 117.013, 113.837], ['A', ' CD ', 157.083, 115.723, 114.505], ['A', ' NE ', 158.077, 115.823, 115.526], ['A', ' CZ ', 159.399, 115.759, 115.314], ['A', ' NH1', 159.888, 115.602, 114.098], ['A', ' NH2', 160.223, 115.845, 116.346], ['A', ' H ', 157.33, 120.349, 114.021], ['A', ' HA ', 154.79, 118.915, 113.383], ['A', ' HB ', 156.816, 118.254, 115.543], ['A', ' HB ', 155.284, 117.424, 115.284], ['A', ' HG ', 156.117, 116.827, 112.985], ['A', ' HG ', 157.696, 117.45, 113.483], ['A', ' HD ', 156.175, 115.338, 114.97], ['A', ' HD ', 157.429, 115.011, 113.764], ['A', ' HE ', 157.754, 115.937, 116.48], ['A', ' HH1', 159.267, 115.525, 113.268], ['A', ' HH1', 160.886, 115.544, 113.967], ['A', ' HH2', 159.853, 115.956, 117.281], ['A', ' HH2', 161.223, 115.795, 116.204]] AA_SCO= 2.4315789473684215 CA_SCO= 1.5942631578947366
[['A', ' N ', 153.692, 120.683, 114.824], ['A', ' CA ', 152.75, 121.429, 115.695], ['A', ' C ', 153.29, 122.596, 116.52], ['A', ' O ', 152.646, 123.627, 116.618], ['A', ' CB ', 151.992, 120.478, 116.631], ['A', ' CG1', 151.242, 119.38, 115.807], ['A', ' CG2', 150.96, 121.289, 117.461], ['A', ' CD1', 150.164, 119.862, 114.817], ['A', ' H ', 153.489, 120.649, 113.832], ['A', ' HA ', 152.004, 121.869, 115.044], ['A', ' HB ', 152.686, 119.972, 117.304], ['A', ' HG1', 151.99, 118.816, 115.252], ['A', ' HG1', 150.77, 118.694, 116.517], ['A', ' HG2', 150.413, 120.614, 118.113], ['A', ' HG2', 151.452, 122.032, 118.067], ['A', ' HG2', 150.263, 121.8, 116.81], ['A', ' HD1', 149.73, 119.015, 114.321], ['A', ' HD1', 149.392, 120.381, 115.339], ['A', ' HD1', 150.58, 120.511, 114.076]] AA_SCO= 2.397894736842106 CA_SCO= 1.6028947368421052
[['A', ' N ', 154.414, 122.402, 117.179], ['A', ' CA ', 155.024, 123.4, 118.038], ['A', ' C ', 155.95, 124.319, 117.269], ['A', ' O ', 156.65, 125.133, 117.86], ['A', ' H ', 154.857, 121.507, 117.054], ['A', ' HA ', 154.24, 123.983, 118.508], ['A', ' HA ', 155.565, 122.909, 118.84]] AA_SCO= 2.4373684210526316 CA_SCO= 1.602578947368421
[['A', ' N ', 155.996, 124.16, 115.957], ['A', ' CA ', 156.846, 125.007, 115.142], ['A', ' C ', 158.281, 124.563, 114.933], ['A', ' O ', 159.186, 125.356, 115.139], ['A', ' H ', 155.399, 123.463, 115.542], ['A', ' HA ', 156.373, 125.1, 114.167], ['A', ' HA ', 156.849, 126.001, 115.568]] AA_SCO= 2.4347368421052638 CA_SCO= 1.6205263157894738
[['A', ' N ', 158.472, 123.323, 114.483], ['A', ' CA ', 159.793, 122.737, 114.194], ['A', ' C ', 160.43, 122.229, 115.468], ['A', ' O ', 160.363, 122.875, 116.5], ['A', ' CB ', 160.714, 123.783, 113.537], ['A', ' CG ', 161.987, 123.266, 112.937], ['A', ' SD ', 161.709, 122.305, 111.484], ['A', ' CE ', 161.488, 123.544, 110.271], ['A', ' H ', 157.648, 122.764, 114.363], ['A', ' HA ', 159.686, 121.884, 113.534], ['A', ' HB ', 160.165, 124.355, 112.798], ['A', ' HB ', 161.07, 124.465, 114.261], ['A', ' HG ', 162.629, 124.104, 112.675], ['A', ' HG ', 162.529, 122.65, 113.657], ['A', ' HE ', 161.319, 123.089, 109.305], ['A', ' HE ', 160.647, 124.182, 110.524], ['A', ' HE ', 162.371, 124.129, 110.224]] AA_SCO= 2.481578947368421 CA_SCO= 1.6223157894736842
[['A', ' N ', 161.004, 121.033, 115.428], ['A', ' CA ', 161.648, 120.471, 116.59], ['A', ' C ', 163.114, 120.858, 116.705], ['A', ' O ', 163.566, 121.32, 117.756], ['A', ' CB ', 161.519, 118.964, 116.553], ['A', ' H ', 161.026, 120.497, 114.566], ['A', ' HA ', 161.143, 120.832, 117.463], ['A', ' HB ', 161.97, 118.537, 117.445], ['A', ' HB ', 160.468, 118.698, 116.506], ['A', ' HB ', 162.035, 118.582, 115.666]] AA_SCO= 2.403684210526316 CA_SCO= 1.6234210526315789
[['A', ' N ', 163.862, 120.697, 115.624], ['A', ' CA ', 165.297, 120.931, 115.685], ['A', ' C ', 165.837, 122.195, 115.031], ['A', ' O ', 165.227, 122.765, 114.132], ['A', ' CB ', 165.974, 119.728, 115.091], ['A', ' CG ', 165.904, 118.517, 115.974], ['A', ' OD1', 166.522, 118.536, 117.028], ['A', ' OD2', 165.26, 117.554, 115.617], ['A', ' H ', 163.454, 120.32, 114.749], ['A', ' HA ', 165.572, 120.977, 116.737], ['A', ' HB ', 165.48, 119.487, 114.142], ['A', ' HB ', 167.015, 119.969, 114.888]] AA_SCO= 2.384210526315789 CA_SCO= 1.6079473684210528
[['A', ' N ', 167.027, 122.611, 115.475], ['A', ' CA ', 167.754, 123.714, 114.846], ['A', ' C ', 168.652, 123.2, 113.763], ['A', ' O ', 169.115, 122.062, 113.811], ['A', ' CB ', 168.669, 124.466, 115.805], ['A', ' CG ', 168.02, 125.368, 116.738], ['A', ' OD1', 167.404, 126.342, 116.292], ['A', ' ND2', 168.132, 125.08, 118.012], ['A', ' H ', 167.446, 122.114, 116.251], ['A', ' HA ', 167.039, 124.403, 114.395], ['A', ' HB ', 169.247, 123.743, 116.379], ['A', ' HB ', 169.392, 125.05, 115.226], ['A', ' HD2', 167.69, 125.656, 118.729], ['A', ' HD2', 168.653, 124.276, 118.294]] AA_SCO= 2.38 CA_SCO= 1.61
[['A', ' N ', 168.959, 124.047, 112.815], ['A', ' CA ', 169.995, 123.697, 111.871], ['A', ' C ', 171.248, 123.936, 112.677], ['A', ' O ', 171.369, 125.016, 113.246], ['A', ' CB ', 169.972, 124.616, 110.628], ['A', ' CG1', 168.672, 124.442, 109.846], ['A', ' CG2', 171.121, 124.359, 109.778], ['A', ' CD1', 168.488, 125.451, 108.708], ['A', ' H ', 168.513, 124.956, 112.806], ['A', ' HA ', 169.934, 122.646, 111.586], ['A', ' HB ', 170.021, 125.648, 110.963], ['A', ' HG1', 168.64, 123.433, 109.431], ['A', ' HG1', 167.836, 124.556, 110.535], ['A', ' HG2', 171.146, 125.014, 108.932], ['A', ' HG2', 172.022, 124.507, 110.353], ['A', ' HG2', 171.048, 123.339, 109.44], ['A', ' HD1', 167.564, 125.283, 108.217], ['A', ' HD1', 168.491, 126.445, 109.097], ['A', ' HD1', 169.267, 125.362, 107.971]] AA_SCO= 2.466315789473684 CA_SCO= 1.6188421052631579
[['A', ' N ', 172.172, 122.986, 112.752], ['A', ' CA ', 173.342, 123.268, 113.587], ['A', ' C ', 174.385, 124.11, 112.88], ['A', ' O ', 174.312, 124.361, 111.667], ['A', ' CB ', 174.028, 122.005, 114.081], ['A', ' OG1', 174.973, 122.376, 115.097], ['A', ' CG2', 174.76, 121.344, 112.934], ['A', ' H ', 172.023, 122.08, 112.286], ['A', ' HA ', 173.005, 123.82, 114.465], ['A', ' HB ', 173.286, 121.319, 114.494], ['A', ' HG1', 175.282, 121.588, 115.558], ['A', ' HG2', 175.255, 120.442, 113.278], ['A', ' HG2', 174.045, 121.096, 112.161], ['A', ' HG2', 175.498, 121.994, 112.527]] AA_SCO= 2.4752631578947364 CA_SCO= 1.6309473684210527
[['A', ' N ', 175.427, 124.509, 113.605], ['A', ' CA ', 176.441, 125.363, 112.987], ['A', ' C ', 177.503, 124.544, 112.248], ['A', ' O ', 178.669, 124.465, 112.625], ['A', ' CB ', 177.09, 126.276, 114.02], ['A', ' CG ', 177.958, 127.368, 113.406], ['A', ' CD ', 178.621, 128.26, 114.413], ['A', ' OE1', 178.683, 127.901, 115.563], ['A', ' OE2', 179.034, 129.336, 114.03], ['A', ' H ', 175.483, 124.225, 114.582], ['A', ' HA ', 175.948, 126.001, 112.257], ['A', ' HB ', 176.315, 126.758, 114.618], ['A', ' HB ', 177.708, 125.685, 114.696], ['A', ' HG ', 178.731, 126.921, 112.793], ['A', ' HG ', 177.329, 127.975, 112.756]] AA_SCO= 2.4531578947368415 CA_SCO= 1.6309473684210527
[['A', ' N ', 177.038, 123.964, 111.181], ['A', ' CA ', 177.723, 123.124, 110.225], ['A', ' C ', 176.806, 123.117, 109.058], ['A', ' O ', 177.151, 123.577, 107.972], ['A', ' CB ', 177.95, 121.693, 110.742], ['A', ' CG ', 178.607, 120.67, 109.754], ['A', ' CD1', 180.003, 121.123, 109.335], ['A', ' CD2', 178.655, 119.296, 110.441], ['A', ' H ', 176.045, 124.131, 111.058], ['A', ' HA ', 178.667, 123.588, 109.947], ['A', ' HB ', 178.572, 121.744, 111.635], ['A', ' HB ', 177.002, 121.262, 111.02], ['A', ' HG ', 177.993, 120.585, 108.853], ['A', ' HD1', 180.431, 120.388, 108.655], ['A', ' HD1', 179.951, 122.083, 108.827], ['A', ' HD1', 180.638, 121.212, 110.215], ['A', ' HD2', 179.086, 118.562, 109.758], ['A', ' HD2', 179.262, 119.35, 111.345], ['A', ' HD2', 177.645, 118.989, 110.706]] AA_SCO= 2.4573684210526316 CA_SCO= 1.6393684210526314
[['A', ' N ', 175.601, 122.636, 109.311], ['A', ' CA ', 174.578, 122.602, 108.311], ['A', ' C ', 174.233, 124.019, 107.865], ['A', ' O ', 174.078, 124.263, 106.676], ['A', ' CB ', 173.361, 121.909, 108.877], ['A', ' H ', 175.406, 122.253, 110.228], ['A', ' HA ', 174.949, 122.052, 107.447], ['A', ' HB ', 172.569, 121.869, 108.131], ['A', ' HB ', 173.599, 120.929, 109.189], ['A', ' HB ', 173.038, 122.452, 109.74]] AA_SCO= 2.4584210526315795 CA_SCO= 1.7995789473684212
[['A', ' N ', 174.192, 124.977, 108.797], ['A', ' CA ', 173.866, 126.349, 108.435], ['A', ' C ', 174.878, 126.902, 107.466], ['A', ' O ', 174.517, 127.539, 106.478], ['A', ' CB ', 173.839, 127.222, 109.676], ['A', ' CG ', 173.566, 128.719, 109.477], ['A', ' CD ', 173.604, 129.39, 110.799], ['A', ' NE ', 173.483, 130.833, 110.766], ['A', ' CZ ', 174.493, 131.69, 110.477], ['A', ' NH1', 175.694, 131.252, 110.132], ['A', ' NH2', 174.256, 132.976, 110.549], ['A', ' H ', 174.323, 124.737, 109.779], ['A', ' HA ', 172.885, 126.363, 107.963], ['A', ' HB ', 173.076, 126.845, 110.359], ['A', ' HB ', 174.794, 127.132, 110.194], ['A', ' HG ', 174.309, 129.166, 108.818], ['A', ' HG ', 172.574, 128.869, 109.059], ['A', ' HD ', 172.739, 129.028, 111.339], ['A', ' HD ', 174.508, 129.125, 111.343], ['A', ' HE ', 172.569, 131.274, 111.086], ['A', ' HH1', 175.878, 130.267, 110.078], ['A', ' HH1', 176.423, 131.916, 109.921], ['A', ' HH2', 173.309, 133.276, 110.82], ['A', ' HH2', 174.961, 133.656, 110.335]] AA_SCO= 2.445263157894737 CA_SCO= 1.8192105263157894
[['A', ' N ', 176.15, 126.669, 107.753], ['A', ' CA ', 177.216, 127.17, 106.915], ['A', ' C ', 177.267, 126.47, 105.574], ['A', ' O ', 177.476, 127.12, 104.545], ['A', ' CB ', 178.542, 127.046, 107.642], ['A', ' CG ', 178.683, 128.02, 108.796], ['A', ' CD ', 179.998, 127.842, 109.533], ['A', ' CE ', 180.149, 128.883, 110.637], ['A', ' NZ ', 181.383, 128.673, 111.448], ['A', ' H ', 176.367, 126.148, 108.59], ['A', ' HA ', 177.029, 128.227, 106.727], ['A', ' HB ', 178.644, 126.03, 108.036], ['A', ' HB ', 179.361, 127.214, 106.944], ['A', ' HG ', 178.622, 129.039, 108.412], ['A', ' HG ', 177.862, 127.868, 109.497], ['A', ' HD ', 180.03, 126.846, 109.984], ['A', ' HD ', 180.829, 127.938, 108.836], ['A', ' HE ', 180.192, 129.871, 110.186], ['A', ' HE ', 179.286, 128.837, 111.291], ['A', ' HZ ', 181.43, 129.39, 112.167], ['A', ' HZ ', 181.343, 127.763, 111.889], ['A', ' HZ ', 182.199, 128.729, 110.858]] AA_SCO= 2.4463157894736844 CA_SCO= 1.8190526315789473
[['A', ' N ', 177.045, 125.159, 105.555], ['A', ' CA ', 177.081, 124.467, 104.288], ['A', ' C ', 175.945, 124.906, 103.411], ['A', ' O ', 176.138, 125.162, 102.22], ['A', ' CB ', 176.974, 122.972, 104.477], ['A', ' CG ', 178.181, 122.339, 105.035], ['A', ' CD ', 178.033, 120.874, 105.183], ['A', ' NE ', 179.219, 120.329, 105.758], ['A', ' CZ ', 180.345, 120.061, 105.07], ['A', ' NH1', 180.405, 120.266, 103.771], ['A', ' NH2', 181.399, 119.599, 105.694], ['A', ' H ', 176.901, 124.639, 106.424], ['A', ' HA ', 178.023, 124.698, 103.792], ['A', ' HB ', 176.148, 122.756, 105.157], ['A', ' HB ', 176.749, 122.495, 103.523], ['A', ' HG ', 179.015, 122.551, 104.376], ['A', ' HG ', 178.394, 122.754, 106.012], ['A', ' HD ', 177.204, 120.661, 105.866], ['A', ' HD ', 177.843, 120.39, 104.224], ['A', ' HE ', 179.213, 120.137, 106.754], ['A', ' HH1', 179.603, 120.609, 103.27], ['A', ' HH1', 181.254, 120.053, 103.268], ['A', ' HH2', 181.365, 119.418, 106.686], ['A', ' HH2', 182.249, 119.395, 105.178]] AA_SCO= 2.487368421052632 CA_SCO= 1.8694210526315784
[['A', ' N ', 174.763, 125.054, 103.991], ['A', ' CA ', 173.639, 125.447, 103.191], ['A', ' C ', 173.808, 126.846, 102.704], ['A', ' O ', 173.446, 127.147, 101.566], ['A', ' CB ', 172.356, 125.383, 103.982], ['A', ' CG ', 171.853, 124.037, 104.413], ['A', ' CD1', 170.621, 124.303, 105.28], ['A', ' CD2', 171.593, 123.151, 103.195], ['A', ' H ', 174.631, 124.84, 104.984], ['A', ' HA ', 173.588, 124.807, 102.319], ['A', ' HB ', 172.505, 125.971, 104.893], ['A', ' HB ', 171.581, 125.855, 103.399], ['A', ' HG ', 172.572, 123.535, 105.033], ['A', ' HD1', 170.222, 123.38, 105.647], ['A', ' HD1', 170.913, 124.925, 106.125], ['A', ' HD1', 169.863, 124.818, 104.704], ['A', ' HD2', 171.203, 122.21, 103.514], ['A', ' HD2', 170.9, 123.614, 102.549], ['A', ' HD2', 172.507, 122.974, 102.651]] AA_SCO= 2.5500000000000003 CA_SCO= 1.8752105263157894
[['A', ' N ', 174.371, 127.701, 103.543], ['A', ' CA ', 174.567, 129.063, 103.167], ['A', ' C ', 175.434, 129.126, 101.952], ['A', ' O ', 175.105, 129.806, 100.976], ['A', ' CB ', 175.236, 129.827, 104.277], ['A', ' CG ', 175.415, 131.18, 103.912], ['A', ' CD1', 174.358, 131.976, 104.042], ['A', ' CD2', 176.604, 131.651, 103.418], ['A', ' CE1', 174.422, 133.237, 103.712], ['A', ' CE2', 176.687, 132.963, 103.067], ['A', ' CZ ', 175.584, 133.765, 103.223], ['A', ' OH ', 175.616, 135.091, 102.885], ['A', ' H ', 174.621, 127.421, 104.495], ['A', ' HA ', 173.606, 129.511, 102.925], ['A', ' HB ', 174.632, 129.783, 105.182], ['A', ' HB ', 176.205, 129.392, 104.501], ['A', ' HD1', 173.448, 131.584, 104.415], ['A', ' HD2', 177.466, 130.993, 103.307], ['A', ' HE1', 173.533, 133.849, 103.831], ['A', ' HE2', 177.614, 133.369, 102.673], ['A', ' HH ', 174.887, 135.55, 103.381]] AA_SCO= 2.5089473684210533 CA_SCO= 1.8753684210526311
[['A', ' N ', 176.557, 128.414, 101.997], ['A', ' CA ', 177.462, 128.437, 100.883], ['A', ' C ', 176.8, 127.908, 99.642], ['A', ' O ', 176.973, 128.481, 98.569], ['A', ' CB ', 178.677, 127.605, 101.192], ['A', ' H ', 176.793, 127.875, 102.837], ['A', ' HA ', 177.756, 129.47, 100.705], ['A', ' HB ', 179.365, 127.639, 100.35], ['A', ' HB ', 179.164, 127.997, 102.085], ['A', ' HB ', 178.365, 126.574, 101.372]] AA_SCO= 2.513157894736842 CA_SCO= 1.931473684210526
[['A', ' N ', 175.993, 126.859, 99.769], ['A', ' CA ', 175.363, 126.321, 98.588], ['A', ' C ', 174.41, 127.301, 97.956], ['A', ' O ', 174.409, 127.443, 96.736], ['A', ' CB ', 174.573, 125.073, 98.917], ['A', ' CG ', 175.375, 123.852, 99.221], ['A', ' CD ', 174.49, 122.718, 99.577], ['A', ' NE ', 175.238, 121.546, 99.926], ['A', ' CZ ', 175.745, 120.657, 99.052], ['A', ' NH1', 175.586, 120.793, 97.736], ['A', ' NH2', 176.414, 119.617, 99.509], ['A', ' H ', 175.891, 126.393, 100.676], ['A', ' HA ', 176.143, 126.073, 97.867], ['A', ' HB ', 173.942, 125.27, 99.781], ['A', ' HB ', 173.914, 124.834, 98.083], ['A', ' HG ', 175.945, 123.582, 98.334], ['A', ' HG ', 176.057, 124.043, 100.037], ['A', ' HD ', 173.891, 122.998, 100.442], ['A', ' HD ', 173.831, 122.483, 98.757], ['A', ' HE ', 175.393, 121.37, 100.911], ['A', ' HH1', 175.046, 121.566, 97.326], ['A', ' HH1', 175.975, 120.095, 97.12], ['A', ' HH2', 176.555, 119.472, 100.525], ['A', ' HH2', 176.783, 118.944, 98.86]] AA_SCO= 2.56 CA_SCO= 1.931473684210526
[['A', ' N ', 173.619, 128.003, 98.761], ['A', ' CA ', 172.656, 128.908, 98.174], ['A', ' C ', 173.322, 130.15, 97.622], ['A', ' O ', 172.899, 130.698, 96.599], ['A', ' CB ', 171.623, 129.344, 99.189], ['A', ' CG ', 170.675, 128.298, 99.757], ['A', ' CD1', 169.824, 129.041, 100.76], ['A', ' CD2', 169.836, 127.594, 98.647], ['A', ' H ', 173.644, 127.833, 99.773], ['A', ' HA ', 172.162, 128.395, 97.364], ['A', ' HB ', 172.165, 129.771, 100.038], ['A', ' HB ', 171.023, 130.12, 98.747], ['A', ' HG ', 171.247, 127.541, 100.296], ['A', ' HD1', 169.137, 128.384, 101.26], ['A', ' HD1', 170.466, 129.499, 101.484], ['A', ' HD1', 169.269, 129.813, 100.244], ['A', ' HD2', 169.167, 126.88, 99.076], ['A', ' HD2', 169.261, 128.31, 98.119], ['A', ' HD2', 170.487, 127.073, 97.954]] AA_SCO= 2.5294736842105263 CA_SCO= 1.9313157894736839
[['A', ' N ', 174.363, 130.623, 98.287], ['A', ' CA ', 175.039, 131.803, 97.804], ['A', ' C ', 175.696, 131.489, 96.463], ['A', ' O ', 175.681, 132.314, 95.549], ['A', ' CB ', 176.04, 132.3, 98.836], ['A', ' CG ', 176.736, 133.595, 98.468], ['A', ' CD ', 177.632, 134.068, 99.604], ['A', ' CE ', 178.38, 135.338, 99.24], ['A', ' NZ ', 179.305, 135.781, 100.331], ['A', ' H ', 174.674, 130.18, 99.159], ['A', ' HA ', 174.3, 132.585, 97.64], ['A', ' HB ', 175.526, 132.448, 99.79], ['A', ' HB ', 176.8, 131.531, 98.997], ['A', ' HG ', 177.341, 133.442, 97.571], ['A', ' HG ', 175.988, 134.358, 98.255], ['A', ' HD ', 177.01, 134.278, 100.472], ['A', ' HD ', 178.342, 133.285, 99.866], ['A', ' HE ', 178.96, 135.161, 98.336], ['A', ' HE ', 177.659, 136.132, 99.046], ['A', ' HZ ', 179.781, 136.624, 100.041], ['A', ' HZ ', 178.793, 135.967, 101.184], ['A', ' HZ ', 179.986, 135.056, 100.506]] AA_SCO= 2.6047368421052637 CA_SCO= 1.9354736842105265
[['A', ' N ', 176.279, 130.291, 96.352], ['A', ' CA ', 176.918, 129.821, 95.133], ['A', ' C ', 175.885, 129.535, 94.048], ['A', ' O ', 176.176, 129.688, 92.864], ['A', ' CB ', 177.727, 128.577, 95.435], ['A', ' CG ', 178.949, 128.829, 96.291], ['A', ' CD ', 179.546, 127.539, 96.769], ['A', ' OE1', 178.929, 126.482, 96.599], ['A', ' NE2', 180.731, 127.601, 97.365], ['A', ' H ', 176.304, 129.669, 97.166], ['A', ' HA ', 177.585, 130.6, 94.77], ['A', ' HB ', 177.089, 127.862, 95.956], ['A', ' HB ', 178.048, 128.114, 94.504], ['A', ' HG ', 179.692, 129.341, 95.683], ['A', ' HG ', 178.688, 129.445, 97.145], ['A', ' HE2', 181.167, 126.764, 97.699], ['A', ' HE2', 181.193, 128.481, 97.479]] AA_SCO= 2.5889473684210524 CA_SCO= 1.9223157894736842
[['A', ' N ', 174.696, 129.091, 94.462], ['A', ' CA ', 173.569, 128.798, 93.592], ['A', ' C ', 172.984, 130.015, 92.922], ['A', ' O ', 172.678, 129.978, 91.731], ['A', ' CB ', 172.445, 128.149, 94.404], ['A', ' CG ', 171.162, 127.862, 93.696], ['A', ' CD1', 171.39, 126.978, 92.583], ['A', ' CD2', 170.155, 127.246, 94.669], ['A', ' H ', 174.585, 128.884, 95.454], ['A', ' HA ', 173.927, 128.114, 92.827], ['A', ' HB ', 172.812, 127.223, 94.837], ['A', ' HB ', 172.195, 128.817, 95.191], ['A', ' HG ', 170.753, 128.783, 93.32], ['A', ' HD1', 170.444, 126.838, 92.138], ['A', ' HD1', 172.061, 127.407, 91.866], ['A', ' HD1', 171.79, 126.036, 92.92], ['A', ' HD2', 169.208, 127.047, 94.154], ['A', ' HD2', 170.537, 126.324, 95.062], ['A', ' HD2', 169.981, 127.936, 95.487]] AA_SCO= 2.565789473684211 CA_SCO= 1.9257894736842107
[['A', ' N ', 172.823, 131.094, 93.669], ['A', ' CA ', 172.219, 132.308, 93.15], ['A', ' C ', 172.514, 132.614, 91.674], ['A', ' O ', 171.547, 132.794, 90.932], ['A', ' CB ', 172.52, 133.468, 94.086], ['A', ' CG ', 171.896, 134.768, 93.682], ['A', ' CD ', 172.16, 135.824, 94.735], ['A', ' CE ', 171.566, 137.157, 94.339], ['A', ' NZ ', 171.798, 138.19, 95.378], ['A', ' H ', 173.055, 131.035, 94.668], ['A', ' HA ', 171.155, 132.179, 93.185], ['A', ' HB ', 172.118, 133.216, 95.07], ['A', ' HB ', 173.582, 133.601, 94.224], ['A', ' HG ', 172.314, 135.099, 92.729], ['A', ' HG ', 170.819, 134.634, 93.562], ['A', ' HD ', 171.723, 135.506, 95.685], ['A', ' HD ', 173.236, 135.939, 94.87], ['A', ' HE ', 172.019, 137.486, 93.405], ['A', ' HE ', 170.491, 137.042, 94.19], ['A', ' HZ ', 171.389, 139.066, 95.085], ['A', ' HZ ', 171.366, 137.891, 96.239], ['A', ' HZ ', 172.79, 138.314, 95.521]] AA_SCO= 2.416842105263158 CA_SCO= 1.925842105263158
[['A', ' N ', 173.765, 132.732, 91.188], ['A', ' CA ', 174.057, 133.009, 89.798], ['A', ' C ', 173.577, 131.941, 88.815], ['A', ' O ', 173.381, 132.258, 87.647], ['A', ' CB ', 175.58, 133.136, 89.79], ['A', ' CG ', 176.034, 132.431, 91.026], ['A', ' CD ', 174.963, 132.704, 92.037], ['A', ' HA ', 173.61, 133.979, 89.544], ['A', ' HB ', 175.986, 132.674, 88.875], ['A', ' HB ', 175.868, 134.196, 89.769], ['A', ' HG ', 176.157, 131.352, 90.834], ['A', ' HG ', 177.017, 132.805, 91.347], ['A', ' HD ', 174.985, 131.925, 92.766], ['A', ' HD ', 175.13, 133.684, 92.495]] AA_SCO= 2.4268421052631584 CA_SCO= 1.9459473684210526
[['A', ' N ', 173.373, 130.695, 89.253], ['A', ' CA ', 172.92, 129.663, 88.336], ['A', ' C ', 171.437, 129.8, 88.185], ['A', ' O ', 170.884, 129.552, 87.11], ['A', ' CB ', 173.263, 128.265, 88.844], ['A', ' CG ', 174.762, 127.941, 88.953], ['A', ' CD ', 175.492, 128.016, 87.592], ['A', ' CE ', 175.089, 126.884, 86.635], ['A', ' NZ ', 175.761, 127.03, 85.312], ['A', ' H ', 173.512, 130.432, 90.223], ['A', ' HA ', 173.359, 129.831, 87.355], ['A', ' HB ', 172.859, 128.162, 89.843], ['A', ' HB ', 172.769, 127.519, 88.232], ['A', ' HG ', 175.224, 128.654, 89.644], ['A', ' HG ', 174.881, 126.938, 89.366], ['A', ' HD ', 175.338, 128.974, 87.102], ['A', ' HD ', 176.56, 127.921, 87.779], ['A', ' HE ', 175.371, 125.928, 87.075], ['A', ' HE ', 174.017, 126.897, 86.469], ['A', ' HZ ', 175.481, 126.282, 84.699], ['A', ' HZ ', 175.46, 127.941, 84.9], ['A', ' HZ ', 176.76, 127.02, 85.42]] AA_SCO= 2.4263157894736844 CA_SCO= 1.8014736842105261
[['A', ' N ', 170.79, 130.227, 89.26], ['A', ' CA ', 169.368, 130.453, 89.191], ['A', ' C ', 169.168, 131.613, 88.275], ['A', ' O ', 168.25, 131.584, 87.464], ['A', ' CB ', 168.714, 130.686, 90.55], ['A', ' CG1', 167.238, 131.133, 90.393], ['A', ' CG2', 168.75, 129.395, 91.258], ['A', ' H ', 171.33, 130.381, 90.119], ['A', ' HA ', 168.896, 129.578, 88.748], ['A', ' HB ', 169.261, 131.452, 91.105], ['A', ' HG1', 166.791, 131.26, 91.38], ['A', ' HG1', 167.18, 132.083, 89.855], ['A', ' HG1', 166.684, 130.375, 89.839], ['A', ' HG2', 168.301, 129.473, 92.225], ['A', ' HG2', 168.204, 128.676, 90.674], ['A', ' HG2', 169.773, 129.085, 91.348]] AA_SCO= 2.4210526315789473 CA_SCO= 1.8012105263157894
[['A', ' N ', 170.013, 132.635, 88.396], ['A', ' CA ', 169.873, 133.773, 87.527], ['A', ' C ', 170.073, 133.36, 86.065], ['A', ' O ', 169.302, 133.78, 85.209], ['A', ' CB ', 170.868, 134.839, 87.886], ['A', ' CG ', 170.565, 135.517, 89.167], ['A', ' OD1', 169.459, 135.459, 89.702], ['A', ' ND2', 171.547, 136.193, 89.685], ['A', ' H ', 170.728, 132.615, 89.129], ['A', ' HA ', 168.876, 134.181, 87.642], ['A', ' HB ', 171.858, 134.401, 87.944], ['A', ' HB ', 170.892, 135.587, 87.095], ['A', ' HD2', 171.411, 136.693, 90.538], ['A', ' HD2', 172.432, 136.227, 89.223]] AA_SCO= 2.3184210526315794 CA_SCO= 1.7646315789473679
[['A', ' N ', 171.034, 132.475, 85.76], ['A', ' CA ', 171.193, 132.067, 84.364], ['A', ' C ', 169.958, 131.341, 83.866], ['A', ' O ', 169.496, 131.57, 82.741], ['A', ' CB ', 172.38, 131.114, 84.197], ['A', ' CG ', 173.762, 131.716, 84.351], ['A', ' CD ', 174.861, 130.644, 84.372], ['A', ' OE1', 174.53, 129.47, 84.35], ['A', ' OE2', 176.012, 130.992, 84.427], ['A', ' H ', 171.703, 132.161, 86.47], ['A', ' HA ', 171.347, 132.957, 83.755], ['A', ' HB ', 172.294, 130.317, 84.937], ['A', ' HB ', 172.33, 130.646, 83.215], ['A', ' HG ', 173.943, 132.387, 83.514], ['A', ' HG ', 173.804, 132.303, 85.254]] AA_SCO= 2.3415789473684216 CA_SCO= 1.7644210526315787
[['A', ' N ', 169.408, 130.484, 84.717], ['A', ' CA ', 168.235, 129.71, 84.389], ['A', ' C ', 167.032, 130.56, 84.118], ['A', ' O ', 166.35, 130.38, 83.104], ['A', ' CB ', 167.903, 128.75, 85.513], ['A', ' CG ', 166.642, 128.06, 85.308], ['A', ' ND1', 166.456, 127.116, 84.34], ['A', ' CD2', 165.472, 128.182, 85.95], ['A', ' CE1', 165.221, 126.681, 84.398], ['A', ' NE2', 164.609, 127.308, 85.379], ['A', ' H ', 169.87, 130.322, 85.618], ['A', ' HA ', 168.435, 129.126, 83.493], ['A', ' HB ', 168.699, 128.01, 85.615], ['A', ' HB ', 167.844, 129.292, 86.451], ['A', ' HD1', 167.131, 126.803, 83.675], ['A', ' HD2', 165.152, 128.809, 86.779], ['A', ' HE1', 164.865, 125.919, 83.701]] AA_SCO= 2.336315789473684 CA_SCO= 1.7367894736842102
[['A', ' N ', 166.756, 131.501, 85.0], ['A', ' CA ', 165.577, 132.287, 84.784], ['A', ' C ', 165.77, 133.208, 83.613], ['A', ' O ', 164.859, 133.36, 82.817], ['A', ' CB ', 165.172, 133.063, 86.043], ['A', ' CG1', 164.898, 132.058, 87.164], ['A', ' CG2', 166.19, 134.015, 86.43], ['A', ' H ', 167.354, 131.619, 85.822], ['A', ' HA ', 164.757, 131.607, 84.553], ['A', ' HB ', 164.296, 133.62, 85.858], ['A', ' HG1', 164.596, 132.584, 88.06], ['A', ' HG1', 164.103, 131.382, 86.856], ['A', ' HG1', 165.788, 131.483, 87.377], ['A', ' HG2', 165.856, 134.504, 87.303], ['A', ' HG2', 167.079, 133.498, 86.628], ['A', ' HG2', 166.366, 134.757, 85.668]] AA_SCO= 2.263157894736842 CA_SCO= 1.7366842105263158
[['A', ' N ', 166.96, 133.75, 83.393], ['A', ' CA ', 167.059, 134.645, 82.265], ['A', ' C ', 166.868, 133.857, 80.972], ['A', ' O ', 166.268, 134.369, 80.017], ['A', ' CB ', 168.366, 135.416, 82.306], ['A', ' CG ', 168.457, 136.409, 83.507], ['A', ' CD ', 167.35, 137.428, 83.561], ['A', ' OE1', 166.976, 137.91, 82.524], ['A', ' OE2', 166.884, 137.75, 84.659], ['A', ' H ', 167.755, 133.618, 84.026], ['A', ' HA ', 166.251, 135.371, 82.332], ['A', ' HB ', 169.197, 134.711, 82.393], ['A', ' HB ', 168.496, 135.975, 81.381], ['A', ' HG ', 168.423, 135.855, 84.429], ['A', ' HG ', 169.414, 136.922, 83.465]] AA_SCO= 2.1578947368421053 CA_SCO= 1.469052631578947
[['A', ' N ', 167.33, 132.603, 80.924], ['A', ' CA ', 167.08, 131.802, 79.742], ['A', ' C ', 165.604, 131.547, 79.557], ['A', ' O ', 165.071, 131.756, 78.466], ['A', ' CB ', 167.756, 130.43, 79.833], ['A', ' CG ', 167.43, 129.421, 78.659], ['A', ' CD1', 167.894, 129.984, 77.315], ['A', ' CD2', 168.077, 128.065, 78.96], ['A', ' H ', 167.9, 132.226, 81.691], ['A', ' HA ', 167.458, 132.349, 78.883], ['A', ' HB ', 168.834, 130.58, 79.868], ['A', ' HB ', 167.453, 129.961, 80.771], ['A', ' HG ', 166.352, 129.276, 78.599], ['A', ' HD1', 167.646, 129.277, 76.525], ['A', ' HD1', 167.396, 130.927, 77.105], ['A', ' HD1', 168.971, 130.138, 77.336], ['A', ' HD2', 167.831, 127.356, 78.167], ['A', ' HD2', 169.161, 128.181, 79.021], ['A', ' HD2', 167.699, 127.689, 79.912]] AA_SCO= 2.165263157894737 CA_SCO= 1.310315789473684
[['A', ' N ', 164.922, 131.119, 80.621], ['A', ' CA ', 163.514, 130.806, 80.475], ['A', ' C ', 162.679, 132.031, 80.204], ['A', ' O ', 161.658, 131.924, 79.558], ['A', ' CB ', 162.972, 130.075, 81.701], ['A', ' CG ', 163.47, 128.641, 81.873], ['A', ' SD ', 163.147, 127.567, 80.427], ['A', ' CE ', 161.34, 127.416, 80.344], ['A', ' H ', 165.4, 130.975, 81.516], ['A', ' HA ', 163.406, 130.153, 79.615], ['A', ' HB ', 163.28, 130.624, 82.596], ['A', ' HB ', 161.882, 130.079, 81.684], ['A', ' HG ', 164.546, 128.669, 82.049], ['A', ' HG ', 162.999, 128.197, 82.75], ['A', ' HE ', 161.067, 126.791, 79.496], ['A', ' HE ', 160.969, 126.957, 81.257], ['A', ' HE ', 160.888, 128.405, 80.218]] AA_SCO= 2.158421052631579 CA_SCO= 1.307
[['A', ' N ', 163.092, 133.185, 80.705], ['A', ' CA ', 162.377, 134.427, 80.491], ['A', ' C ', 162.56, 134.9, 79.055], ['A', ' O ', 161.62, 135.428, 78.472], ['A', ' CB ', 162.781, 135.507, 81.506], ['A', ' CG1', 162.32, 135.052, 82.923], ['A', ' CG2', 162.128, 136.854, 81.119], ['A', ' CD1', 162.903, 135.869, 84.08], ['A', ' H ', 163.919, 133.192, 81.296], ['A', ' HA ', 161.316, 134.233, 80.638], ['A', ' HB ', 163.87, 135.608, 81.523], ['A', ' HG1', 161.253, 135.092, 82.967], ['A', ' HG1', 162.604, 134.02, 83.062], ['A', ' HG2', 162.402, 137.62, 81.833], ['A', ' HG2', 162.465, 137.169, 80.134], ['A', ' HG2', 161.044, 136.743, 81.102], ['A', ' HD1', 162.541, 135.483, 85.028], ['A', ' HD1', 163.996, 135.799, 84.056], ['A', ' HD1', 162.608, 136.906, 83.993]] AA_SCO= 2.187894736842105 CA_SCO= 1.3039473684210527
[['A', ' N ', 163.786, 134.813, 78.502], ['A', ' CA ', 163.996, 135.187, 77.1], ['A', ' C ', 163.144, 134.275, 76.202], ['A', ' O ', 162.48, 134.74, 75.26], ['A', ' H ', 164.581, 134.481, 79.055], ['A', ' HA ', 163.721, 136.23, 76.952], ['A', ' HA ', 165.051, 135.079, 76.852]] AA_SCO= 2.1047368421052632 CA_SCO= 1.2967368421052632
[['A', ' N ', 163.122, 132.986, 76.545], ['A', ' CA ', 162.287, 132.009, 75.876], ['A', ' C ', 160.912, 132.37, 76.356], ['A', ' O ', 160.776, 133.311, 77.116], ['A', ' CB ', 162.628, 130.573, 76.273], ['A', ' CG ', 164.023, 130.045, 75.933], ['A', ' CD1', 164.172, 128.707, 76.57], ['A', ' CD2', 164.188, 129.913, 74.438], ['A', ' H ', 163.727, 132.664, 77.31], ['A', ' HA ', 162.334, 132.133, 74.8], ['A', ' HB ', 162.505, 130.493, 77.353], ['A', ' HB ', 161.912, 129.902, 75.805], ['A', ' HG ', 164.783, 130.709, 76.324], ['A', ' HD1', 165.156, 128.296, 76.348], ['A', ' HD1', 164.057, 128.798, 77.648], ['A', ' HD1', 163.403, 128.054, 76.175], ['A', ' HD2', 165.178, 129.515, 74.22], ['A', ' HD2', 163.427, 129.232, 74.044], ['A', ' HD2', 164.083, 130.885, 73.965]] AA_SCO= 2.1184210526315788 CA_SCO= 1.2833157894736844
[['A', ' N ', 159.877, 131.755, 75.831], ['A', ' CA ', 158.486, 132.024, 76.229], ['A', ' C ', 158.007, 133.245, 75.496], ['A', ' O ', 156.985, 133.186, 74.833], ['A', ' CB ', 158.276, 132.324, 77.731], ['A', ' CG1', 158.739, 131.173, 78.546], ['A', ' CG2', 156.738, 132.547, 77.968], ['A', ' CD1', 158.795, 131.505, 80.019], ['A', ' H ', 160.052, 131.042, 75.133], ['A', ' HA ', 157.862, 131.189, 75.944], ['A', ' HB ', 158.762, 133.229, 78.063], ['A', ' HG1', 158.128, 130.333, 78.341], ['A', ' HG1', 159.742, 130.912, 78.259], ['A', ' HG2', 156.527, 132.756, 79.007], ['A', ' HG2', 156.388, 133.39, 77.385], ['A', ' HG2', 156.191, 131.651, 77.667], ['A', ' HD1', 159.182, 130.653, 80.572], ['A', ' HD1', 159.445, 132.353, 80.178], ['A', ' HD1', 157.83, 131.757, 80.403]] AA_SCO= 2.081578947368421 CA_SCO= 1.2815789473684214
[['A', ' N ', 158.679, 134.376, 75.666], ['A', ' CA ', 158.315, 135.517, 74.849], ['A', ' C ', 158.825, 135.246, 73.428], ['A', ' O ', 158.116, 135.453, 72.437], ['A', ' CB ', 158.874, 136.815, 75.419], ['A', ' CG ', 158.21, 137.248, 76.733], ['A', ' CD ', 158.729, 138.564, 77.262], ['A', ' OE1', 159.688, 139.062, 76.724], ['A', ' OE2', 158.15, 139.078, 78.193], ['A', ' H ', 159.467, 134.382, 76.326], ['A', ' HA ', 157.23, 135.598, 74.816], ['A', ' HB ', 159.945, 136.688, 75.614], ['A', ' HB ', 158.762, 137.617, 74.691], ['A', ' HG ', 157.133, 137.324, 76.579], ['A', ' HG ', 158.384, 136.469, 77.481]] AA_SCO= 2.154210526315789 CA_SCO= 1.2775263157894738
[['A', ' N ', 160.038, 134.69, 73.335], ['A', ' CA ', 160.637, 134.305, 72.069], ['A', ' C ', 159.969, 133.009, 71.65], ['A', ' O ', 159.959, 132.048, 72.419], ['A', ' CB ', 162.151, 134.107, 72.163], ['A', ' CG ', 162.807, 133.875, 70.78], ['A', ' OD1', 162.079, 133.82, 69.797], ['A', ' OD2', 164.006, 133.75, 70.703], ['A', ' H ', 160.613, 134.574, 74.175], ['A', ' HA ', 160.427, 135.07, 71.321], ['A', ' HB ', 162.605, 134.981, 72.635], ['A', ' HB ', 162.363, 133.256, 72.792]] AA_SCO= 2.0978947368421053 CA_SCO= 1.2623684210526318
[['A', ' N ', 159.34, 133.001, 70.479], ['A', ' CA ', 158.557, 131.853, 70.012], ['A', ' C ', 157.432, 131.626, 70.993], ['A', ' O ', 157.121, 130.498, 71.384], ['A', ' CB ', 159.416, 130.584, 69.909], ['A', ' CG ', 160.719, 130.761, 69.138], ['A', ' CD ', 160.527, 130.996, 67.646], ['A', ' CE ', 161.884, 131.255, 66.975], ['A', ' NZ ', 162.353, 132.695, 67.167], ['A', ' H ', 159.427, 133.825, 69.9], ['A', ' HA ', 158.116, 132.085, 69.044], ['A', ' HB ', 159.648, 130.195, 70.898], ['A', ' HB ', 158.842, 129.814, 69.398], ['A', ' HG ', 161.28, 131.573, 69.561], ['A', ' HG ', 161.308, 129.857, 69.266], ['A', ' HD ', 160.057, 130.126, 67.189], ['A', ' HD ', 159.894, 131.863, 67.484], ['A', ' HE ', 162.619, 130.59, 67.425], ['A', ' HE ', 161.817, 131.041, 65.91], ['A', ' HZ ', 163.251, 132.821, 66.73], ['A', ' HZ ', 161.689, 133.317, 66.741], ['A', ' HZ ', 162.433, 132.961, 68.174]] AA_SCO= 1.9973684210526315 CA_SCO= 1.215421052631579
[['A', ' N ', 156.816, 132.734, 71.363], ['A', ' CA ', 155.73, 132.75, 72.298], ['A', ' C ', 154.363, 132.558, 71.694], ['A', ' O ', 154.193, 132.126, 70.55], ['A', ' H ', 157.158, 133.614, 71.0], ['A', ' HA ', 155.899, 131.977, 73.046], ['A', ' HA ', 155.748, 133.705, 72.824]] AA_SCO= 1.9868421052631582 CA_SCO= 1.010157894736842
[['A', ' N ', 153.383, 132.852, 72.519], ['A', ' CA ', 151.99, 132.661, 72.226], ['A', ' C ', 151.349, 134.028, 71.958], ['A', ' O ', 151.953, 135.037, 72.311], ['A', ' CB ', 151.414, 131.926, 73.429], ['A', ' CG ', 152.179, 130.601, 73.814], ['A', ' CD1', 151.597, 130.038, 75.061], ['A', ' CD2', 152.082, 129.575, 72.71], ['A', ' H ', 153.639, 133.23, 73.421], ['A', ' HA ', 151.923, 132.045, 71.342], ['A', ' HB ', 151.4, 132.594, 74.291], ['A', ' HB ', 150.418, 131.634, 73.201], ['A', ' HG ', 153.228, 130.826, 74.001], ['A', ' HD1', 152.131, 129.128, 75.328], ['A', ' HD1', 151.695, 130.755, 75.862], ['A', ' HD1', 150.548, 129.805, 74.901], ['A', ' HD2', 152.617, 128.672, 73.013], ['A', ' HD2', 151.05, 129.331, 72.54], ['A', ' HD2', 152.526, 129.952, 71.793]] AA_SCO= 2.08578947368421 CA_SCO= 0.992736842105263
[['A', ' N ', 150.174, 134.108, 71.3], ['A', ' CA ', 149.45, 135.331, 70.971], ['A', ' C ', 149.127, 136.212, 72.159], ['A', ' O ', 148.792, 135.73, 73.246], ['A', ' CB ', 148.146, 134.785, 70.395], ['A', ' CG ', 148.495, 133.449, 69.846], ['A', ' CD ', 149.514, 132.894, 70.794], ['A', ' HA ', 150.015, 135.898, 70.217], ['A', ' HB ', 147.401, 134.726, 71.195], ['A', ' HB ', 147.753, 135.48, 69.637], ['A', ' HG ', 147.589, 132.823, 69.798], ['A', ' HG ', 148.871, 133.535, 68.817], ['A', ' HD ', 149.018, 132.351, 71.587], ['A', ' HD ', 150.18, 132.269, 70.202]] AA_SCO= 2.0010526315789474 CA_SCO= 0.9459473684210524
[['A', ' N ', 149.203, 137.51, 71.933], ['A', ' CA ', 148.92, 138.473, 72.967], ['A', ' C ', 147.475, 138.36, 73.391], ['A', ' O ', 146.58, 138.218, 72.559], ['A', ' CB ', 149.206, 139.879, 72.453], ['A', ' CG ', 150.662, 140.105, 72.075], ['A', ' CD ', 150.979, 139.664, 70.662], ['A', ' OE1', 150.106, 139.111, 70.019], ['A', ' OE2', 152.081, 139.872, 70.229], ['A', ' H ', 149.483, 137.856, 71.009], ['A', ' HA ', 149.557, 138.265, 73.826], ['A', ' HB ', 148.588, 140.082, 71.578], ['A', ' HB ', 148.939, 140.607, 73.217], ['A', ' HG ', 150.895, 141.165, 72.175], ['A', ' HG ', 151.294, 139.553, 72.769]] AA_SCO= 1.985263157894737 CA_SCO= 1.06
[['A', ' N ', 147.238, 138.435, 74.691], ['A', ' CA ', 145.885, 138.343, 75.207], ['A', ' C ', 145.533, 136.905, 75.562], ['A', ' O ', 144.452, 136.625, 76.098], ['A', ' H ', 148.01, 138.554, 75.333], ['A', ' HA ', 145.786, 138.977, 76.084], ['A', ' HA ', 145.185, 138.719, 74.462]] AA_SCO= 1.9552631578947368 CA_SCO= 1.060157894736842
[['A', ' N ', 146.42, 135.967, 75.247], ['A', ' CA ', 146.101, 134.608, 75.577], ['A', ' C ', 146.202, 134.453, 77.066], ['A', ' O ', 147.233, 134.766, 77.672], ['A', ' CB ', 147.042, 133.652, 74.849], ['A', ' CG ', 146.844, 132.165, 75.114], ['A', ' CD1', 145.497, 131.692, 74.593], ['A', ' CD2', 147.934, 131.416, 74.448], ['A', ' H ', 147.29, 136.177, 74.747], ['A', ' HA ', 145.082, 134.407, 75.276], ['A', ' HB ', 146.921, 133.817, 73.776], ['A', ' HB ', 148.068, 133.912, 75.107], ['A', ' HG ', 146.893, 131.995, 76.175], ['A', ' HD1', 145.374, 130.635, 74.788], ['A', ' HD1', 144.684, 132.219, 75.071], ['A', ' HD1', 145.463, 131.864, 73.525], ['A', ' HD2', 147.843, 130.359, 74.659], ['A', ' HD2', 147.884, 131.583, 73.383], ['A', ' HD2', 148.866, 131.768, 74.826]] AA_SCO= 2.0473684210526315 CA_SCO= 1.0920526315789474
[['A', ' N ', 145.103, 134.007, 77.658], ['A', ' CA ', 144.992, 133.849, 79.091], ['A', ' C ', 144.642, 135.155, 79.808], ['A', ' O ', 144.813, 135.239, 81.019], ['A', ' H ', 144.303, 133.776, 77.077], ['A', ' HA ', 144.219, 133.107, 79.298], ['A', ' HA ', 145.918, 133.457, 79.493]] AA_SCO= 1.980526315789474 CA_SCO= 1.0631578947368419
[['A', ' N ', 144.2, 136.194, 79.091], ['A', ' CA ', 143.864, 137.449, 79.759], ['A', ' C ', 142.357, 137.61, 79.792], ['A', ' O ', 141.731, 137.787, 78.747], ['A', ' CB ', 144.477, 138.628, 78.999], ['A', ' CG1', 144.134, 139.921, 79.673], ['A', ' CG2', 145.94, 138.45, 78.941], ['A', ' H ', 144.079, 136.125, 78.076], ['A', ' HA ', 144.243, 137.43, 80.781], ['A', ' HB ', 144.067, 138.658, 77.989], ['A', ' HG1', 144.576, 140.747, 79.12], ['A', ' HG1', 143.054, 140.057, 79.709], ['A', ' HG1', 144.53, 139.903, 80.673], ['A', ' HG2', 146.403, 139.274, 78.408], ['A', ' HG2', 146.293, 138.428, 79.941], ['A', ' HG2', 146.182, 137.516, 78.439]] AA_SCO= 2.025263157894737 CA_SCO= 1.0876842105263158
[['A', ' N ', 141.767, 137.579, 80.987], ['A', ' CA ', 140.311, 137.593, 81.096], ['A', ' C ', 139.949, 137.64, 82.547], ['A', ' O ', 138.823, 137.939, 82.948], ['A', ' CB ', 139.744, 136.279, 80.565], ['A', ' CG ', 140.099, 135.169, 81.497], ['A', ' ND1', 141.397, 134.865, 81.799], ['A', ' CD2', 139.336, 134.287, 82.186], ['A', ' CE1', 141.429, 133.865, 82.636], ['A', ' NE2', 140.191, 133.48, 82.886], ['A', ' H ', 142.321, 137.474, 81.839], ['A', ' HA ', 139.88, 138.449, 80.578], ['A', ' HB ', 138.661, 136.342, 80.49], ['A', ' HB ', 140.135, 136.048, 79.576], ['A', ' HD2', 138.252, 134.232, 82.174], ['A', ' HE1', 142.329, 133.416, 83.045], ['A', ' HE2', 139.943, 132.679, 83.505]] AA_SCO= 2.0389473684210526 CA_SCO= 1.0625263157894735
[['A', ' N ', 140.926, 137.232, 83.305], ['A', ' CA ', 140.841, 136.921, 84.695], ['A', ' C ', 140.528, 138.02, 85.645], ['A', ' O ', 140.961, 139.162, 85.493], ['A', ' CB ', 142.158, 136.356, 85.096], ['A', ' CG ', 143.192, 137.323, 84.736], ['A', ' OD1', 143.327, 137.708, 83.544], ['A', ' ND2', 143.924, 137.784, 85.701], ['A', ' H ', 141.824, 137.085, 82.852], ['A', ' HA ', 140.068, 136.16, 84.811], ['A', ' HB ', 142.168, 136.216, 86.168], ['A', ' HB ', 142.362, 135.409, 84.637], ['A', ' HD2', 144.635, 138.443, 85.505], ['A', ' HD2', 143.778, 137.465, 86.641]] AA_SCO= 2.0989473684210527 CA_SCO= 1.3223684210526316
[['A', ' N ', 139.798, 137.621, 86.666], ['A', ' CA ', 139.493, 138.448, 87.791], ['A', ' C ', 140.613, 138.344, 88.826], ['A', ' O ', 140.968, 137.233, 89.229], ['A', ' CB ', 138.196, 137.983, 88.418], ['A', ' CG ', 137.855, 138.635, 89.743], ['A', ' CD ', 137.506, 140.071, 89.675], ['A', ' OE1', 136.562, 140.466, 88.979], ['A', ' NE2', 138.239, 140.894, 90.408], ['A', ' H ', 139.454, 136.671, 86.662], ['A', ' HA ', 139.356, 139.451, 87.42], ['A', ' HB ', 137.374, 138.18, 87.732], ['A', ' HB ', 138.237, 136.915, 88.558], ['A', ' HG ', 137.02, 138.1, 90.158], ['A', ' HG ', 138.696, 138.536, 90.414], ['A', ' HE2', 138.046, 141.878, 90.418], ['A', ' HE2', 139.034, 140.529, 90.955]] AA_SCO= 2.121052631578947 CA_SCO= 1.4385263157894734
[['A', ' N ', 141.278, 139.439, 89.174], ['A', ' CA ', 142.303, 139.503, 90.181], ['A', ' C ', 141.711, 139.504, 91.581], ['A', ' O ', 140.57, 139.938, 91.749], ['A', ' CB ', 142.976, 140.849, 89.855], ['A', ' CG ', 141.897, 141.688, 89.258], ['A', ' CD ', 141.058, 140.729, 88.463], ['A', ' HA ', 142.986, 138.658, 90.031], ['A', ' HB ', 143.369, 141.309, 90.772], ['A', ' HB ', 143.826, 140.696, 89.174], ['A', ' HG ', 141.324, 142.186, 90.056], ['A', ' HG ', 142.332, 142.483, 88.634], ['A', ' HD ', 140.04, 141.086, 88.53], ['A', ' HD ', 141.414, 140.672, 87.422]] AA_SCO= 2.1510526315789473 CA_SCO= 1.4266842105263156
[['A', ' N ', 142.448, 139.081, 92.606], ['A', ' CA ', 143.728, 138.367, 92.618], ['A', ' C ', 143.876, 138.018, 94.08], ['A', ' O ', 143.489, 138.82, 94.934], ['A', ' CB ', 144.97, 139.17, 92.154], ['A', ' OG1', 146.071, 138.302, 92.127], ['A', ' CG2', 145.283, 140.322, 93.094], ['A', ' H ', 142.039, 139.213, 93.522], ['A', ' HA ', 143.657, 137.441, 92.045], ['A', ' HB ', 144.832, 139.543, 91.183], ['A', ' HG1', 145.95, 137.68, 91.395], ['A', ' HG2', 146.166, 140.848, 92.735], ['A', ' HG2', 144.44, 141.011, 93.122], ['A', ' HG2', 145.486, 139.963, 94.099]] AA_SCO= 2.0068421052631575 CA_SCO= 1.3960000000000001
[['A', ' N ', 144.467, 136.896, 94.396], ['A', ' CA ', 144.665, 136.562, 95.789], ['A', ' C ', 146.109, 136.389, 96.234], ['A', ' O ', 146.846, 135.586, 95.668], ['A', ' CB ', 143.867, 135.296, 96.063], ['A', ' CG ', 143.993, 134.663, 97.412], ['A', ' CD1', 143.443, 135.56, 98.462], ['A', ' CD2', 143.236, 133.364, 97.398], ['A', ' H ', 144.713, 136.238, 93.658], ['A', ' HA ', 144.242, 137.368, 96.381], ['A', ' HB ', 142.831, 135.546, 95.94], ['A', ' HB ', 144.12, 134.561, 95.306], ['A', ' HG ', 145.045, 134.468, 97.639], ['A', ' HD1', 143.566, 135.048, 99.384], ['A', ' HD1', 143.98, 136.499, 98.504], ['A', ' HD1', 142.385, 135.756, 98.275], ['A', ' HD2', 143.316, 132.878, 98.37], ['A', ' HD2', 142.186, 133.558, 97.177], ['A', ' HD2', 143.645, 132.704, 96.637]] AA_SCO= 2.119473684210526 CA_SCO= 1.3929473684210527
[['A', ' N ', 146.489, 137.11, 97.289], ['A', ' CA ', 147.814, 136.989, 97.893], ['A', ' C ', 147.793, 137.534, 99.332], ['A', ' O ', 146.978, 138.407, 99.63], ['A', ' CB ', 148.819, 137.716, 97.046], ['A', ' H ', 145.82, 137.759, 97.684], ['A', ' HA ', 148.079, 135.929, 97.936], ['A', ' HB ', 149.782, 137.573, 97.487], ['A', ' HB ', 148.804, 137.295, 96.051], ['A', ' HB ', 148.573, 138.776, 97.001]] AA_SCO= 1.991578947368421 CA_SCO= 1.3624210526315788
[['A', ' N ', 148.702, 137.071, 100.202], ['A', ' CA ', 148.828, 137.622, 101.572], ['A', ' C ', 150.254, 138.107, 101.901], ['A', ' O ', 150.434, 139.025, 102.703], ['A', ' CB ', 148.486, 136.571, 102.606], ['A', ' OG ', 149.469, 135.572, 102.645], ['A', ' H ', 149.306, 136.323, 99.901], ['A', ' HA ', 148.15, 138.467, 101.669], ['A', ' HB ', 148.401, 137.033, 103.587], ['A', ' HB ', 147.52, 136.125, 102.367], ['A', ' HG ', 149.551, 135.219, 101.734]] AA_SCO= 1.999473684210526 CA_SCO= 1.3598421052631577
[['A', ' N ', 151.255, 137.537, 101.241], ['A', ' CA ', 152.662, 137.909, 101.45], ['A', ' C ', 153.385, 137.579, 100.17], ['A', ' O ', 152.767, 137.079, 99.245], ['A', ' CB ', 153.315, 137.14, 102.593], ['A', ' CG ', 154.562, 137.771, 103.143], ['A', ' ND1', 155.772, 137.801, 102.456], ['A', ' CD2', 154.786, 138.371, 104.329], ['A', ' CE1', 156.682, 138.398, 103.216], ['A', ' NE2', 156.105, 138.755, 104.35], ['A', ' H ', 151.026, 136.759, 100.625], ['A', ' HA ', 152.761, 138.976, 101.636], ['A', ' HB ', 152.605, 137.037, 103.413], ['A', ' HB ', 153.583, 136.14, 102.254], ['A', ' HD2', 154.055, 138.517, 105.125], ['A', ' HE1', 157.726, 138.567, 102.953], ['A', ' HE2', 156.557, 139.227, 105.12]] AA_SCO= 2.0068421052631575 CA_SCO= 1.3603684210526317
[['A', ' N ', 154.679, 137.836, 100.086], ['A', ' CA ', 155.408, 137.505, 98.877], ['A', ' C ', 155.925, 136.074, 98.953], ['A', ' O ', 156.002, 135.38, 97.94], ['A', ' CB ', 156.579, 138.461, 98.656], ['A', ' CG ', 157.315, 138.226, 97.333], ['A', ' CD ', 156.44, 138.506, 96.156], ['A', ' OE1', 156.001, 139.632, 95.972], ['A', ' NE2', 156.143, 137.483, 95.383], ['A', ' H ', 155.158, 138.2, 100.894], ['A', ' HA ', 154.73, 137.585, 98.033], ['A', ' HB ', 156.214, 139.486, 98.665], ['A', ' HB ', 157.293, 138.353, 99.472], ['A', ' HG ', 158.166, 138.898, 97.288], ['A', ' HG ', 157.652, 137.196, 97.263], ['A', ' HE2', 155.482, 137.617, 94.607], ['A', ' HE2', 156.5, 136.566, 95.603]] AA_SCO= 2.012105263157894 CA_SCO= 1.3752105263157894
[['A', ' N ', 156.424, 135.697, 100.129], ['A', ' CA ', 156.97, 134.356, 100.383], ['A', ' C ', 156.453, 133.977, 101.748], ['A', ' O ', 156.609, 134.796, 102.631], ['A', ' CB ', 158.53, 134.351, 100.449], ['A', ' CG1', 159.183, 134.887, 99.127], ['A', ' CG2', 159.075, 132.922, 100.794], ['A', ' CD1', 159.039, 134.016, 97.89], ['A', ' H ', 156.326, 136.357, 100.918], ['A', ' HA ', 156.598, 133.651, 99.645], ['A', ' HB ', 158.842, 135.031, 101.242], ['A', ' HG1', 158.751, 135.85, 98.911], ['A', ' HG1', 160.249, 135.028, 99.309], ['A', ' HG2', 160.16, 132.966, 100.866], ['A', ' HG2', 158.675, 132.588, 101.748], ['A', ' HG2', 158.793, 132.207, 100.027], ['A', ' HD1', 159.528, 134.503, 97.046], ['A', ' HD1', 159.5, 133.048, 98.048], ['A', ' HD1', 157.989, 133.873, 97.648]] AA_SCO= 2.1042105263157893 CA_SCO= 1.4321578947368423
[['A', ' N ', 155.927, 132.769, 101.983], ['A', ' CA ', 155.525, 132.451, 103.374], ['A', ' C ', 154.424, 133.393, 103.862], ['A', ' O ', 154.668, 134.446, 104.451], ['A', ' CB ', 156.726, 132.433, 104.334], ['A', ' CG ', 156.377, 132.088, 105.763], ['A', ' CD1', 156.048, 130.806, 106.112], ['A', ' CD2', 156.422, 133.056, 106.724], ['A', ' CE1', 155.761, 130.483, 107.391], ['A', ' CE2', 156.133, 132.737, 108.025], ['A', ' CZ ', 155.806, 131.446, 108.356], ['A', ' OH ', 155.513, 131.114, 109.652], ['A', ' H ', 155.794, 132.086, 101.217], ['A', ' HA ', 155.105, 131.447, 103.38], ['A', ' HB ', 157.454, 131.702, 103.984], ['A', ' HB ', 157.233, 133.385, 104.358], ['A', ' HD1', 156.006, 130.049, 105.385], ['A', ' HD2', 156.688, 134.08, 106.453], ['A', ' HE1', 155.495, 129.456, 107.646], ['A', ' HE2', 156.168, 133.508, 108.795], ['A', ' HH ', 155.474, 131.91, 110.187]] AA_SCO= 1.9726315789473678 CA_SCO= 1.618526315789474
[['A', ' N ', 153.199, 132.96, 103.674], ['A', ' CA ', 152.037, 133.78, 103.952], ['A', ' C ', 151.704, 133.98, 105.391], ['A', ' O ', 152.417, 133.556, 106.301], ['A', ' H ', 153.069, 132.058, 103.253], ['A', ' HA ', 152.153, 134.746, 103.477], ['A', ' HA ', 151.169, 133.318, 103.481]] AA_SCO= 2.0626315789473684 CA_SCO= 1.624
[['A', ' N ', 150.603, 134.68, 105.585], ['A', ' CA ', 150.17, 135.045, 106.911], ['A', ' C ', 148.676, 134.858, 107.086], ['A', ' O ', 147.958, 134.535, 106.14], ['A', ' CB ', 150.516, 136.528, 107.115], ['A', ' CG ', 150.651, 136.983, 108.551], ['A', ' OD1', 150.413, 136.18, 109.43], ['A', ' OD2', 150.941, 138.154, 108.765], ['A', ' H ', 150.065, 134.979, 104.769], ['A', ' HA ', 150.693, 134.424, 107.64], ['A', ' HB ', 151.446, 136.751, 106.59], ['A', ' HB ', 149.73, 137.126, 106.652]] AA_SCO= 2.163684210526316 CA_SCO= 1.6680526315789472
[['A', ' N ', 148.216, 135.152, 108.281], ['A', ' CA ', 146.807, 135.157, 108.611], ['A', ' C ', 146.434, 136.61, 108.515], ['A', ' O ', 147.333, 137.446, 108.438], ['A', ' CB ', 146.539, 134.572, 109.979], ['A', ' CG ', 147.136, 135.334, 111.119], ['A', ' CD ', 146.862, 134.669, 112.389], ['A', ' NE ', 147.44, 135.397, 113.499], ['A', ' CZ ', 147.304, 135.052, 114.795], ['A', ' NH1', 146.592, 133.999, 115.117], ['A', ' NH2', 147.89, 135.78, 115.736], ['A', ' H ', 148.913, 135.401, 108.988], ['A', ' HA ', 146.244, 134.597, 107.865], ['A', ' HB ', 145.466, 134.508, 110.146], ['A', ' HB ', 146.932, 133.553, 110.02], ['A', ' HG ', 148.217, 135.396, 110.991], ['A', ' HG ', 146.722, 136.338, 111.162], ['A', ' HD ', 145.784, 134.603, 112.537], ['A', ' HD ', 147.293, 133.664, 112.37], ['A', ' HE ', 147.999, 136.216, 113.281], ['A', ' HH1', 146.129, 133.447, 114.399], ['A', ' HH1', 146.469, 133.719, 116.086], ['A', ' HH2', 148.438, 136.591, 115.482], ['A', ' HH2', 147.788, 135.523, 116.707]] AA_SCO= 2.098421052631579 CA_SCO= 1.6944736842105264
[['A', ' N ', 145.148, 136.939, 108.503], ['A', ' CA ', 144.79, 138.334, 108.284], ['A', ' C ', 145.279, 138.577, 106.871], ['A', ' O ', 145.823, 137.652, 106.267], ['A', ' CB ', 145.301, 139.353, 109.352], ['A', ' OG1', 146.711, 139.348, 109.467], ['A', ' CG2', 144.713, 139.038, 110.7], ['A', ' H ', 144.432, 136.233, 108.588], ['A', ' HA ', 143.704, 138.428, 108.268], ['A', ' HB ', 144.985, 140.35, 109.056], ['A', ' HG1', 147.107, 139.097, 108.626], ['A', ' HG2', 145.06, 139.772, 111.427], ['A', ' HG2', 143.629, 139.071, 110.64], ['A', ' HG2', 145.029, 138.047, 111.009]] AA_SCO= 1.9647368421052627 CA_SCO= 1.6933157894736839
[['A', ' N ', 144.966, 139.721, 106.267], ['A', ' CA ', 145.168, 139.922, 104.818], ['A', ' C ', 144.109, 139.041, 104.146], ['A', ' O ', 143.103, 139.534, 103.628], ['A', ' CB ', 146.575, 139.565, 104.283], ['A', ' CG ', 147.727, 140.509, 104.642], ['A', ' CD ', 148.331, 140.184, 106.033], ['A', ' CE ', 149.682, 140.903, 106.239], ['A', ' NZ ', 150.264, 140.705, 107.644], ['A', ' H ', 144.546, 140.459, 106.811], ['A', ' HA ', 144.954, 140.962, 104.561], ['A', ' HB ', 146.885, 138.579, 104.523], ['A', ' HB ', 146.52, 139.588, 103.196], ['A', ' HG ', 148.51, 140.414, 103.883], ['A', ' HG ', 147.366, 141.535, 104.641], ['A', ' HD ', 147.648, 140.506, 106.816], ['A', ' HD ', 148.473, 139.105, 106.13], ['A', ' HE ', 150.395, 140.522, 105.505], ['A', ' HE ', 149.535, 141.967, 106.068], ['A', ' HZ ', 151.135, 141.201, 107.719], ['A', ' HZ ', 149.618, 141.064, 108.331], ['A', ' HZ ', 150.446, 139.702, 107.871]] AA_SCO= 1.9110526315789471 CA_SCO= 1.6559473684210524
[['A', ' N ', 144.286, 137.723, 104.214], ['A', ' CA ', 143.254, 136.835, 103.743], ['A', ' C ', 142.172, 136.85, 104.776], ['A', ' O ', 142.125, 136.072, 105.738], ['A', ' CB ', 143.733, 135.417, 103.547], ['A', ' CG ', 142.652, 134.554, 102.994], ['A', ' CD1', 142.186, 134.761, 101.739], ['A', ' CD2', 142.108, 133.541, 103.719], ['A', ' CE1', 141.207, 133.981, 101.2], ['A', ' CE2', 141.124, 132.768, 103.178], ['A', ' CZ ', 140.674, 132.983, 101.929], ['A', ' H ', 145.127, 137.369, 104.657], ['A', ' HA ', 142.847, 137.219, 102.809], ['A', ' HB ', 144.577, 135.405, 102.863], ['A', ' HB ', 144.067, 135.002, 104.497], ['A', ' HD1', 142.601, 135.571, 101.167], ['A', ' HD2', 142.464, 133.353, 104.735], ['A', ' HE1', 140.858, 134.171, 100.184], ['A', ' HE2', 140.705, 131.973, 103.742], ['A', ' HZ ', 139.887, 132.353, 101.519]] AA_SCO= 1.72 CA_SCO= 1.668684210526316
[['A', ' N ', 141.275, 137.769, 104.568], ['A', ' CA ', 140.243, 137.977, 105.522], ['A', ' C ', 139.148, 136.988, 105.216], ['A', ' O ', 138.247, 137.252, 104.409], ['A', ' CB ', 139.735, 139.406, 105.426], ['A', ' CG ', 138.767, 139.769, 106.49], ['A', ' OD1', 138.55, 138.961, 107.364], ['A', ' OD2', 138.235, 140.853, 106.432], ['A', ' H ', 141.405, 138.395, 103.769], ['A', ' HA ', 140.628, 137.791, 106.525], ['A', ' HB ', 140.583, 140.092, 105.468], ['A', ' HB ', 139.27, 139.542, 104.479]] AA_SCO= 1.7042105263157896 CA_SCO= 1.6658947368421053
[['A', ' N ', 139.18, 135.865, 105.918], ['A', ' CA ', 138.274, 134.74, 105.702], ['A', ' C ', 136.941, 134.986, 106.392], ['A', ' O ', 136.521, 134.29, 107.313], ['A', ' CB ', 138.996, 133.465, 106.203], ['A', ' CG ', 138.333, 132.041, 106.078], ['A', ' CD1', 137.794, 131.815, 104.755], ['A', ' CD2', 139.413, 130.99, 106.312], ['A', ' H ', 139.976, 135.768, 106.55], ['A', ' HA ', 138.104, 134.651, 104.631], ['A', ' HB ', 139.968, 133.425, 105.736], ['A', ' HB ', 139.157, 133.617, 107.26], ['A', ' HG ', 137.535, 131.934, 106.816], ['A', ' HD1', 137.357, 130.817, 104.703], ['A', ' HD1', 137.05, 132.535, 104.641], ['A', ' HD1', 138.537, 131.914, 103.991], ['A', ' HD2', 138.975, 129.996, 106.232], ['A', ' HD2', 140.196, 131.081, 105.593], ['A', ' HD2', 139.828, 131.119, 107.276]] AA_SCO= 1.7173684210526317 CA_SCO= 1.683
[['A', ' N ', 136.286, 136.01, 105.847], ['A', ' CA ', 135.008, 136.584, 106.209], ['A', ' C ', 134.414, 136.963, 104.867], ['A', ' O ', 133.203, 136.999, 104.66], ['A', ' CB ', 135.185, 137.816, 107.101], ['A', ' CG ', 133.888, 138.284, 107.799], ['A', ' OD1', 133.342, 137.514, 108.556], ['A', ' OD2', 133.466, 139.399, 107.577], ['A', ' H ', 136.775, 136.476, 105.09], ['A', ' HA ', 134.38, 135.841, 106.698], ['A', ' HB ', 135.938, 137.603, 107.864], ['A', ' HB ', 135.578, 138.644, 106.502]] AA_SCO= 1.644736842105263 CA_SCO= 1.6515789473684213
[['A', ' N ', 135.331, 137.22, 103.93], ['A', ' CA ', 135.036, 137.645, 102.566], ['A', ' C ', 134.988, 136.456, 101.636], ['A', ' O ', 134.903, 136.595, 100.423], ['A', ' CB ', 136.089, 138.612, 102.068], ['A', ' CG ', 136.084, 139.967, 102.697], ['A', ' CD ', 137.32, 140.734, 102.37], ['A', ' NE ', 137.521, 140.984, 100.944], ['A', ' CZ ', 138.645, 141.549, 100.429], ['A', ' NH1', 139.626, 141.939, 101.229], ['A', ' NH2', 138.77, 141.704, 99.125], ['A', ' H ', 136.32, 137.152, 104.192], ['A', ' HA ', 134.066, 138.142, 102.554], ['A', ' HB ', 137.057, 138.192, 102.265], ['A', ' HB ', 136.001, 138.734, 100.991], ['A', ' HG ', 135.227, 140.528, 102.334], ['A', ' HG ', 136.025, 139.863, 103.783], ['A', ' HD ', 137.288, 141.691, 102.887], ['A', ' HD ', 138.162, 140.169, 102.716], ['A', ' HE ', 136.778, 140.688, 100.272], ['A', ' HH1', 139.549, 141.818, 102.229], ['A', ' HH1', 140.462, 142.352, 100.84], ['A', ' HH2', 138.022, 141.365, 98.502], ['A', ' HH2', 139.597, 142.113, 98.734]] AA_SCO= 1.7299999999999998 CA_SCO= 1.499105263157895
[['A', ' N ', 135.091, 135.28, 102.201], ['A', ' CA ', 135.131, 134.06, 101.435], ['A', ' C ', 133.874, 133.199, 101.446], ['A', ' O ', 133.295, 132.939, 102.502], ['A', ' CB ', 136.229, 133.229, 101.988], ['A', ' CG ', 136.244, 131.967, 101.427], ['A', ' CD1', 136.718, 131.795, 100.2], ['A', ' CD2', 135.729, 130.905, 102.12], ['A', ' CE1', 136.693, 130.602, 99.646], ['A', ' CE2', 135.697, 129.693, 101.568], ['A', ' CZ ', 136.176, 129.535, 100.322], ['A', ' H ', 135.132, 135.232, 103.209], ['A', ' HA ', 135.347, 134.317, 100.399], ['A', ' HB ', 137.197, 133.697, 101.868], ['A', ' HB ', 136.017, 133.14, 103.005], ['A', ' HD1', 137.109, 132.637, 99.652], ['A', ' HD2', 135.327, 131.056, 103.125], ['A', ' HE1', 137.078, 130.489, 98.663], ['A', ' HE2', 135.283, 128.842, 102.108], ['A', ' HZ ', 136.143, 128.547, 99.871]] AA_SCO= 1.7352631578947368 CA_SCO= 1.5138947368421056
[['A', ' N ', 133.51, 132.691, 100.263], ['A', ' CA ', 132.404, 131.759, 100.092], ['A', ' C ', 132.853, 130.395, 99.545], ['A', ' O ', 133.663, 130.306, 98.623], ['A', ' CB ', 131.338, 132.359, 99.157], ['A', ' OG1', 130.832, 133.561, 99.731], ['A', ' CG2', 130.191, 131.394, 98.956], ['A', ' H ', 133.999, 132.993, 99.418], ['A', ' HA ', 131.948, 131.592, 101.067], ['A', ' HB ', 131.792, 132.591, 98.191], ['A', ' HG1', 131.534, 134.218, 99.73], ['A', ' HG2', 129.456, 131.854, 98.301], ['A', ' HG2', 130.541, 130.478, 98.503], ['A', ' HG2', 129.729, 131.169, 99.914]] AA_SCO= 1.8242105263157893 CA_SCO= 1.4373157894736845
[['A', ' N ', 132.341, 129.317, 100.133], ['A', ' CA ', 132.643, 127.97, 99.642], ['A', ' C ', 131.541, 127.468, 98.71], ['A', ' O ', 130.387, 127.339, 99.126], ['A', ' CB ', 132.786, 126.995, 100.809], ['A', ' CG ', 133.098, 125.542, 100.419], ['A', ' CD ', 134.486, 125.335, 99.905], ['A', ' OE1', 135.321, 126.133, 100.21], ['A', ' OE2', 134.714, 124.359, 99.229], ['A', ' H ', 131.705, 129.436, 100.91], ['A', ' HA ', 133.58, 127.997, 99.083], ['A', ' HB ', 133.576, 127.335, 101.471], ['A', ' HB ', 131.862, 126.989, 101.384], ['A', ' HG ', 132.956, 124.912, 101.296], ['A', ' HG ', 132.39, 125.214, 99.664]] AA_SCO= 1.784736842105263 CA_SCO= 1.4392105263157895
[['A', ' N ', 131.881, 127.178, 97.461], ['A', ' CA ', 130.907, 126.718, 96.488], ['A', ' C ', 131.05, 125.281, 96.022], ['A', ' O ', 132.118, 124.799, 95.643], ['A', ' CB ', 130.9, 127.664, 95.279], ['A', ' CG1', 130.501, 129.071, 95.697], ['A', ' CG2', 130.075, 127.16, 94.141], ['A', ' CD1', 129.116, 129.245, 96.307], ['A', ' H ', 132.842, 127.316, 97.135], ['A', ' HA ', 129.931, 126.763, 96.954], ['A', ' HB ', 131.915, 127.764, 94.923], ['A', ' HG1', 131.247, 129.454, 96.395], ['A', ' HG1', 130.518, 129.664, 94.822], ['A', ' HG2', 130.148, 127.867, 93.346], ['A', ' HG2', 130.446, 126.204, 93.791], ['A', ' HG2', 129.038, 127.052, 94.437], ['A', ' HD1', 128.96, 130.299, 96.514], ['A', ' HD1', 128.352, 128.912, 95.612], ['A', ' HD1', 129.02, 128.696, 97.236]] AA_SCO= 1.9110526315789471 CA_SCO= 1.4171578947368422
[['A', ' N ', 129.933, 124.583, 96.03], ['A', ' CA ', 129.909, 123.224, 95.542], ['A', ' C ', 129.923, 123.354, 94.037], ['A', ' O ', 129.107, 124.116, 93.505], ['A', ' CB ', 128.693, 122.501, 96.073], ['A', ' CG ', 128.691, 122.383, 97.565], ['A', ' SD ', 130.065, 121.386, 98.169], ['A', ' CE ', 131.235, 122.608, 98.801], ['A', ' H ', 129.091, 125.027, 96.377], ['A', ' HA ', 130.807, 122.721, 95.874], ['A', ' HB ', 127.792, 123.037, 95.775], ['A', ' HB ', 128.622, 121.498, 95.655], ['A', ' HG ', 128.753, 123.371, 98.02], ['A', ' HG ', 127.76, 121.915, 97.887], ['A', ' HE ', 132.101, 122.103, 99.217], ['A', ' HE ', 131.563, 123.271, 98.015], ['A', ' HE ', 130.758, 123.194, 99.586]] AA_SCO= 1.923157894736842 CA_SCO= 1.418
[['A', ' N ', 130.721, 122.539, 93.331], ['A', ' CA ', 130.993, 122.629, 91.917], ['A', ' C ', 129.776, 122.531, 91.055], ['A', ' O ', 129.745, 123.103, 89.978], ['A', ' CB ', 131.897, 121.426, 91.664], ['A', ' CG ', 131.585, 120.465, 92.768], ['A', ' CD ', 131.261, 121.321, 93.961], ['A', ' HA ', 131.53, 123.563, 91.719], ['A', ' HB ', 131.68, 120.993, 90.679], ['A', ' HB ', 132.956, 121.743, 91.655], ['A', ' HG ', 130.744, 119.805, 92.476], ['A', ' HG ', 132.454, 119.805, 92.935], ['A', ' HD ', 130.501, 120.794, 94.553], ['A', ' HD ', 132.155, 121.522, 94.531]] AA_SCO= 1.865789473684211 CA_SCO= 1.4043157894736842
[['A', ' N ', 128.708, 121.923, 91.53], ['A', ' CA ', 127.554, 121.826, 90.678], ['A', ' C ', 127.042, 123.194, 90.249], ['A', ' O ', 126.563, 123.346, 89.127], ['A', ' CB ', 126.453, 121.043, 91.38], ['A', ' CG ', 126.793, 119.571, 91.623], ['A', ' CD ', 127.618, 119.332, 92.862], ['A', ' OE1', 127.975, 120.29, 93.514], ['A', ' OE2', 127.9, 118.195, 93.157], ['A', ' H ', 128.676, 121.445, 92.436], ['A', ' HA ', 127.858, 121.294, 89.789], ['A', ' HB ', 126.235, 121.507, 92.344], ['A', ' HB ', 125.543, 121.083, 90.784], ['A', ' HG ', 125.87, 118.999, 91.695], ['A', ' HG ', 127.347, 119.198, 90.767]] AA_SCO= 1.8621052631578945 CA_SCO= 1.3943684210526315
[['A', ' N ', 127.218, 124.209, 91.094], ['A', ' CA ', 126.725, 125.544, 90.809], ['A', ' C ', 127.474, 126.244, 89.678], ['A', ' O ', 127.027, 127.278, 89.188], ['A', ' CB ', 126.814, 126.398, 92.054], ['A', ' OG ', 125.94, 125.95, 93.058], ['A', ' H ', 127.671, 124.052, 92.001], ['A', ' HA ', 125.678, 125.463, 90.519], ['A', ' HB ', 127.833, 126.367, 92.423], ['A', ' HB ', 126.59, 127.433, 91.804], ['A', ' HG ', 126.09, 126.525, 93.814]] AA_SCO= 1.574736842105263 CA_SCO= 1.3976842105263156
[['A', ' N ', 128.646, 125.735, 89.311], ['A', ' CA ', 129.449, 126.328, 88.255], ['A', ' C ', 129.372, 125.681, 86.904], ['A', ' O ', 130.029, 126.155, 85.959], ['A', ' CB ', 130.882, 126.405, 88.667], ['A', ' CG ', 131.091, 127.567, 89.44], ['A', ' CD1', 130.499, 127.909, 90.588], ['A', ' CD2', 131.953, 128.636, 89.099], ['A', ' NE1', 130.927, 129.125, 90.982], ['A', ' CE2', 131.812, 129.588, 90.08], ['A', ' CE3', 132.813, 128.867, 88.04], ['A', ' CZ2', 132.487, 130.758, 90.045], ['A', ' CZ3', 133.498, 130.049, 88.008], ['A', ' CH2', 133.332, 130.971, 88.987], ['A', ' H ', 128.97, 124.863, 89.734], ['A', ' HA ', 129.105, 127.355, 88.135], ['A', ' HB ', 131.119, 125.522, 89.257], ['A', ' HB ', 131.527, 126.406, 87.8], ['A', ' HD1', 129.774, 127.312, 91.119], ['A', ' HE1', 130.625, 129.615, 91.811], ['A', ' HE3', 132.943, 128.134, 87.248], ['A', ' HZ2', 132.364, 131.513, 90.81], ['A', ' HZ3', 134.178, 130.235, 87.171], ['A', ' HH2', 133.875, 131.897, 88.927]] AA_SCO= 1.7405263157894737 CA_SCO= 1.4164210526315786
[['A', ' N ', 128.608, 124.615, 86.763], ['A', ' CA ', 128.593, 124.011, 85.461], ['A', ' C ', 127.158, 123.876, 85.028], ['A', ' O ', 126.296, 123.471, 85.798], ['A', ' CB ', 129.316, 122.672, 85.498], ['A', ' CG ', 130.744, 122.788, 86.024], ['A', ' CD1', 130.986, 122.49, 87.328], ['A', ' CD2', 131.777, 123.217, 85.234], ['A', ' CE1', 132.249, 122.609, 87.86], ['A', ' CE2', 133.06, 123.336, 85.767], ['A', ' CZ ', 133.285, 123.037, 87.069], ['A', ' OH ', 134.55, 123.156, 87.599], ['A', ' H ', 128.041, 124.238, 87.536], ['A', ' HA ', 129.087, 124.66, 84.739], ['A', ' HB ', 128.778, 121.992, 86.134], ['A', ' HB ', 129.341, 122.242, 84.499], ['A', ' HD1', 130.167, 122.153, 87.94], ['A', ' HD2', 131.589, 123.46, 84.198], ['A', ' HE1', 132.422, 122.368, 88.902], ['A', ' HE2', 133.888, 123.671, 85.15], ['A', ' HH ', 135.172, 123.44, 86.907]] AA_SCO= 1.7173684210526317 CA_SCO= 1.4245263157894734
[['A', ' N ', 126.892, 124.249, 83.791], ['A', ' CA ', 125.557, 124.139, 83.249], ['A', ' C ', 125.266, 122.73, 82.795], ['A', ' O ', 124.146, 122.237, 82.907], ['A', ' CB ', 125.448, 125.143, 82.119], ['A', ' CG ', 126.61, 124.977, 81.143], ['A', ' OD1', 127.552, 124.239, 81.47], ['A', ' OD2', 126.602, 125.618, 80.113], ['A', ' H ', 127.639, 124.575, 83.178], ['A', ' HA ', 124.841, 124.405, 84.028], ['A', ' HB ', 124.507, 124.993, 81.588], ['A', ' HB ', 125.449, 126.155, 82.521]] AA_SCO= 1.5231578947368423 CA_SCO= 1.4199473684210522
[['A', ' N ', 126.317, 122.086, 82.336], ['A', ' CA ', 126.309, 120.728, 81.834], ['A', ' C ', 126.465, 119.743, 82.997], ['A', ' O ', 127.534, 119.75, 83.624], ['A', ' CB ', 127.461, 120.509, 80.843], ['A', ' CG ', 127.395, 119.128, 80.196], ['A', ' OD1', 126.533, 118.366, 80.629], ['A', ' OD2', 128.173, 118.824, 79.299], ['A', ' H ', 127.154, 122.661, 82.249], ['A', ' HA ', 125.39, 120.574, 81.286], ['A', ' HB ', 127.42, 121.278, 80.066], ['A', ' HB ', 128.418, 120.619, 81.36]] AA_SCO= 1.5115789473684211 CA_SCO= 1.4236315789473681
[['A', ' N ', 125.453, 118.896, 83.319], ['A', ' CA ', 125.454, 117.911, 84.389], ['A', ' C ', 126.623, 116.944, 84.239], ['A', ' O ', 127.093, 116.368, 85.216], ['A', ' CB ', 124.13, 117.18, 84.191], ['A', ' CG ', 123.253, 118.169, 83.497], ['A', ' CD ', 124.173, 118.934, 82.583], ['A', ' HA ', 125.467, 118.427, 85.35], ['A', ' HB ', 124.293, 116.266, 83.596], ['A', ' HB ', 123.729, 116.862, 85.162], ['A', ' HG ', 122.454, 117.652, 82.948], ['A', ' HG ', 122.763, 118.821, 84.234], ['A', ' HD ', 124.269, 118.439, 81.602], ['A', ' HD ', 123.768, 119.937, 82.507]] AA_SCO= 1.6289473684210527 CA_SCO= 1.4037894736842103
[['A', ' N ', 127.142, 116.812, 83.013], ['A', ' CA ', 128.266, 115.929, 82.774], ['A', ' C ', 129.455, 116.407, 83.561], ['A', ' O ', 130.263, 115.607, 84.017], ['A', ' CB ', 128.645, 115.9, 81.297], ['A', ' CG ', 129.84, 115.011, 80.932], ['A', ' CD ', 129.636, 113.56, 81.181], ['A', ' OE1', 128.509, 113.138, 81.307], ['A', ' OE2', 130.621, 112.857, 81.23], ['A', ' H ', 126.754, 117.319, 82.203], ['A', ' HA ', 128.003, 114.922, 83.103], ['A', ' HB ', 127.783, 115.596, 80.702], ['A', ' HB ', 128.91, 116.904, 80.986], ['A', ' HG ', 130.045, 115.148, 79.872], ['A', ' HG ', 130.719, 115.348, 81.477]] AA_SCO= 1.6542105263157894 CA_SCO= 1.4457894736842103
[['A', ' N ', 129.604, 117.71, 83.71], ['A', ' CA ', 130.736, 118.184, 84.44], ['A', ' C ', 130.332, 118.334, 85.875], ['A', ' O ', 131.038, 117.9, 86.787], ['A', ' CB ', 131.258, 119.508, 83.928], ['A', ' CG1', 131.732, 119.335, 82.486], ['A', ' CG2', 132.384, 119.906, 84.85], ['A', ' CD1', 132.09, 120.635, 81.782], ['A', ' H ', 128.914, 118.373, 83.353], ['A', ' HA ', 131.54, 117.452, 84.377], ['A', ' HB ', 130.48, 120.259, 83.923], ['A', ' HG1', 132.566, 118.668, 82.471], ['A', ' HG1', 130.926, 118.869, 81.917], ['A', ' HG2', 132.836, 120.813, 84.522], ['A', ' HG2', 132.04, 120.042, 85.865], ['A', ' HG2', 133.105, 119.123, 84.84], ['A', ' HD1', 132.389, 120.414, 80.76], ['A', ' HD1', 131.222, 121.297, 81.768], ['A', ' HD1', 132.911, 121.129, 82.29]] AA_SCO= 1.9515789473684209 CA_SCO= 1.4617368421052632
[['A', ' N ', 129.151, 118.882, 86.102], ['A', ' CA ', 128.743, 119.142, 87.466], ['A', ' C ', 128.817, 117.893, 88.329], ['A', ' O ', 129.263, 117.962, 89.468], ['A', ' CB ', 127.314, 119.639, 87.471], ['A', ' H ', 128.574, 119.191, 85.315], ['A', ' HA ', 129.409, 119.894, 87.885], ['A', ' HB ', 126.988, 119.838, 88.466], ['A', ' HB ', 127.217, 120.541, 86.873], ['A', ' HB ', 126.695, 118.872, 87.064]] AA_SCO= 1.8610526315789473 CA_SCO= 1.4679473684210524
[['A', ' N ', 128.464, 116.737, 87.774], ['A', ' CA ', 128.462, 115.499, 88.526], ['A', ' C ', 129.755, 114.699, 88.451], ['A', ' O ', 129.824, 113.612, 89.026], ['A', ' CB ', 127.303, 114.625, 88.069], ['A', ' CG ', 125.942, 115.22, 88.368], ['A', ' CD ', 124.824, 114.294, 87.926], ['A', ' CE ', 123.459, 114.883, 88.255], ['A', ' NZ ', 122.345, 113.985, 87.827], ['A', ' H ', 128.113, 116.715, 86.813], ['A', ' HA ', 128.301, 115.752, 89.574], ['A', ' HB ', 127.376, 114.467, 86.991], ['A', ' HB ', 127.364, 113.652, 88.552], ['A', ' HG ', 125.857, 115.416, 89.437], ['A', ' HG ', 125.848, 116.167, 87.834], ['A', ' HD ', 124.894, 114.141, 86.847], ['A', ' HD ', 124.93, 113.331, 88.422], ['A', ' HE ', 123.391, 115.042, 89.331], ['A', ' HE ', 123.354, 115.843, 87.748], ['A', ' HZ ', 121.459, 114.411, 88.064], ['A', ' HZ ', 122.391, 113.839, 86.829], ['A', ' HZ ', 122.426, 113.097, 88.301]] AA_SCO= 1.8863157894736844 CA_SCO= 1.476
[['A', ' N ', 130.751, 115.178, 87.715], ['A', ' CA ', 132.031, 114.481, 87.6], ['A', ' C ', 133.158, 115.23, 88.263], ['A', ' O ', 134.122, 114.619, 88.714], ['A', ' CB ', 132.426, 114.211, 86.165], ['A', ' CG ', 131.597, 113.174, 85.46], ['A', ' CD ', 132.039, 112.988, 84.059], ['A', ' NE ', 133.41, 112.462, 83.962], ['A', ' CZ ', 134.152, 112.474, 82.827], ['A', ' NH1', 133.645, 112.954, 81.705], ['A', ' NH2', 135.388, 111.99, 82.812], ['A', ' H ', 130.642, 116.093, 87.284], ['A', ' HA ', 131.937, 113.518, 88.1], ['A', ' HB ', 132.344, 115.137, 85.592], ['A', ' HB ', 133.468, 113.9, 86.131], ['A', ' HG ', 131.682, 112.223, 85.98], ['A', ' HG ', 130.552, 113.492, 85.451], ['A', ' HD ', 131.366, 112.285, 83.571], ['A', ' HD ', 132.001, 113.941, 83.539], ['A', ' HE ', 133.828, 112.072, 84.795], ['A', ' HH1', 132.668, 113.279, 81.661], ['A', ' HH1', 134.2, 112.954, 80.856], ['A', ' HH2', 135.812, 111.546, 83.634], ['A', ' HH2', 135.92, 112.006, 81.951]] AA_SCO= 1.976842105263158 CA_SCO= 1.511157894736842
[['A', ' N ', 133.056, 116.547, 88.316], ['A', ' CA ', 134.121, 117.34, 88.878], ['A', ' C ', 134.356, 116.904, 90.307], ['A', ' O ', 133.418, 116.765, 91.096], ['A', ' CB ', 133.763, 118.817, 88.792], ['A', ' H ', 132.253, 117.012, 87.898], ['A', ' HA ', 135.032, 117.147, 88.32], ['A', ' HB ', 134.567, 119.417, 89.21], ['A', ' HB ', 133.605, 119.088, 87.746], ['A', ' HB ', 132.845, 118.997, 89.351]] AA_SCO= 1.8952631578947372 CA_SCO= 1.7029473684210528
[['A', ' N ', 135.627, 116.764, 90.644], ['A', ' CA ', 136.073, 116.302, 91.954], ['A', ' C ', 136.732, 117.355, 92.822], ['A', ' O ', 137.601, 117.046, 93.637], ['A', ' CB ', 137.049, 115.156, 91.772], ['A', ' SG ', 136.325, 113.705, 91.011], ['A', ' H ', 136.315, 116.902, 89.897], ['A', ' HA ', 135.203, 115.921, 92.489], ['A', ' HB ', 137.879, 115.48, 91.143], ['A', ' HB ', 137.465, 114.858, 92.733], ['A', ' HG ', 137.46, 112.981, 91.037]] AA_SCO= 1.8726315789473684 CA_SCO= 1.6988947368421055
[['A', ' N ', 136.333, 118.598, 92.663], ['A', ' CA ', 136.869, 119.652, 93.497], ['A', ' C ', 135.828, 120.69, 93.8], ['A', ' O ', 134.856, 120.839, 93.066], ['A', ' CB ', 138.016, 120.314, 92.816], ['A', ' OG ', 137.604, 120.96, 91.647], ['A', ' H ', 135.647, 118.82, 91.957], ['A', ' HA ', 137.205, 119.22, 94.441], ['A', ' HB ', 138.409, 121.023, 93.484], ['A', ' HB ', 138.794, 119.59, 92.595], ['A', ' HG ', 138.388, 121.377, 91.295]] AA_SCO= 1.8973684210526314 CA_SCO= 1.8033157894736844
[['A', ' N ', 136.019, 121.415, 94.89], ['A', ' CA ', 135.106, 122.48, 95.242], ['A', ' C ', 135.63, 123.772, 94.693], ['A', ' O ', 136.758, 123.828, 94.21], ['A', ' CB ', 134.882, 122.583, 96.751], ['A', ' OG1', 136.099, 122.925, 97.396], ['A', ' CG2', 134.367, 121.256, 97.304], ['A', ' H ', 136.82, 121.248, 95.484], ['A', ' HA ', 134.15, 122.301, 94.771], ['A', ' HB ', 134.148, 123.368, 96.951], ['A', ' HG1', 135.862, 123.408, 98.231], ['A', ' HG2', 134.214, 121.354, 98.375], ['A', ' HG2', 133.424, 121.003, 96.824], ['A', ' HG2', 135.092, 120.466, 97.118]] AA_SCO= 1.9221052631578945 CA_SCO= 1.8006842105263154
[['A', ' N ', 134.814, 124.813, 94.744], ['A', ' CA ', 135.192, 126.111, 94.245], ['A', ' C ', 135.263, 127.188, 95.306], ['A', ' O ', 134.239, 127.681, 95.77], ['A', ' CB ', 134.19, 126.518, 93.165], ['A', ' CG1', 134.293, 125.461, 92.052], ['A', ' CG2', 134.307, 128.001, 92.735], ['A', ' CD1', 133.378, 125.649, 90.938], ['A', ' H ', 133.88, 124.704, 95.145], ['A', ' HA ', 136.154, 126.016, 93.753], ['A', ' HB ', 133.194, 126.381, 93.574], ['A', ' HG1', 135.308, 125.411, 91.693], ['A', ' HG1', 134.04, 124.494, 92.477], ['A', ' HG2', 133.552, 128.232, 92.002], ['A', ' HG2', 134.16, 128.665, 93.578], ['A', ' HG2', 135.255, 128.191, 92.332], ['A', ' HD1', 133.498, 124.83, 90.224], ['A', ' HD1', 132.361, 125.659, 91.316], ['A', ' HD1', 133.596, 126.584, 90.44]] AA_SCO= 1.9136842105263154 CA_SCO= 1.8702105263157893
[['A', ' N ', 136.444, 127.529, 95.789], ['A', ' CA ', 136.636, 128.604, 96.7], ['A', ' C ', 136.212, 129.836, 95.931], ['A', ' O ', 136.578, 129.955, 94.763], ['A', ' CB ', 138.137, 128.554, 96.934], ['A', ' CG ', 138.537, 127.182, 96.601], ['A', ' CD ', 137.641, 126.789, 95.48], ['A', ' HA ', 136.029, 128.442, 97.603], ['A', ' HB ', 138.589, 129.221, 96.254], ['A', ' HB ', 138.411, 128.862, 97.941], ['A', ' HG ', 139.602, 127.159, 96.307], ['A', ' HG ', 138.443, 126.516, 97.474], ['A', ' HD ', 138.061, 127.105, 94.515], ['A', ' HD ', 137.494, 125.711, 95.548]] AA_SCO= 1.8868421052631577 CA_SCO= 1.8711578947368421
[['A', ' N ', 135.525, 130.782, 96.538], ['A', ' CA ', 135.156, 131.94, 95.767], ['A', ' C ', 135.293, 133.224, 96.614], ['A', ' O ', 134.427, 133.555, 97.439], ['A', ' CB ', 133.711, 131.673, 95.338], ['A', ' CG ', 133.107, 132.568, 94.396], ['A', ' CD1', 133.783, 132.403, 93.079], ['A', ' CD2', 131.662, 132.287, 94.262], ['A', ' H ', 135.167, 130.664, 97.487], ['A', ' HA ', 135.83, 132.019, 94.922], ['A', ' HB ', 133.668, 130.669, 94.915], ['A', ' HB ', 133.092, 131.673, 96.236], ['A', ' HG ', 133.26, 133.555, 94.734], ['A', ' HD1', 133.334, 133.086, 92.366], ['A', ' HD1', 134.815, 132.606, 93.165], ['A', ' HD1', 133.655, 131.381, 92.735], ['A', ' HD2', 131.217, 132.981, 93.543], ['A', ' HD2', 131.55, 131.285, 93.902], ['A', ' HD2', 131.169, 132.398, 95.228]] AA_SCO= 1.928421052631579 CA_SCO= 1.8733157894736845
[['A', ' N ', 136.372, 133.972, 96.41], ['A', ' CA ', 136.655, 135.105, 97.293], ['A', ' C ', 135.918, 136.339, 96.808], ['A', ' O ', 135.983, 136.691, 95.635], ['A', ' CB ', 138.158, 135.337, 97.39], ['A', ' CG ', 138.572, 136.176, 98.533], ['A', ' CD1', 138.415, 135.626, 99.78], ['A', ' CD2', 139.138, 137.407, 98.394], ['A', ' CE1', 138.798, 136.286, 100.891], ['A', ' CE2', 139.541, 138.083, 99.534], ['A', ' CZ ', 139.362, 137.507, 100.778], ['A', ' OH ', 139.753, 138.138, 101.925], ['A', ' H ', 137.011, 133.732, 95.662], ['A', ' HA ', 136.276, 134.877, 98.285], ['A', ' HB ', 138.664, 134.416, 97.481], ['A', ' HB ', 138.509, 135.811, 96.472], ['A', ' HD1', 137.981, 134.648, 99.876], ['A', ' HD2', 139.278, 137.85, 97.406], ['A', ' HE1', 138.663, 135.831, 101.876], ['A', ' HE2', 140.0, 139.064, 99.447], ['A', ' HH ', 139.424, 137.619, 102.688]] AA_SCO= 1.9731578947368418 CA_SCO= 1.6809473684210527
[['A', ' N ', 135.136, 136.947, 97.687], ['A', ' CA ', 134.286, 138.085, 97.373], ['A', ' C ', 133.209, 137.707, 96.378], ['A', ' O ', 132.613, 138.573, 95.74], ['A', ' CB ', 135.064, 139.287, 96.817], ['A', ' CG ', 135.962, 139.96, 97.821], ['A', ' OD1', 135.577, 140.081, 98.969], ['A', ' OD2', 137.023, 140.4, 97.429], ['A', ' H ', 135.121, 136.625, 98.651], ['A', ' HA ', 133.797, 138.4, 98.296], ['A', ' HB ', 135.659, 139.001, 95.959], ['A', ' HB ', 134.35, 140.029, 96.463]] AA_SCO= 2.2931578947368414 CA_SCO= 1.6808947368421054
[['A', ' N ', 132.942, 136.416, 96.226], ['A', ' CA ', 131.901, 135.997, 95.313], ['A', ' C ', 132.389, 135.89, 93.873], ['A', ' O ', 131.593, 135.634, 92.967], ['A', ' H ', 133.457, 135.707, 96.758], ['A', ' HA ', 131.509, 135.035, 95.639], ['A', ' HA ', 131.075, 136.704, 95.362]] AA_SCO= 2.28578947368421 CA_SCO= 1.6787894736842108
[['A', ' N ', 133.683, 136.074, 93.641], ['A', ' CA ', 134.205, 136.003, 92.294], ['A', ' C ', 135.399, 135.077, 92.276], ['A', ' O ', 136.129, 134.974, 93.254], ['A', ' CB ', 134.572, 137.393, 91.827], ['A', ' CG ', 133.379, 138.335, 91.796], ['A', ' CD ', 133.701, 139.711, 91.381], ['A', ' NE ', 134.13, 139.795, 90.011], ['A', ' CZ ', 133.355, 139.828, 88.926], ['A', ' NH1', 132.041, 139.74, 89.0], ['A', ' NH2', 133.967, 139.95, 87.774], ['A', ' H ', 134.324, 136.299, 94.409], ['A', ' HA ', 133.443, 135.595, 91.63], ['A', ' HB ', 135.335, 137.815, 92.484], ['A', ' HB ', 134.984, 137.334, 90.825], ['A', ' HG ', 132.621, 137.925, 91.135], ['A', ' HG ', 132.967, 138.416, 92.801], ['A', ' HD ', 132.828, 140.349, 91.513], ['A', ' HD ', 134.51, 140.086, 92.009], ['A', ' HE ', 135.118, 139.904, 89.826], ['A', ' HH1', 131.588, 139.644, 89.896], ['A', ' HH1', 131.485, 139.768, 88.157], ['A', ' HH2', 134.993, 140.025, 87.797], ['A', ' HH2', 133.453, 139.983, 86.909]] AA_SCO= 2.3089473684210526 CA_SCO= 1.682526315789474
[['A', ' N ', 135.607, 134.367, 91.189], ['A', ' CA ', 136.776, 133.526, 91.134], ['A', ' C ', 137.973, 134.419, 91.043], ['A', ' O ', 137.904, 135.441, 90.372], ['A', ' CB ', 136.666, 132.602, 89.973], ['A', ' CG ', 136.38, 133.371, 88.776], ['A', ' OD1', 135.272, 133.933, 88.674], ['A', ' ND2', 137.305, 133.457, 87.879], ['A', ' H ', 134.989, 134.439, 90.383], ['A', ' HA ', 136.864, 132.948, 92.057], ['A', ' HB ', 137.6, 132.063, 89.841], ['A', ' HB ', 135.883, 131.876, 90.149], ['A', ' HD2', 137.148, 133.987, 87.051], ['A', ' HD2', 138.195, 133.009, 88.029]] AA_SCO= 2.501578947368421 CA_SCO= 1.6892105263157897
[['A', ' N ', 139.054, 134.075, 91.721], ['A', ' CA ', 140.244, 134.901, 91.603], ['A', ' C ', 141.473, 134.104, 91.307], ['A', ' O ', 141.643, 133.021, 91.857], ['A', ' CB ', 140.487, 135.707, 92.896], ['A', ' CG1', 139.347, 136.681, 93.124], ['A', ' CG2', 140.624, 134.764, 94.115], ['A', ' H ', 139.049, 133.223, 92.264], ['A', ' HA ', 140.094, 135.604, 90.786], ['A', ' HB ', 141.398, 136.288, 92.78], ['A', ' HG1', 139.543, 137.267, 94.019], ['A', ' HG1', 139.273, 137.343, 92.272], ['A', ' HG1', 138.409, 136.148, 93.247], ['A', ' HG2', 140.786, 135.365, 95.001], ['A', ' HG2', 139.709, 134.191, 94.24], ['A', ' HG2', 141.462, 134.081, 93.994]] AA_SCO= 2.594736842105263 CA_SCO= 1.6895263157894735
[['A', ' N ', 142.387, 134.684, 90.548], ['A', ' CA ', 143.648, 133.985, 90.347], ['A', ' C ', 144.475, 134.047, 91.591], ['A', ' O ', 144.518, 135.089, 92.253], ['A', ' CB ', 144.523, 134.597, 89.271], ['A', ' CG ', 144.068, 134.484, 87.892], ['A', ' CD ', 145.082, 135.078, 86.968], ['A', ' OE1', 145.947, 135.763, 87.464], ['A', ' OE2', 145.033, 134.833, 85.79], ['A', ' H ', 142.158, 135.58, 90.098], ['A', ' HA ', 143.437, 132.944, 90.108], ['A', ' HB ', 144.639, 135.659, 89.486], ['A', ' HB ', 145.517, 134.147, 89.331], ['A', ' HG ', 143.899, 133.444, 87.643], ['A', ' HG ', 143.13, 135.014, 87.814]] AA_SCO= 2.588947368421053 CA_SCO= 1.7093157894736841
[['A', ' N ', 145.165, 132.969, 91.866], ['A', ' CA ', 146.109, 132.925, 92.959], ['A', ' C ', 147.369, 132.325, 92.339], ['A', ' O ', 147.263, 131.535, 91.406], ['A', ' CB ', 145.548, 132.082, 94.101], ['A', ' CG1', 145.487, 130.669, 93.716], ['A', ' CG2', 146.321, 132.283, 95.296], ['A', ' H ', 145.019, 132.148, 91.27], ['A', ' HA ', 146.32, 133.934, 93.32], ['A', ' HB ', 144.519, 132.39, 94.295], ['A', ' HG1', 145.074, 130.16, 94.54], ['A', ' HG1', 144.858, 130.548, 92.845], ['A', ' HG1', 146.471, 130.264, 93.503], ['A', ' HG2', 145.895, 131.684, 96.105], ['A', ' HG2', 147.302, 132.0, 95.109], ['A', ' HG2', 146.295, 133.315, 95.568]] AA_SCO= 2.6373684210526314 CA_SCO= 1.7091052631578947
[['A', ' N ', 148.559, 132.665, 92.797], ['A', ' CA ', 149.707, 132.067, 92.143], ['A', ' C ', 150.839, 133.054, 92.118], ['A', ' O ', 150.829, 133.985, 92.906], ['A', ' H ', 148.677, 133.313, 93.569], ['A', ' HA ', 150.004, 131.158, 92.65], ['A', ' HA ', 149.417, 131.798, 91.134]] AA_SCO= 2.5421052631578944 CA_SCO= 1.696052631578947
[['A', ' N ', 151.926, 132.759, 91.393], ['A', ' CA ', 153.107, 133.584, 91.23], ['A', ' C ', 152.933, 134.862, 90.414], ['A', ' O ', 153.746, 135.755, 90.555], ['A', ' CB ', 154.072, 132.632, 90.557], ['A', ' CG ', 153.209, 131.632, 89.897], ['A', ' CD ', 152.018, 131.469, 90.747], ['A', ' HA ', 153.488, 133.847, 92.229], ['A', ' HB ', 154.699, 133.19, 89.843], ['A', ' HB ', 154.76, 132.199, 91.307], ['A', ' HG ', 152.993, 131.897, 88.851], ['A', ' HG ', 153.748, 130.715, 89.893], ['A', ' HD ', 151.178, 131.258, 90.084], ['A', ' HD ', 152.182, 130.663, 91.491]] AA_SCO= 2.5515789473684207 CA_SCO= 1.6889473684210525
[['A', ' N ', 151.908, 134.984, 89.531], ['A', ' CA ', 151.79, 136.306, 88.891], ['A', ' C ', 150.895, 137.103, 89.801], ['A', ' O ', 150.883, 138.326, 89.811], ['A', ' CB ', 151.239, 136.33, 87.483], ['A', ' CG ', 149.779, 135.995, 87.309], ['A', ' CD ', 149.312, 136.364, 85.951], ['A', ' NE ', 149.358, 137.796, 85.758], ['A', ' CZ ', 148.444, 138.676, 86.201], ['A', ' NH1', 147.368, 138.299, 86.869], ['A', ' NH2', 148.636, 139.947, 85.952], ['A', ' H ', 151.267, 134.236, 89.325], ['A', ' HA ', 152.759, 136.793, 88.865], ['A', ' HB ', 151.403, 137.321, 87.075], ['A', ' HB ', 151.809, 135.645, 86.879], ['A', ' HG ', 149.627, 134.926, 87.434], ['A', ' HG ', 149.164, 136.531, 88.02], ['A', ' HD ', 149.985, 135.934, 85.227], ['A', ' HD ', 148.294, 136.005, 85.772], ['A', ' HE ', 150.149, 138.176, 85.24], ['A', ' HH1', 147.166, 137.304, 87.06], ['A', ' HH1', 146.712, 138.992, 87.19], ['A', ' HH2', 149.459, 140.239, 85.406], ['A', ' HH2', 147.975, 140.635, 86.267]] AA_SCO= 2.5984210526315787 CA_SCO= 1.688578947368421
[['A', ' N ', 150.101, 136.383, 90.556], ['A', ' CA ', 149.32, 136.976, 91.588], ['A', ' C ', 150.408, 137.142, 92.584], ['A', ' O ', 151.48, 136.618, 92.34], ['A', ' CB ', 148.189, 136.111, 92.06], ['A', ' H ', 150.078, 135.386, 90.436], ['A', ' HA ', 148.944, 137.949, 91.277], ['A', ' HB ', 147.69, 136.575, 92.911], ['A', ' HB ', 147.472, 135.958, 91.254], ['A', ' HB ', 148.59, 135.184, 92.36]] AA_SCO= 2.59578947368421 CA_SCO= 1.5592105263157894
[['A', ' N ', 150.282, 137.958, 93.594], ['A', ' CA ', 151.415, 138.012, 94.516], ['A', ' C ', 152.699, 138.414, 93.77], ['A', ' O ', 153.795, 137.951, 94.077], ['A', ' CB ', 151.617, 136.633, 95.122], ['A', ' CG ', 152.474, 136.535, 96.285], ['A', ' CD ', 152.534, 135.156, 96.702], ['A', ' NE ', 153.234, 134.364, 95.74], ['A', ' CZ ', 153.185, 133.03, 95.62], ['A', ' NH1', 152.447, 132.286, 96.415], ['A', ' NH2', 153.903, 132.477, 94.692], ['A', ' H ', 149.41, 138.435, 93.783], ['A', ' HA ', 151.21, 138.74, 95.301], ['A', ' HB ', 150.668, 136.173, 95.35], ['A', ' HB ', 152.102, 135.983, 94.417], ['A', ' HG ', 153.48, 136.851, 96.107], ['A', ' HG ', 152.043, 137.131, 97.053], ['A', ' HD ', 153.037, 135.07, 97.661], ['A', ' HD ', 151.523, 134.795, 96.762], ['A', ' HE ', 153.815, 134.874, 95.08], ['A', ' HH1', 151.885, 132.721, 97.163], ['A', ' HH1', 152.47, 131.259, 96.306], ['A', ' HH2', 154.512, 133.068, 94.122], ['A', ' HH2', 153.922, 131.479, 94.562]] AA_SCO= 2.5173684210526313 CA_SCO= 1.5666842105263157
[['A', ' N ', 152.544, 139.288, 92.793], ['A', ' CA ', 153.644, 139.822, 92.008], ['A', ' C ', 153.155, 141.166, 91.548], ['A', ' O ', 153.913, 142.03, 91.142], ['A', ' CB ', 153.987, 138.903, 90.857], ['A', ' CG ', 155.254, 139.213, 90.109], ['A', ' SD ', 156.716, 139.005, 91.097], ['A', ' CE ', 156.913, 137.237, 91.155], ['A', ' H ', 151.61, 139.578, 92.577], ['A', ' HA ', 154.516, 139.967, 92.644], ['A', ' HB ', 154.043, 137.918, 91.239], ['A', ' HB ', 153.192, 138.932, 90.133], ['A', ' HG ', 155.327, 138.576, 89.232], ['A', ' HG ', 155.236, 140.218, 89.786], ['A', ' HE ', 157.797, 136.992, 91.738], ['A', ' HE ', 156.036, 136.773, 91.616], ['A', ' HE ', 157.031, 136.852, 90.148]] AA_SCO= 2.506842105263157 CA_SCO= 1.5632105263157894
[['A', ' N ', 151.835, 141.309, 91.637], ['A', ' CA ', 151.074, 142.493, 91.277], ['A', ' C ', 150.614, 143.138, 92.576], ['A', ' O ', 149.813, 144.069, 92.587], ['A', ' CB ', 149.851, 142.129, 90.407], ['A', ' CG1', 150.292, 141.508, 89.115], ['A', ' CG2', 148.961, 141.144, 91.159], ['A', ' H ', 151.326, 140.517, 91.971], ['A', ' HA ', 151.719, 143.188, 90.735], ['A', ' HB ', 149.292, 143.033, 90.173], ['A', ' HG1', 149.427, 141.258, 88.512], ['A', ' HG1', 150.899, 142.214, 88.581], ['A', ' HG1', 150.863, 140.622, 89.307], ['A', ' HG2', 148.099, 140.895, 90.543], ['A', ' HG2', 149.508, 140.242, 91.377], ['A', ' HG2', 148.615, 141.591, 92.078]] AA_SCO= 2.5278947368421045 CA_SCO= 1.5636842105263158
[['A', ' N ', 151.103, 142.543, 93.654], ['A', ' CA ', 150.927, 142.885, 95.044], ['A', ' C ', 152.314, 142.691, 95.59], ['A', ' O ', 153.019, 141.801, 95.117], ['A', ' CB ', 149.971, 141.946, 95.783], ['A', ' CG ', 148.523, 141.946, 95.353], ['A', ' CD ', 147.779, 143.194, 95.744], ['A', ' OE1', 148.329, 144.005, 96.46], ['A', ' OE2', 146.642, 143.33, 95.349], ['A', ' H ', 151.758, 141.804, 93.473], ['A', ' HA ', 150.623, 143.926, 95.157], ['A', ' HB ', 150.333, 140.929, 95.688], ['A', ' HB ', 149.99, 142.189, 96.847], ['A', ' HG ', 148.477, 141.841, 94.285], ['A', ' HG ', 148.025, 141.081, 95.791]] AA_SCO= 2.5363157894736843 CA_SCO= 1.568315789473684
[['A', ' N ', 152.716, 143.479, 96.572], ['A', ' CA ', 154.031, 143.383, 97.231], ['A', ' C ', 155.129, 143.899, 96.284], ['A', ' O ', 155.791, 144.897, 96.57], ['A', ' CB ', 154.313, 141.945, 97.667], ['A', ' CG ', 153.206, 141.444, 98.467], ['A', ' CD1', 152.45, 140.419, 97.987], ['A', ' CD2', 152.847, 142.038, 99.643], ['A', ' CE1', 151.366, 140.004, 98.657], ['A', ' CE2', 151.748, 141.611, 100.315], ['A', ' CZ ', 151.007, 140.599, 99.808], ['A', ' H ', 152.06, 144.172, 96.902], ['A', ' HA ', 154.025, 144.024, 98.112], ['A', ' HB ', 154.474, 141.292, 96.838], ['A', ' HB ', 155.214, 141.918, 98.271], ['A', ' HD1', 152.729, 139.949, 97.037], ['A', ' HD2', 153.433, 142.868, 100.035], ['A', ' HE1', 150.784, 139.214, 98.279], ['A', ' HE2', 151.45, 142.088, 101.252], ['A', ' HZ ', 150.123, 140.268, 100.334]] AA_SCO= 2.447368421052632 CA_SCO= 1.569157894736842
[['A', ' N ', 155.287, 143.233, 95.149], ['A', ' CA ', 156.14, 143.668, 94.054], ['A', ' C ', 155.23, 144.26, 92.994], ['A', ' O ', 154.032, 143.999, 92.998], ['A', ' CB ', 156.978, 142.525, 93.478], ['A', ' CG ', 158.008, 141.964, 94.447], ['A', ' CD ', 158.882, 140.879, 93.826], ['A', ' OE1', 158.938, 140.755, 92.603], ['A', ' NE2', 159.579, 140.122, 94.66], ['A', ' H ', 154.706, 142.408, 95.028], ['A', ' HA ', 156.809, 144.451, 94.405], ['A', ' HB ', 156.314, 141.708, 93.188], ['A', ' HB ', 157.488, 142.862, 92.576], ['A', ' HG ', 158.653, 142.773, 94.778], ['A', ' HG ', 157.485, 141.542, 95.298], ['A', ' HE2', 160.194, 139.384, 94.309], ['A', ' HE2', 159.524, 140.287, 95.643]] AA_SCO= 2.4794736842105265 CA_SCO= 1.5716842105263158
[['A', ' N ', 155.747, 145.113, 92.122], ['A', ' CA ', 154.884, 145.582, 91.046], ['A', ' C ', 155.047, 144.686, 89.829], ['A', ' O ', 156.148, 144.204, 89.554], ['A', ' H ', 156.721, 145.37, 92.158], ['A', ' HA ', 153.844, 145.573, 91.371], ['A', ' HA ', 155.138, 146.609, 90.789]] AA_SCO= 2.4742105263157894 CA_SCO= 1.5817894736842104
[['A', ' N ', 153.971, 144.516, 89.079], ['A', ' CA ', 153.959, 143.724, 87.859], ['A', ' C ', 152.713, 144.155, 87.118], ['A', ' O ', 151.696, 144.434, 87.752], ['A', ' CB ', 154.007, 142.249, 88.227], ['A', ' CG ', 154.229, 141.232, 87.195], ['A', ' CD1', 155.49, 141.01, 86.697], ['A', ' CD2', 153.212, 140.439, 86.772], ['A', ' CE1', 155.715, 140.018, 85.778], ['A', ' CE2', 153.431, 139.453, 85.869], ['A', ' CZ ', 154.686, 139.235, 85.364], ['A', ' H ', 153.108, 144.947, 89.379], ['A', ' HA ', 154.832, 143.967, 87.251], ['A', ' HB ', 154.817, 142.152, 88.92], ['A', ' HB ', 153.123, 141.987, 88.759], ['A', ' HD1', 156.318, 141.634, 87.046], ['A', ' HD2', 152.211, 140.593, 87.169], ['A', ' HE1', 156.715, 139.853, 85.383], ['A', ' HE2', 152.604, 138.838, 85.552], ['A', ' HZ ', 154.855, 138.438, 84.635]] AA_SCO= 2.332105263157895 CA_SCO= 1.7818421052631577
[['A', ' N ', 152.807, 144.354, 85.816], ['A', ' CA ', 151.645, 144.801, 85.059], ['A', ' C ', 151.191, 143.783, 84.04], ['A', ' O ', 150.047, 143.802, 83.585], ['A', ' CB ', 151.943, 146.132, 84.386], ['A', ' CG ', 152.18, 147.261, 85.371], ['A', ' CD ', 152.443, 148.577, 84.661], ['A', ' CE ', 152.676, 149.705, 85.659], ['A', ' NZ ', 152.973, 151.0, 84.981], ['A', ' H ', 153.674, 144.118, 85.319], ['A', ' HA ', 150.818, 144.951, 85.751], ['A', ' HB ', 152.831, 146.027, 83.759], ['A', ' HB ', 151.112, 146.407, 83.74], ['A', ' HG ', 151.306, 147.364, 86.015], ['A', ' HG ', 153.037, 147.017, 85.995], ['A', ' HD ', 153.322, 148.479, 84.022], ['A', ' HD ', 151.586, 148.827, 84.036], ['A', ' HE ', 151.785, 149.825, 86.274], ['A', ' HE ', 153.516, 149.442, 86.302], ['A', ' HZ ', 153.121, 151.718, 85.677], ['A', ' HZ ', 153.806, 150.905, 84.416], ['A', ' HZ ', 152.196, 151.26, 84.391]] AA_SCO= 2.311578947368421 CA_SCO= 1.7817894736842106
[['A', ' N ', 152.104, 142.923, 83.653], ['A', ' CA ', 151.886, 141.952, 82.617], ['A', ' C ', 150.768, 140.993, 82.997], ['A', ' O ', 150.664, 140.575, 84.154], ['A', ' CB ', 153.197, 141.209, 82.374], ['A', ' CG ', 154.359, 142.083, 81.852], ['A', ' CD ', 155.204, 142.822, 82.943], ['A', ' OE1', 154.681, 143.166, 84.002], ['A', ' OE2', 156.367, 143.03, 82.696], ['A', ' H ', 153.03, 142.966, 84.066], ['A', ' HA ', 151.596, 142.475, 81.706], ['A', ' HB ', 153.519, 140.737, 83.284], ['A', ' HB ', 153.039, 140.431, 81.638], ['A', ' HG ', 155.029, 141.449, 81.271], ['A', ' HG ', 153.942, 142.827, 81.174]] AA_SCO= 2.311578947368421 CA_SCO= 1.784
[['A', ' N ', 149.947, 140.644, 82.004], ['A', ' CA ', 148.825, 139.722, 82.145], ['A', ' C ', 148.911, 138.653, 81.07], ['A', ' O ', 149.488, 138.893, 80.011], ['A', ' CB ', 147.503, 140.451, 81.969], ['A', ' CG ', 147.24, 141.583, 82.941], ['A', ' CD ', 145.922, 142.222, 82.712], ['A', ' NE ', 144.842, 141.316, 83.046], ['A', ' CZ ', 143.525, 141.543, 82.854], ['A', ' NH1', 143.106, 142.676, 82.324], ['A', ' NH2', 142.661, 140.609, 83.204], ['A', ' H ', 150.116, 141.048, 81.094], ['A', ' HA ', 148.865, 139.25, 83.123], ['A', ' HB ', 147.449, 140.862, 80.963], ['A', ' HB ', 146.691, 139.734, 82.069], ['A', ' HG ', 147.254, 141.203, 83.951], ['A', ' HG ', 148.01, 142.346, 82.832], ['A', ' HD ', 145.837, 143.112, 83.335], ['A', ' HD ', 145.833, 142.495, 81.66], ['A', ' HE ', 145.102, 140.446, 83.483], ['A', ' HH1', 143.767, 143.39, 82.057], ['A', ' HH1', 142.117, 142.832, 82.188], ['A', ' HH2', 143.005, 139.726, 83.586], ['A', ' HH2', 141.666, 140.749, 83.089]] AA_SCO= 2.311578947368421 CA_SCO= 1.783842105263158
[['A', ' N ', 148.322, 137.484, 81.313], ['A', ' CA ', 148.298, 136.428, 80.297], ['A', ' C ', 149.246, 135.293, 80.605], ['A', ' O ', 149.942, 135.31, 81.623], ['A', ' H ', 147.848, 137.317, 82.188], ['A', ' HA ', 147.288, 136.032, 80.217], ['A', ' HA ', 148.54, 136.847, 79.321]] AA_SCO= 2.283157894736842 CA_SCO= 1.7842631578947366
[['A', ' N ', 149.281, 134.315, 79.713], ['A', ' CA ', 150.078, 133.113, 79.935], ['A', ' C ', 151.567, 133.38, 79.939], ['A', ' O ', 152.314, 132.717, 80.663], ['A', ' CB ', 149.776, 132.041, 78.879], ['A', ' CG1', 148.391, 131.67, 78.945], ['A', ' CG2', 150.063, 132.517, 77.486], ['A', ' H ', 148.669, 134.417, 78.898], ['A', ' HA ', 149.801, 132.704, 80.908], ['A', ' HB ', 150.368, 131.157, 79.095], ['A', ' HG1', 148.244, 130.907, 78.199], ['A', ' HG1', 148.157, 131.293, 79.941], ['A', ' HG1', 147.778, 132.511, 78.724], ['A', ' HG2', 149.815, 131.714, 76.821], ['A', ' HG2', 149.456, 133.385, 77.243], ['A', ' HG2', 151.1, 132.759, 77.359]] AA_SCO= 2.276842105263158 CA_SCO= 1.7842631578947366
[['A', ' N ', 152.011, 134.351, 79.155], ['A', ' CA ', 153.424, 134.635, 79.159], ['A', ' C ', 153.76, 135.324, 80.456], ['A', ' O ', 154.858, 135.185, 80.958], ['A', ' CB ', 153.866, 135.465, 77.941], ['A', ' CG1', 153.566, 134.685, 76.651], ['A', ' CG2', 153.169, 136.815, 77.926], ['A', ' H ', 151.362, 134.868, 78.577], ['A', ' HA ', 153.969, 133.691, 79.121], ['A', ' HB ', 154.949, 135.615, 77.988], ['A', ' HG1', 153.911, 135.264, 75.791], ['A', ' HG1', 154.085, 133.729, 76.672], ['A', ' HG1', 152.501, 134.512, 76.56], ['A', ' HG2', 153.508, 137.376, 77.056], ['A', ' HG2', 152.092, 136.681, 77.868], ['A', ' HG2', 153.413, 137.386, 78.814]] AA_SCO= 2.2905263157894735 CA_SCO= 1.7813684210526317
[['A', ' N ', 152.832, 136.097, 81.004], ['A', ' CA ', 153.11, 136.742, 82.264], ['A', ' C ', 153.237, 135.692, 83.357], ['A', ' O ', 154.166, 135.725, 84.161], ['A', ' CB ', 152.007, 137.715, 82.6], ['A', ' H ', 151.934, 136.203, 80.552], ['A', ' HA ', 154.055, 137.276, 82.175], ['A', ' HB ', 152.221, 138.211, 83.519], ['A', ' HB ', 151.928, 138.442, 81.807], ['A', ' HB ', 151.072, 137.19, 82.693]] AA_SCO= 2.3284210526315787 CA_SCO= 1.7808421052631582
[['A', ' N ', 152.37, 134.686, 83.316], ['A', ' CA ', 152.358, 133.644, 84.335], ['A', ' C ', 153.606, 132.799, 84.327], ['A', ' O ', 154.171, 132.475, 85.381], ['A', ' CB ', 151.189, 132.703, 84.103], ['A', ' CG ', 149.849, 133.265, 84.352], ['A', ' CD ', 148.815, 132.326, 83.926], ['A', ' OE1', 149.014, 131.126, 84.049], ['A', ' NE2', 147.723, 132.832, 83.413], ['A', ' H ', 151.635, 134.709, 82.605], ['A', ' HA ', 152.27, 134.11, 85.308], ['A', ' HB ', 151.209, 132.379, 83.068], ['A', ' HB ', 151.309, 131.81, 84.721], ['A', ' HG ', 149.73, 133.441, 85.415], ['A', ' HG ', 149.731, 134.177, 83.791], ['A', ' HE2', 146.992, 132.22, 83.099], ['A', ' HE2', 147.598, 133.825, 83.356]] AA_SCO= 2.3626315789473686 CA_SCO= 1.794105263157895
[['A', ' N ', 154.122, 132.516, 83.145], ['A', ' CA ', 155.239, 131.604, 83.082], ['A', ' C ', 156.572, 132.355, 83.076], ['A', ' O ', 157.639, 131.766, 82.918], ['A', ' CB ', 155.003, 130.645, 81.896], ['A', ' CG ', 156.004, 129.555, 81.732], ['A', ' ND1', 156.29, 128.624, 82.698], ['A', ' CD2', 156.71, 129.208, 80.677], ['A', ' CE1', 157.204, 127.795, 82.242], ['A', ' NE2', 157.498, 128.136, 81.023], ['A', ' H ', 153.636, 132.806, 82.287], ['A', ' HA ', 155.237, 130.982, 83.973], ['A', ' HB ', 154.021, 130.183, 82.007], ['A', ' HB ', 154.982, 131.227, 80.972], ['A', ' HD1', 155.866, 128.482, 83.602], ['A', ' HD2', 156.744, 129.624, 79.708], ['A', ' HE1', 157.583, 126.99, 82.868]] AA_SCO= 2.3710526315789475 CA_SCO= 1.8007894736842112
[['A', ' N ', 156.494, 133.652, 83.364], ['A', ' CA ', 157.617, 134.545, 83.571], ['A', ' C ', 157.676, 134.918, 85.03], ['A', ' O ', 158.741, 134.867, 85.644], ['A', ' CB ', 157.535, 135.783, 82.683], ['A', ' CG1', 158.59, 136.817, 83.079], ['A', ' CG2', 157.832, 135.33, 81.242], ['A', ' H ', 155.568, 134.067, 83.478], ['A', ' HA ', 158.536, 134.017, 83.313], ['A', ' HB ', 156.54, 136.227, 82.759], ['A', ' HG1', 158.521, 137.672, 82.409], ['A', ' HG1', 158.425, 137.155, 84.1], ['A', ' HG1', 159.561, 136.393, 83.007], ['A', ' HG2', 157.776, 136.184, 80.566], ['A', ' HG2', 158.83, 134.896, 81.195], ['A', ' HG2', 157.118, 134.581, 80.932]] AA_SCO= 2.3536842105263163 CA_SCO= 1.8010526315789481
[['A', ' N ', 156.522, 135.22, 85.621], ['A', ' CA ', 156.463, 135.608, 87.01], ['A', ' C ', 157.066, 134.527, 87.874], ['A', ' O ', 157.713, 134.829, 88.869], ['A', ' CB ', 155.043, 135.863, 87.42], ['A', ' H ', 155.664, 135.259, 85.075], ['A', ' HA ', 157.038, 136.513, 87.139], ['A', ' HB ', 155.025, 136.165, 88.459], ['A', ' HB ', 154.621, 136.65, 86.802], ['A', ' HB ', 154.46, 134.949, 87.29]] AA_SCO= 2.364736842105263 CA_SCO= 1.9312631578947375
[['A', ' N ', 156.894, 133.27, 87.497], ['A', ' CA ', 157.47, 132.188, 88.274], ['A', ' C ', 158.983, 132.266, 88.334], ['A', ' O ', 159.594, 131.975, 89.362], ['A', ' CB ', 157.119, 130.897, 87.621], ['A', ' CG ', 155.734, 130.598, 87.741], ['A', ' CD ', 155.395, 129.436, 87.048], ['A', ' NE ', 153.991, 129.271, 86.992], ['A', ' CZ ', 153.23, 128.727, 87.924], ['A', ' NH1', 153.745, 128.228, 89.037], ['A', ' NH2', 151.947, 128.701, 87.684], ['A', ' H ', 156.302, 133.065, 86.683], ['A', ' HA ', 157.065, 132.225, 89.287], ['A', ' HB ', 157.37, 130.938, 86.559], ['A', ' HB ', 157.694, 130.082, 88.066], ['A', ' HG ', 155.57, 130.412, 88.779], ['A', ' HG ', 155.115, 131.42, 87.407], ['A', ' HD ', 155.765, 129.526, 86.029], ['A', ' HD ', 155.837, 128.578, 87.543], ['A', ' HE ', 153.515, 129.612, 86.158], ['A', ' HH1', 154.747, 128.239, 89.187], ['A', ' HH1', 153.146, 127.796, 89.724], ['A', ' HH2', 151.607, 129.04, 86.766], ['A', ' HH2', 151.271, 128.282, 88.336]] AA_SCO= 2.3615789473684217 CA_SCO= 1.9314736842105262
[['A', ' N ', 159.597, 132.642, 87.226], ['A', ' CA ', 161.032, 132.707, 87.141], ['A', ' C ', 161.533, 133.869, 87.996], ['A', ' O ', 162.562, 133.79, 88.682], ['A', ' CB ', 161.396, 132.828, 85.686], ['A', ' H ', 159.058, 132.947, 86.421], ['A', ' HA ', 161.449, 131.783, 87.541], ['A', ' HB ', 162.42, 132.846, 85.557], ['A', ' HB ', 160.993, 131.968, 85.152], ['A', ' HB ', 160.96, 133.733, 85.283]] AA_SCO= 2.379473684210527 CA_SCO= 1.9316842105263161
[['A', ' N ', 160.76, 134.946, 87.995], ['A', ' CA ', 161.127, 136.111, 88.772], ['A', ' C ', 161.01, 135.757, 90.25], ['A', ' O ', 161.812, 136.197, 91.092], ['A', ' CB ', 160.182, 137.26, 88.446], ['A', ' CG ', 160.227, 137.794, 87.001], ['A', ' CD1', 159.125, 138.817, 86.837], ['A', ' CD2', 161.576, 138.389, 86.676], ['A', ' H ', 159.939, 134.955, 87.38], ['A', ' HA ', 162.159, 136.372, 88.565], ['A', ' HB ', 159.168, 136.927, 88.639], ['A', ' HB ', 160.396, 138.089, 89.121], ['A', ' HG ', 160.029, 136.976, 86.31], ['A', ' HD1', 159.124, 139.184, 85.812], ['A', ' HD1', 158.169, 138.376, 87.056], ['A', ' HD1', 159.294, 139.647, 87.52], ['A', ' HD2', 161.564, 138.755, 85.648], ['A', ' HD2', 161.783, 139.217, 87.354], ['A', ' HD2', 162.352, 137.64, 86.769]] AA_SCO= 2.356842105263158 CA_SCO= 1.937684210526316
[['A', ' N ', 159.995, 134.961, 90.567], ['A', ' CA ', 159.787, 134.516, 91.918], ['A', ' C ', 160.936, 133.649, 92.39], ['A', ' O ', 161.385, 133.796, 93.521], ['A', ' CB ', 158.482, 133.785, 92.082], ['A', ' CG ', 158.252, 133.372, 93.479], ['A', ' CD ', 156.935, 132.888, 93.693], ['A', ' OE1', 156.02, 133.629, 93.481], ['A', ' OE2', 156.781, 131.737, 94.002], ['A', ' H ', 159.326, 134.697, 89.838], ['A', ' HA ', 159.744, 135.397, 92.556], ['A', ' HB ', 157.657, 134.412, 91.753], ['A', ' HB ', 158.481, 132.893, 91.463], ['A', ' HG ', 158.954, 132.578, 93.743], ['A', ' HG ', 158.439, 134.218, 94.142]] AA_SCO= 2.3526315789473684 CA_SCO= 1.9440000000000004
[['A', ' N ', 161.48, 132.786, 91.533], ['A', ' CA ', 162.591, 131.957, 91.985], ['A', ' C ', 163.705, 132.832, 92.505], ['A', ' O ', 164.272, 132.545, 93.563], ['A', ' CB ', 163.163, 131.138, 90.849], ['A', ' CG ', 162.271, 130.126, 90.383], ['A', ' SD ', 162.814, 129.267, 88.927], ['A', ' CE ', 163.985, 128.176, 89.591], ['A', ' H ', 161.042, 132.653, 90.615], ['A', ' HA ', 162.247, 131.308, 92.789], ['A', ' HB ', 163.393, 131.79, 90.013], ['A', ' HB ', 164.089, 130.674, 91.171], ['A', ' HG ', 162.173, 129.414, 91.183], ['A', ' HG ', 161.307, 130.548, 90.191], ['A', ' HE ', 164.363, 127.563, 88.791], ['A', ' HE ', 164.796, 128.726, 90.052], ['A', ' HE ', 163.511, 127.536, 90.329]] AA_SCO= 2.443157894736842 CA_SCO= 1.9149999999999996
[['A', ' N ', 164.008, 133.92, 91.792], ['A', ' CA ', 165.064, 134.802, 92.271], ['A', ' C ', 164.698, 135.388, 93.638], ['A', ' O ', 165.54, 135.444, 94.542], ['A', ' CB ', 165.334, 135.925, 91.27], ['A', ' CG ', 166.003, 135.45, 89.994], ['A', ' CD ', 166.522, 136.614, 89.089], ['A', ' CE ', 165.391, 137.363, 88.377], ['A', ' NZ ', 165.904, 138.347, 87.329], ['A', ' H ', 163.524, 134.073, 90.896], ['A', ' HA ', 165.975, 134.216, 92.392], ['A', ' HB ', 164.391, 136.398, 91.002], ['A', ' HB ', 165.968, 136.681, 91.73], ['A', ' HG ', 166.841, 134.796, 90.245], ['A', ' HG ', 165.27, 134.862, 89.447], ['A', ' HD ', 167.082, 137.321, 89.703], ['A', ' HD ', 167.204, 136.212, 88.34], ['A', ' HE ', 164.722, 136.647, 87.896], ['A', ' HE ', 164.828, 137.92, 89.123], ['A', ' HZ ', 165.118, 138.824, 86.916], ['A', ' HZ ', 166.506, 139.023, 87.77], ['A', ' HZ ', 166.429, 137.89, 86.548]] AA_SCO= 2.43 CA_SCO= 1.844052631578947
[['A', ' N ', 163.435, 135.782, 93.81], ['A', ' CA ', 162.997, 136.348, 95.086], ['A', ' C ', 163.101, 135.353, 96.234], ['A', ' O ', 163.592, 135.681, 97.326], ['A', ' CB ', 161.532, 136.83, 95.001], ['A', ' OG1', 161.417, 137.89, 94.034], ['A', ' CG2', 161.039, 137.326, 96.349], ['A', ' H ', 162.8, 135.747, 93.005], ['A', ' HA ', 163.633, 137.202, 95.316], ['A', ' HB ', 160.902, 136.003, 94.688], ['A', ' HG1', 161.629, 137.547, 93.149], ['A', ' HG2', 160.012, 137.647, 96.247], ['A', ' HG2', 161.087, 136.538, 97.095], ['A', ' HG2', 161.652, 138.165, 96.675]] AA_SCO= 2.401578947368421 CA_SCO= 1.8431052631578946
[['A', ' N ', 162.632, 134.14, 95.997], ['A', ' CA ', 162.633, 133.12, 97.018], ['A', ' C ', 164.039, 132.769, 97.433], ['A', ' O ', 164.322, 132.626, 98.623], ['A', ' CB ', 161.926, 131.888, 96.503], ['A', ' H ', 162.243, 133.946, 95.076], ['A', ' HA ', 162.107, 133.506, 97.889], ['A', ' HB ', 161.91, 131.129, 97.271], ['A', ' HB ', 160.904, 132.142, 96.219], ['A', ' HB ', 162.455, 131.512, 95.629]] AA_SCO= 2.5142105263157895 CA_SCO= 1.7890526315789477
[['A', ' N ', 164.95, 132.706, 96.479], ['A', ' CA ', 166.297, 132.352, 96.833], ['A', ' C ', 166.949, 133.425, 97.668], ['A', ' O ', 167.638, 133.104, 98.642], ['A', ' CB ', 167.102, 132.035, 95.592], ['A', ' CG ', 168.549, 131.635, 95.809], ['A', ' CD1', 168.674, 130.483, 96.738], ['A', ' CD2', 169.076, 131.196, 94.526], ['A', ' H ', 164.677, 132.814, 95.498], ['A', ' HA ', 166.232, 131.447, 97.429], ['A', ' HB ', 166.602, 131.248, 95.045], ['A', ' HB ', 167.097, 132.929, 94.959], ['A', ' HG ', 169.123, 132.481, 96.193], ['A', ' HD1', 169.73, 130.225, 96.811], ['A', ' HD1', 168.308, 130.734, 97.727], ['A', ' HD1', 168.117, 129.633, 96.348], ['A', ' HD2', 170.11, 130.889, 94.657], ['A', ' HD2', 168.492, 130.356, 94.194], ['A', ' HD2', 169.003, 132.007, 93.805]] AA_SCO= 2.4826315789473683 CA_SCO= 1.738
[['A', ' N ', 166.725, 134.695, 97.342], ['A', ' CA ', 167.333, 135.728, 98.15], ['A', ' C ', 166.838, 135.646, 99.583], ['A', ' O ', 167.633, 135.796, 100.517], ['A', ' CB ', 167.03, 137.096, 97.584], ['A', ' OG ', 167.676, 137.295, 96.357], ['A', ' H ', 166.189, 134.944, 96.502], ['A', ' HA ', 168.412, 135.577, 98.147], ['A', ' HB ', 165.951, 137.188, 97.444], ['A', ' HB ', 167.336, 137.863, 98.294], ['A', ' HG ', 167.357, 138.14, 96.028]] AA_SCO= 2.471578947368421 CA_SCO= 1.736631578947368
[['A', ' N ', 165.554, 135.338, 99.787], ['A', ' CA ', 165.089, 135.262, 101.163], ['A', ' C ', 165.703, 134.07, 101.888], ['A', ' O ', 165.995, 134.161, 103.084], ['A', ' CB ', 163.576, 135.182, 101.259], ['A', ' CG ', 163.021, 135.14, 102.716], ['A', ' CD ', 163.395, 136.369, 103.497], ['A', ' NE ', 162.815, 136.386, 104.819], ['A', ' CZ ', 163.216, 137.196, 105.828], ['A', ' NH1', 164.207, 138.063, 105.664], ['A', ' NH2', 162.611, 137.123, 107.006], ['A', ' H ', 164.911, 135.255, 98.988], ['A', ' HA ', 165.412, 136.175, 101.658], ['A', ' HB ', 163.134, 136.037, 100.751], ['A', ' HB ', 163.231, 134.282, 100.739], ['A', ' HG ', 161.932, 135.085, 102.688], ['A', ' HG ', 163.404, 134.269, 103.25], ['A', ' HD ', 164.469, 136.393, 103.627], ['A', ' HD ', 163.074, 137.262, 102.963], ['A', ' HE ', 162.029, 135.74, 105.013], ['A', ' HH1', 164.705, 138.148, 104.763], ['A', ' HH1', 164.492, 138.654, 106.429], ['A', ' HH2', 161.851, 136.433, 107.157], ['A', ' HH2', 162.901, 137.715, 107.765]] AA_SCO= 2.441578947368421 CA_SCO= 1.7363157894736843
[['A', ' N ', 165.865, 132.938, 101.202], ['A', ' CA ', 166.461, 131.777, 101.849], ['A', ' C ', 167.877, 132.103, 102.333], ['A', ' O ', 168.281, 131.728, 103.441], ['A', ' CB ', 166.504, 130.611, 100.871], ['A', ' H ', 165.532, 132.886, 100.231], ['A', ' HA ', 165.856, 131.518, 102.713], ['A', ' HB ', 166.937, 129.743, 101.341], ['A', ' HB ', 165.513, 130.372, 100.529], ['A', ' HB ', 167.11, 130.897, 100.014]] AA_SCO= 2.4110526315789476 CA_SCO= 1.734842105263158
[['A', ' N ', 168.604, 132.876, 101.535], ['A', ' CA ', 169.956, 133.25, 101.896], ['A', ' C ', 169.929, 134.14, 103.127], ['A', ' O ', 170.723, 133.924, 104.046], ['A', ' CB ', 170.675, 133.927, 100.72], ['A', ' CG1', 170.876, 132.865, 99.609], ['A', ' CG2', 172.041, 134.474, 101.191], ['A', ' CD1', 171.286, 133.391, 98.247], ['A', ' H ', 168.218, 133.133, 100.618], ['A', ' HA ', 170.508, 132.348, 102.145], ['A', ' HB ', 170.058, 134.734, 100.321], ['A', ' HG1', 171.642, 132.175, 99.943], ['A', ' HG1', 169.945, 132.316, 99.484], ['A', ' HG2', 172.565, 134.942, 100.367], ['A', ' HG2', 171.909, 135.22, 101.983], ['A', ' HG2', 172.638, 133.653, 101.572], ['A', ' HD1', 171.391, 132.555, 97.557], ['A', ' HD1', 170.513, 134.066, 97.877], ['A', ' HD1', 172.227, 133.919, 98.309]] AA_SCO= 2.378421052631579 CA_SCO= 1.6599473684210526
[['A', ' N ', 169.012, 135.107, 103.17], ['A', ' CA ', 168.914, 136.008, 104.313], ['A', ' C ', 168.621, 135.257, 105.611], ['A', ' O ', 169.155, 135.614, 106.666], ['A', ' CB ', 167.807, 137.032, 104.089], ['A', ' CG ', 168.1, 138.062, 103.024], ['A', ' CD ', 166.919, 138.951, 102.724], ['A', ' OE1', 165.851, 138.698, 103.251], ['A', ' OE2', 167.078, 139.88, 101.969], ['A', ' H ', 168.408, 135.254, 102.353], ['A', ' HA ', 169.866, 136.531, 104.416], ['A', ' HB ', 166.897, 136.513, 103.804], ['A', ' HB ', 167.603, 137.557, 105.021], ['A', ' HG ', 168.929, 138.681, 103.364], ['A', ' HG ', 168.417, 137.557, 102.119]] AA_SCO= 2.397894736842105 CA_SCO= 1.664
[['A', ' N ', 167.79, 134.218, 105.563], ['A', ' CA ', 167.529, 133.514, 106.807], ['A', ' C ', 168.789, 132.868, 107.304], ['A', ' O ', 169.067, 132.924, 108.495], ['A', ' CB ', 166.44, 132.44, 106.7], ['A', ' CG1', 165.088, 133.066, 106.345], ['A', ' CG2', 166.355, 131.622, 108.061], ['A', ' CD1', 164.523, 134.065, 107.34], ['A', ' H ', 167.312, 133.992, 104.68], ['A', ' HA ', 167.238, 134.24, 107.559], ['A', ' HB ', 166.687, 131.765, 105.883], ['A', ' HG1', 165.186, 133.571, 105.391], ['A', ' HG1', 164.367, 132.261, 106.233], ['A', ' HG2', 165.587, 130.86, 107.999], ['A', ' HG2', 167.3, 131.135, 108.269], ['A', ' HG2', 166.121, 132.287, 108.881], ['A', ' HD1', 163.579, 134.415, 106.964], ['A', ' HD1', 164.359, 133.597, 108.306], ['A', ' HD1', 165.179, 134.916, 107.458]] AA_SCO= 2.387894736842105 CA_SCO= 1.660736842105263
[['A', ' N ', 169.555, 132.25, 106.419], ['A', ' CA ', 170.79, 131.64, 106.873], ['A', ' C ', 171.826, 132.691, 107.291], ['A', ' O ', 172.63, 132.423, 108.173], ['A', ' CB ', 171.333, 130.701, 105.816], ['A', ' CG ', 170.522, 129.427, 105.554], ['A', ' CD1', 171.088, 128.749, 104.383], ['A', ' CD2', 170.585, 128.464, 106.739], ['A', ' H ', 169.253, 132.186, 105.439], ['A', ' HA ', 170.566, 131.064, 107.764], ['A', ' HB ', 171.356, 131.253, 104.876], ['A', ' HB ', 172.345, 130.411, 106.093], ['A', ' HG ', 169.508, 129.7, 105.347], ['A', ' HD1', 170.516, 127.854, 104.16], ['A', ' HD1', 171.06, 129.417, 103.549], ['A', ' HD1', 172.1, 128.487, 104.61], ['A', ' HD2', 170.021, 127.567, 106.505], ['A', ' HD2', 171.623, 128.194, 106.925], ['A', ' HD2', 170.167, 128.917, 107.618]] AA_SCO= 2.344210526315789 CA_SCO= 1.6422631578947369
[['A', ' N ', 171.787, 133.91, 106.717], ['A', ' CA ', 172.693, 134.971, 107.194], ['A', ' C ', 172.44, 135.24, 108.671], ['A', ' O ', 173.373, 135.545, 109.422], ['A', ' CB ', 172.476, 136.337, 106.502], ['A', ' CG ', 173.016, 136.545, 105.102], ['A', ' OD1', 173.912, 135.866, 104.716], ['A', ' OD2', 172.525, 137.418, 104.435], ['A', ' H ', 171.171, 134.065, 105.914], ['A', ' HA ', 173.723, 134.644, 107.061], ['A', ' HB ', 171.415, 136.54, 106.475], ['A', ' HB ', 172.912, 137.106, 107.136]] AA_SCO= 2.3894736842105258 CA_SCO= 1.6423157894736842
[['A', ' N ', 171.178, 135.122, 109.091], ['A', ' CA ', 170.793, 135.33, 110.477], ['A', ' C ', 170.656, 133.964, 111.143], ['A', ' O ', 171.65, 133.257, 111.301], ['A', ' CB ', 169.473, 136.102, 110.557], ['A', ' CG ', 169.549, 137.534, 110.068], ['A', ' CD ', 168.217, 138.264, 110.15], ['A', ' OE1', 167.225, 137.636, 110.454], ['A', ' OE2', 168.199, 139.451, 109.914], ['A', ' H ', 170.448, 134.917, 108.398], ['A', ' HA ', 171.572, 135.894, 110.988], ['A', ' HB ', 168.722, 135.593, 109.944], ['A', ' HB ', 169.116, 136.129, 111.585], ['A', ' HG ', 170.288, 138.071, 110.66], ['A', ' HG ', 169.89, 137.527, 109.031]] AA_SCO= 2.351052631578947 CA_SCO= 1.5965263157894736
[['A', ' N ', 169.45, 133.587, 111.559], ['A', ' CA ', 169.248, 132.279, 112.166], ['A', ' C ', 170.287, 131.859, 113.191], ['A', ' O ', 171.266, 131.177, 112.872], ['A', ' CB ', 169.205, 131.199, 111.096], ['A', ' CG ', 169.026, 129.744, 111.585], ['A', ' CD1', 167.67, 129.577, 112.282], ['A', ' CD2', 169.195, 128.853, 110.407], ['A', ' H ', 168.658, 134.195, 111.416], ['A', ' HA ', 168.288, 132.312, 112.669], ['A', ' HB ', 168.377, 131.421, 110.436], ['A', ' HB ', 170.126, 131.25, 110.507], ['A', ' HG ', 169.786, 129.476, 112.309], ['A', ' HD1', 167.563, 128.545, 112.614], ['A', ' HD1', 167.612, 130.223, 113.153], ['A', ' HD1', 166.869, 129.828, 111.591], ['A', ' HD2', 169.095, 127.83, 110.74], ['A', ' HD2', 168.443, 129.081, 109.652], ['A', ' HD2', 170.187, 129.005, 109.989]] AA_SCO= 2.3021052631578947 CA_SCO= 1.560736842105263
[['A', ' N ', 170.128, 132.289, 114.427], ['A', ' CA ', 171.051, 131.797, 115.429], ['A', ' C ', 170.748, 130.306, 115.535], ['A', ' O ', 169.578, 129.926, 115.47], ['A', ' CB ', 170.894, 132.477, 116.777], ['A', ' CG ', 172.11, 132.208, 117.643], ['A', ' OD1', 172.325, 131.07, 118.025], ['A', ' OD2', 172.838, 133.141, 117.904], ['A', ' H ', 169.359, 132.892, 114.675], ['A', ' HA ', 172.077, 131.925, 115.08], ['A', ' HB ', 170.778, 133.552, 116.641], ['A', ' HB ', 170.004, 132.099, 117.286]] AA_SCO= 2.332105263157895 CA_SCO= 1.5239473684210525
[['A', ' N ', 171.773, 129.473, 115.686], ['A', ' CA ', 171.604, 128.024, 115.753], ['A', ' C ', 171.398, 127.494, 117.159], ['A', ' O ', 171.207, 126.29, 117.356], ['A', ' CB ', 172.824, 127.32, 115.159], ['A', ' OG1', 173.989, 127.677, 115.915], ['A', ' CG2', 173.007, 127.743, 113.737], ['A', ' H ', 172.71, 129.854, 115.762], ['A', ' HA ', 170.728, 127.756, 115.161], ['A', ' HB ', 172.684, 126.24, 115.198], ['A', ' HG1', 173.985, 127.196, 116.752], ['A', ' HG2', 173.874, 127.24, 113.317], ['A', ' HG2', 172.117, 127.472, 113.166], ['A', ' HG2', 173.152, 128.819, 113.696]] AA_SCO= 2.282631578947368 CA_SCO= 1.4875263157894736
[['A', ' N ', 171.452, 128.366, 118.156], ['A', ' CA ', 171.232, 127.917, 119.521], ['A', ' C ', 170.037, 128.666, 120.061], ['A', ' O ', 170.108, 129.818, 120.491], ['A', ' CB ', 172.442, 128.176, 120.379], ['A', ' OG ', 172.209, 127.775, 121.702], ['A', ' H ', 171.644, 129.363, 117.97], ['A', ' HA ', 171.006, 126.852, 119.528], ['A', ' HB ', 173.296, 127.636, 119.975], ['A', ' HB ', 172.683, 129.241, 120.35], ['A', ' HG ', 173.011, 127.986, 122.185]] AA_SCO= 2.149473684210527 CA_SCO= 1.4802105263157896
[['A', ' N ', 168.913, 127.988, 120.044], ['A', ' CA ', 167.662, 128.609, 120.385], ['A', ' C ', 166.649, 127.545, 120.731], ['A', ' O ', 166.817, 126.393, 120.323], ['A', ' CB ', 167.184, 129.424, 119.191], ['A', ' H ', 168.939, 127.032, 119.721], ['A', ' HA ', 167.827, 129.248, 121.25], ['A', ' HB ', 166.236, 129.913, 119.394], ['A', ' HB ', 167.927, 130.182, 118.937], ['A', ' HB ', 167.056, 128.749, 118.345]] AA_SCO= 2.1531578947368417 CA_SCO= 1.4348421052631581
[['A', ' N ', 165.612, 127.857, 121.502], ['A', ' CA ', 164.488, 126.991, 121.666], ['A', ' C ', 163.875, 127.017, 120.303], ['A', ' O ', 163.915, 128.062, 119.662], ['A', ' CB ', 163.651, 127.692, 122.728], ['A', ' CG ', 164.059, 129.151, 122.621], ['A', ' CD ', 165.526, 129.125, 122.225], ['A', ' HA ', 164.815, 125.982, 121.957], ['A', ' HB ', 162.581, 127.534, 122.522], ['A', ' HB ', 163.855, 127.256, 123.718], ['A', ' HG ', 163.435, 129.658, 121.866], ['A', ' HG ', 163.88, 129.667, 123.576], ['A', ' HD ', 165.711, 129.986, 121.581], ['A', ' HD ', 166.178, 129.115, 123.111]] AA_SCO= 2.1763157894736844 CA_SCO= 1.4580000000000002
[['A', ' N ', 163.319, 125.922, 119.855], ['A', ' CA ', 162.738, 125.924, 118.53], ['A', ' C ', 161.269, 125.618, 118.624], ['A', ' O ', 160.441, 126.341, 118.081], ['A', ' CB ', 163.452, 124.906, 117.645], ['A', ' CG1', 162.874, 124.877, 116.304], ['A', ' CG2', 164.844, 125.247, 117.549], ['A', ' H ', 163.287, 125.1, 120.441], ['A', ' HA ', 162.858, 126.91, 118.086], ['A', ' HB ', 163.329, 123.913, 118.074], ['A', ' HG1', 163.383, 124.128, 115.698], ['A', ' HG1', 161.84, 124.644, 116.366], ['A', ' HG1', 162.996, 125.84, 115.851], ['A', ' HG2', 165.33, 124.514, 116.923], ['A', ' HG2', 164.944, 126.232, 117.111], ['A', ' HG2', 165.303, 125.244, 118.532]] AA_SCO= 2.0626315789473684 CA_SCO= 1.5048947368421055
[['A', ' N ', 160.96, 124.504, 119.269], ['A', ' CA ', 159.598, 124.051, 119.373], ['A', ' C ', 158.963, 124.659, 120.601], ['A', ' O ', 159.594, 124.712, 121.658], ['A', ' CB ', 159.563, 122.551, 119.487], ['A', ' CG ', 158.217, 121.924, 119.36], ['A', ' CD ', 158.323, 120.464, 119.287], ['A', ' NE ', 157.03, 119.829, 119.056], ['A', ' CZ ', 156.166, 119.433, 120.016], ['A', ' NH1', 156.433, 119.624, 121.293], ['A', ' NH2', 155.04, 118.842, 119.658], ['A', ' H ', 161.685, 123.939, 119.675], ['A', ' HA ', 159.05, 124.363, 118.48], ['A', ' HB ', 160.205, 122.139, 118.783], ['A', ' HB ', 159.947, 122.27, 120.463], ['A', ' HG ', 157.579, 122.203, 120.2], ['A', ' HG ', 157.78, 122.268, 118.428], ['A', ' HD ', 158.975, 120.204, 118.452], ['A', ' HD ', 158.754, 120.076, 120.205], ['A', ' HE ', 156.76, 119.651, 118.085], ['A', ' HH1', 157.29, 120.077, 121.573], ['A', ' HH1', 155.777, 119.32, 121.998], ['A', ' HH2', 154.843, 118.687, 118.669], ['A', ' HH2', 154.383, 118.527, 120.355]] AA_SCO= 1.9821052631578946 CA_SCO= 1.4958947368421054
[['A', ' N ', 157.73, 125.104, 120.452], ['A', ' CA ', 156.919, 125.662, 121.508], ['A', ' C ', 156.434, 124.608, 122.488], ['A', ' O ', 156.179, 123.463, 122.125], ['A', ' CB ', 155.73, 126.353, 120.898], ['A', ' H ', 157.327, 125.06, 119.518], ['A', ' HA ', 157.524, 126.385, 122.055], ['A', ' HB ', 155.123, 126.804, 121.681], ['A', ' HB ', 156.07, 127.12, 120.21], ['A', ' HB ', 155.159, 125.611, 120.36]] AA_SCO= 1.9689473684210528 CA_SCO= 1.5472631578947371
[['A', ' N ', 156.284, 125.011, 123.737], ['A', ' CA ', 155.735, 124.179, 124.806], ['A', ' C ', 154.234, 124.448, 124.911], ['A', ' O ', 153.839, 125.593, 125.144], ['A', ' CB ', 156.408, 124.475, 126.143], ['A', ' CG ', 155.974, 123.507, 127.24], ['A', ' OD1', 155.334, 122.526, 126.922], ['A', ' OD2', 156.295, 123.747, 128.382], ['A', ' H ', 156.547, 125.96, 123.962], ['A', ' HA ', 155.884, 123.129, 124.554], ['A', ' HB ', 157.491, 124.414, 126.027], ['A', ' HB ', 156.165, 125.489, 126.458]] AA_SCO= 1.9857894736842103 CA_SCO= 1.5922105263157897
[['A', ' N ', 153.39, 123.469, 124.619], ['A', ' CA ', 151.958, 123.739, 124.609], ['A', ' C ', 151.08, 122.569, 125.021], ['A', ' O ', 151.507, 121.419, 125.034], ['A', ' CB ', 151.542, 124.165, 123.219], ['A', ' CG ', 151.753, 123.083, 122.257], ['A', ' CD1', 150.748, 122.181, 121.972], ['A', ' CD2', 152.971, 122.936, 121.652], ['A', ' CE1', 150.971, 121.155, 121.115], ['A', ' CE2', 153.195, 121.918, 120.799], ['A', ' CZ ', 152.199, 121.019, 120.531], ['A', ' H ', 153.745, 122.539, 124.437], ['A', ' HA ', 151.764, 124.558, 125.302], ['A', ' HB ', 150.488, 124.44, 123.209], ['A', ' HB ', 152.127, 125.032, 122.912], ['A', ' HD1', 149.773, 122.286, 122.446], ['A', ' HD2', 153.766, 123.644, 121.871], ['A', ' HE1', 150.177, 120.442, 120.899], ['A', ' HE2', 154.169, 121.811, 120.336], ['A', ' HZ ', 152.384, 120.197, 119.845]] AA_SCO= 2.0194736842105256 CA_SCO= 1.5927368421052632
[['A', ' N ', 149.838, 122.911, 125.373], ['A', ' CA ', 148.758, 121.992, 125.734], ['A', ' C ', 147.792, 121.839, 124.558], ['A', ' O ', 147.184, 122.823, 124.132], ['A', ' CB ', 148.044, 122.491, 126.995], ['A', ' CG ', 146.983, 121.521, 127.588], ['A', ' OD1', 146.354, 120.749, 126.876], ['A', ' OD2', 146.831, 121.554, 128.799], ['A', ' H ', 149.613, 123.895, 125.366], ['A', ' HA ', 149.189, 121.011, 125.944], ['A', ' HB ', 148.787, 122.699, 127.767], ['A', ' HB ', 147.546, 123.435, 126.767]] AA_SCO= 1.9731578947368418 CA_SCO= 1.5887368421052634
[['A', ' N ', 147.707, 120.637, 123.99], ['A', ' CA ', 146.902, 120.367, 122.797], ['A', ' C ', 145.392, 120.369, 123.038], ['A', ' O ', 144.595, 120.278, 122.094], ['A', ' CB ', 147.296, 119.036, 122.151], ['A', ' CG ', 146.876, 117.762, 122.915], ['A', ' CD ', 147.843, 117.353, 123.984], ['A', ' OE1', 148.55, 118.207, 124.468], ['A', ' OE2', 147.875, 116.198, 124.321], ['A', ' H ', 148.236, 119.862, 124.404], ['A', ' HA ', 147.111, 121.148, 122.09], ['A', ' HB ', 146.861, 118.979, 121.154], ['A', ' HB ', 148.378, 119.004, 122.031], ['A', ' HG ', 145.898, 117.898, 123.366], ['A', ' HG ', 146.789, 116.952, 122.192]] AA_SCO= 2.0084210526315784 CA_SCO= 1.5780526315789474
[['A', ' N ', 144.967, 120.414, 124.286], ['A', ' CA ', 143.545, 120.365, 124.539], ['A', ' C ', 142.92, 121.725, 124.34], ['A', ' O ', 142.677, 122.457, 125.299], ['A', ' CB ', 143.256, 119.901, 125.945], ['A', ' CG ', 143.683, 118.488, 126.243], ['A', ' CD ', 143.484, 118.161, 127.667], ['A', ' NE ', 144.352, 118.974, 128.507], ['A', ' CZ ', 144.333, 119.024, 129.859], ['A', ' NH1', 143.487, 118.281, 130.565], ['A', ' NH2', 145.178, 119.832, 130.469], ['A', ' H ', 145.634, 120.509, 125.071], ['A', ' HA ', 143.098, 119.668, 123.846], ['A', ' HB ', 143.758, 120.567, 126.645], ['A', ' HB ', 142.185, 119.97, 126.134], ['A', ' HG ', 143.105, 117.792, 125.634], ['A', ' HG ', 144.748, 118.38, 126.014], ['A', ' HD ', 142.45, 118.357, 127.943], ['A', ' HD ', 143.723, 117.112, 127.836], ['A', ' HE ', 145.045, 119.582, 128.017], ['A', ' HH1', 142.841, 117.663, 130.099], ['A', ' HH1', 143.489, 118.334, 131.574], ['A', ' HH2', 145.825, 120.417, 129.895], ['A', ' HH2', 145.196, 119.899, 131.469]] AA_SCO= 2.0431578947368423 CA_SCO= 1.6167368421052632
[['A', ' N ', 142.635, 122.035, 123.09], ['A', ' CA ', 142.105, 123.331, 122.725], ['A', ' C ', 140.641, 123.468, 123.093], ['A', ' O ', 139.96, 122.495, 123.463], ['A', ' H ', 142.929, 121.364, 122.383], ['A', ' HA ', 142.687, 124.117, 123.208], ['A', ' HA ', 142.208, 123.468, 121.649]] AA_SCO= 1.887894736842105 CA_SCO= 1.5772631578947365
[['A', ' N ', 140.137, 124.694, 122.941], ['A', ' CA ', 138.748, 125.009, 123.244], ['A', ' C ', 137.927, 125.144, 121.983], ['A', ' O ', 136.699, 125.182, 122.026], ['A', ' CB ', 138.666, 126.327, 124.013], ['A', ' OG1', 139.183, 127.382, 123.186], ['A', ' CG2', 139.5, 126.225, 125.273], ['A', ' H ', 140.751, 125.445, 122.65], ['A', ' HA ', 138.326, 124.204, 123.847], ['A', ' HB ', 137.63, 126.542, 124.272], ['A', ' HG1', 138.514, 127.626, 122.519], ['A', ' HG2', 139.447, 127.167, 125.818], ['A', ' HG2', 139.113, 125.42, 125.897], ['A', ' HG2', 140.536, 126.016, 125.02]] AA_SCO= 1.8221052631578947 CA_SCO= 1.580578947368421
[['A', ' N ', 138.628, 125.288, 120.876], ['A', ' CA ', 138.065, 125.435, 119.552], ['A', ' C ', 137.934, 126.889, 119.118], ['A', ' O ', 137.233, 127.67, 119.76], ['A', ' H ', 139.629, 125.221, 120.96], ['A', ' HA ', 138.705, 124.897, 118.857], ['A', ' HA ', 137.087, 124.955, 119.519]] AA_SCO= 1.8710526315789473 CA_SCO= 1.5965789473684209
[['A', ' N ', 138.577, 127.271, 118.011], ['A', ' CA ', 138.417, 128.637, 117.533], ['A', ' C ', 138.587, 128.806, 116.02], ['A', ' O ', 138.813, 129.925, 115.572], ['A', ' CB ', 139.351, 129.601, 118.265], ['A', ' CG ', 140.817, 129.426, 117.987], ['A', ' CD ', 141.664, 130.526, 118.656], ['A', ' CE ', 141.964, 130.226, 120.13], ['A', ' NZ ', 142.846, 131.274, 120.759], ['A', ' H ', 139.189, 126.635, 117.532], ['A', ' HA ', 137.397, 128.947, 117.765], ['A', ' HB ', 139.083, 130.624, 118.003], ['A', ' HB ', 139.198, 129.493, 119.336], ['A', ' HG ', 141.127, 128.463, 118.387], ['A', ' HG ', 141.01, 129.441, 116.913], ['A', ' HD ', 142.615, 130.612, 118.122], ['A', ' HD ', 141.147, 131.478, 118.587], ['A', ' HE ', 141.039, 130.163, 120.694], ['A', ' HE ', 142.483, 129.267, 120.187], ['A', ' HZ ', 143.082, 131.024, 121.732], ['A', ' HZ ', 143.754, 131.344, 120.288], ['A', ' HZ ', 142.409, 132.168, 120.742]] AA_SCO= 1.9068421052631581 CA_SCO= 1.581631578947368
[['A', ' N ', 138.526, 127.723, 115.234], ['A', ' CA ', 138.711, 127.835, 113.78], ['A', ' C ', 139.949, 128.628, 113.42], ['A', ' O ', 139.857, 129.721, 112.859], ['A', ' CB ', 137.486, 128.47, 113.131], ['A', ' CG ', 136.162, 127.708, 113.286], ['A', ' CD1', 135.043, 128.575, 112.766], ['A', ' CD2', 136.19, 126.385, 112.471], ['A', ' H ', 138.322, 126.823, 115.626], ['A', ' HA ', 138.848, 126.836, 113.378], ['A', ' HB ', 137.349, 129.469, 113.54], ['A', ' HB ', 137.682, 128.571, 112.087], ['A', ' HG ', 135.993, 127.495, 114.337], ['A', ' HD1', 134.094, 128.053, 112.877], ['A', ' HD1', 135.013, 129.506, 113.332], ['A', ' HD1', 135.216, 128.797, 111.712], ['A', ' HD2', 135.244, 125.864, 112.591], ['A', ' HD2', 136.331, 126.597, 111.436], ['A', ' HD2', 136.971, 125.751, 112.786]] AA_SCO= 1.9015789473684213 CA_SCO= 1.6264210526315785
[['A', ' N ', 141.099, 128.112, 113.822], ['A', ' CA ', 142.349, 128.798, 113.618], ['A', ' C ', 142.637, 128.82, 112.147], ['A', ' O ', 142.347, 127.857, 111.436], ['A', ' H ', 141.087, 127.181, 114.218], ['A', ' HA ', 142.281, 129.811, 114.009], ['A', ' HA ', 143.147, 128.285, 114.146]] AA_SCO= 1.986842105263158 CA_SCO= 1.6327368421052628
[['A', ' N ', 143.241, 129.896, 111.682], ['A', ' CA ', 143.546, 130.027, 110.266], ['A', ' C ', 145.013, 130.215, 110.032], ['A', ' O ', 145.624, 131.128, 110.584], ['A', ' CB ', 142.833, 131.245, 109.671], ['A', ' CG1', 141.342, 131.104, 109.872], ['A', ' CG2', 143.163, 131.33, 108.143], ['A', ' CD1', 140.573, 132.373, 109.639], ['A', ' H ', 143.487, 130.634, 112.36], ['A', ' HA ', 143.228, 129.125, 109.745], ['A', ' HB ', 143.159, 132.151, 110.179], ['A', ' HG1', 140.992, 130.336, 109.204], ['A', ' HG1', 141.133, 130.791, 110.889], ['A', ' HG2', 142.667, 132.178, 107.69], ['A', ' HG2', 144.233, 131.444, 107.983], ['A', ' HG2', 142.825, 130.413, 107.653], ['A', ' HD1', 139.51, 132.187, 109.799], ['A', ' HD1', 140.915, 133.13, 110.344], ['A', ' HD1', 140.721, 132.731, 108.642]] AA_SCO= 1.995263157894737 CA_SCO= 1.669052631578947
[['A', ' N ', 145.568, 129.407, 109.161], ['A', ' CA ', 146.961, 129.569, 108.82], ['A', ' C ', 147.081, 129.557, 107.325], ['A', ' O ', 146.361, 128.819, 106.652], ['A', ' H ', 144.991, 128.677, 108.727], ['A', ' HA ', 147.355, 130.501, 109.227], ['A', ' HA ', 147.53, 128.743, 109.238]] AA_SCO= 1.9905263157894737 CA_SCO= 1.7106315789473683
[['A', ' N ', 148.015, 130.308, 106.768], ['A', ' CA ', 148.103, 130.247, 105.334], ['A', ' C ', 149.502, 130.454, 104.84], ['A', ' O ', 150.251, 131.289, 105.336], ['A', ' CB ', 147.179, 131.263, 104.729], ['A', ' H ', 148.621, 130.912, 107.309], ['A', ' HA ', 147.798, 129.257, 105.037], ['A', ' HB ', 147.229, 131.155, 103.66], ['A', ' HB ', 146.166, 131.084, 105.069], ['A', ' HB ', 147.487, 132.265, 105.021]] AA_SCO= 2.1089473684210525 CA_SCO= 1.7155789473684204
[['A', ' N ', 149.844, 129.691, 103.834], ['A', ' CA ', 151.161, 129.75, 103.269], ['A', ' C ', 151.218, 130.141, 101.817], ['A', ' O ', 150.517, 129.618, 100.952], ['A', ' CB ', 151.866, 128.406, 103.472], ['A', ' CG1', 151.927, 128.041, 104.98], ['A', ' CG2', 153.251, 128.444, 102.869], ['A', ' CD1', 152.762, 128.932, 105.897], ['A', ' H ', 149.15, 129.019, 103.493], ['A', ' HA ', 151.719, 130.502, 103.814], ['A', ' HB ', 151.289, 127.61, 102.992], ['A', ' HG1', 150.92, 128.05, 105.369], ['A', ' HG1', 152.301, 127.036, 105.048], ['A', ' HG2', 153.721, 127.509, 103.031], ['A', ' HG2', 153.216, 128.624, 101.806], ['A', ' HG2', 153.833, 129.22, 103.336], ['A', ' HD1', 152.695, 128.541, 106.917], ['A', ' HD1', 153.798, 128.923, 105.587], ['A', ' HD1', 152.395, 129.956, 105.896]] AA_SCO= 2.061052631578947 CA_SCO= 1.7604210526315789
[['A', ' N ', 152.13, 131.033, 101.518], ['A', ' CA ', 152.316, 131.404, 100.133], ['A', ' C ', 153.194, 130.375, 99.457], ['A', ' O ', 154.426, 130.497, 99.404], ['A', ' CB ', 152.93, 132.772, 99.976], ['A', ' CG ', 152.099, 133.869, 100.412], ['A', ' CD ', 150.946, 134.17, 99.599], ['A', ' OE1', 150.726, 133.609, 98.558], ['A', ' OE2', 150.24, 135.037, 100.024], ['A', ' H ', 152.659, 131.454, 102.268], ['A', ' HA ', 151.349, 131.401, 99.631], ['A', ' HB ', 153.823, 132.825, 100.536], ['A', ' HB ', 153.202, 132.941, 98.946], ['A', ' HG ', 151.726, 133.628, 101.352], ['A', ' HG ', 152.72, 134.748, 100.507]] AA_SCO= 2.055263157894737 CA_SCO= 1.765
[['A', ' N ', 152.5, 129.321, 99.052], ['A', ' CA ', 152.935, 128.12, 98.354], ['A', ' C ', 153.33, 128.527, 96.937], ['A', ' O ', 152.829, 129.531, 96.428], ['A', ' CB ', 151.796, 127.097, 98.364], ['A', ' H ', 151.518, 129.395, 99.327], ['A', ' HA ', 153.802, 127.719, 98.872], ['A', ' HB ', 152.026, 126.175, 97.889], ['A', ' HB ', 151.523, 126.895, 99.379], ['A', ' HB ', 150.962, 127.491, 97.879]] AA_SCO= 2.182105263157895 CA_SCO= 1.7888421052631578
[['A', ' N ', 154.162, 127.777, 96.215], ['A', ' CA ', 154.606, 128.107, 94.875], ['A', ' C ', 153.478, 128.153, 93.857], ['A', ' O ', 153.645, 128.678, 92.76], ['A', ' CB ', 155.579, 126.992, 94.569], ['A', ' CG ', 155.172, 125.865, 95.463], ['A', ' CD ', 154.654, 126.495, 96.702], ['A', ' HA ', 155.134, 129.074, 94.905], ['A', ' HB ', 155.517, 126.729, 93.5], ['A', ' HB ', 156.587, 127.345, 94.739], ['A', ' HG ', 154.436, 125.217, 94.966], ['A', ' HG ', 156.04, 125.226, 95.682], ['A', ' HD ', 153.881, 125.845, 97.028], ['A', ' HD ', 155.427, 126.61, 97.45]] AA_SCO= 2.1978947368421053 CA_SCO= 1.8042105263157895
[['A', ' N ', 152.338, 127.569, 94.184], ['A', ' CA ', 151.234, 127.571, 93.258], ['A', ' C ', 150.171, 128.572, 93.673], ['A', ' O ', 149.135, 128.649, 93.022], ['A', ' CB ', 150.586, 126.197, 93.204], ['A', ' CG ', 151.509, 125.021, 92.912], ['A', ' CD ', 152.247, 125.165, 91.668], ['A', ' NE ', 153.085, 124.018, 91.391], ['A', ' CZ ', 152.756, 122.928, 90.667], ['A', ' NH1', 151.593, 122.78, 90.102], ['A', ' NH2', 153.657, 122.006, 90.489], ['A', ' H ', 152.214, 127.133, 95.084], ['A', ' HA ', 151.591, 127.847, 92.267], ['A', ' HB ', 150.118, 125.991, 94.159], ['A', ' HB ', 149.799, 126.192, 92.447], ['A', ' HG ', 152.232, 124.918, 93.717], ['A', ' HG ', 150.911, 124.115, 92.845], ['A', ' HD ', 151.579, 125.319, 90.85], ['A', ' HD ', 152.907, 126.022, 91.741], ['A', ' HE ', 154.02, 124.045, 91.76], ['A', ' HH1', 150.89, 123.516, 90.151], ['A', ' HH1', 151.416, 121.961, 89.538], ['A', ' HH2', 154.585, 122.133, 90.865], ['A', ' HH2', 153.447, 121.202, 89.919]] AA_SCO= 2.196842105263158 CA_SCO= 1.809736842105263
[['A', ' N ', 150.416, 129.341, 94.737], ['A', ' CA ', 149.431, 130.296, 95.248], ['A', ' C ', 149.095, 130.061, 96.719], ['A', ' O ', 149.503, 129.072, 97.299], ['A', ' H ', 151.321, 129.276, 95.202], ['A', ' HA ', 149.826, 131.306, 95.134], ['A', ' HA ', 148.536, 130.24, 94.644]] AA_SCO= 2.066315789473684 CA_SCO= 1.8145263157894735
[['A', ' N ', 148.343, 130.961, 97.34], ['A', ' CA ', 148.067, 130.872, 98.767], ['A', ' C ', 147.3, 129.63, 99.204], ['A', ' O ', 146.169, 129.394, 98.791], ['A', ' CB ', 147.23, 132.094, 99.151], ['A', ' CG ', 146.917, 132.306, 100.619], ['A', ' CD1', 148.198, 132.656, 101.376], ['A', ' CD2', 145.872, 133.411, 100.742], ['A', ' H ', 148.001, 131.76, 96.832], ['A', ' HA ', 149.023, 130.888, 99.283], ['A', ' HB ', 147.755, 132.986, 98.799], ['A', ' HB ', 146.278, 132.035, 98.622], ['A', ' HG ', 146.532, 131.398, 101.044], ['A', ' HD1', 147.982, 132.827, 102.418], ['A', ' HD1', 148.925, 131.866, 101.294], ['A', ' HD1', 148.599, 133.556, 100.962], ['A', ' HD2', 145.636, 133.562, 101.794], ['A', ' HD2', 146.26, 134.34, 100.316], ['A', ' HD2', 144.967, 133.115, 100.21]] AA_SCO= 2.0236842105263158 CA_SCO= 1.7979473684210527
[['A', ' N ', 147.915, 128.893, 100.122], ['A', ' CA ', 147.451, 127.647, 100.728], ['A', ' C ', 146.854, 127.913, 102.107], ['A', ' O ', 147.602, 128.121, 103.061], ['A', ' CB ', 148.67, 126.686, 100.785], ['A', ' CG ', 148.428, 125.285, 101.328], ['A', ' OD1', 147.451, 125.097, 101.932], ['A', ' OD2', 149.185, 124.385, 101.069], ['A', ' H ', 148.846, 129.204, 100.378], ['A', ' HA ', 146.684, 127.222, 100.106], ['A', ' HB ', 149.062, 126.583, 99.77], ['A', ' HB ', 149.459, 127.148, 101.373]] AA_SCO= 2.1142105263157895 CA_SCO= 1.8024736842105267
[['A', ' N ', 145.522, 127.973, 102.221], ['A', ' CA ', 144.889, 128.359, 103.485], ['A', ' C ', 144.225, 127.197, 104.204], ['A', ' O ', 143.281, 126.594, 103.698], ['A', ' CB ', 143.763, 129.375, 103.225], ['A', ' CG1', 143.12, 129.803, 104.553], ['A', ' CG2', 144.264, 130.533, 102.425], ['A', ' H ', 144.932, 127.778, 101.409], ['A', ' HA ', 145.641, 128.787, 104.14], ['A', ' HB ', 143.0, 128.889, 102.661], ['A', ' HG1', 142.316, 130.48, 104.352], ['A', ' HG1', 142.723, 128.946, 105.089], ['A', ' HG1', 143.864, 130.299, 105.174], ['A', ' HG2', 143.448, 131.215, 102.22], ['A', ' HG2', 145.025, 131.05, 102.962], ['A', ' HG2', 144.663, 130.168, 101.48]] AA_SCO= 1.9547368421052629 CA_SCO= 1.814789473684211
[['A', ' N ', 144.648, 126.901, 105.42], ['A', ' CA ', 144.019, 125.799, 106.13], ['A', ' C ', 143.34, 126.333, 107.359], ['A', ' O ', 143.856, 127.209, 108.06], ['A', ' CB ', 144.983, 124.711, 106.598], ['A', ' CG ', 145.729, 123.983, 105.553], ['A', ' ND1', 146.348, 122.777, 105.792], ['A', ' CD2', 146.024, 124.297, 104.294], ['A', ' CE1', 146.983, 122.401, 104.694], ['A', ' NE2', 146.794, 123.322, 103.797], ['A', ' H ', 145.406, 127.445, 105.837], ['A', ' HA ', 143.257, 125.327, 105.518], ['A', ' HB ', 145.703, 125.155, 107.263], ['A', ' HB ', 144.423, 123.982, 107.181], ['A', ' HD2', 145.761, 125.163, 103.731], ['A', ' HE1', 147.584, 121.497, 104.571], ['A', ' HE2', 147.173, 123.406, 102.846]] AA_SCO= 1.95578947368421 CA_SCO= 1.8494210526315795
[['A', ' N ', 142.188, 125.779, 107.645], ['A', ' CA ', 141.458, 126.119, 108.841], ['A', ' C ', 141.332, 124.904, 109.728], ['A', ' O ', 141.084, 123.798, 109.245], ['A', ' CB ', 140.1, 126.702, 108.496], ['A', ' CG ', 139.221, 127.01, 109.717], ['A', ' SD ', 137.666, 127.756, 109.284], ['A', ' CE ', 138.152, 129.43, 109.256], ['A', ' H ', 141.813, 125.076, 107.001], ['A', ' HA ', 142.018, 126.868, 109.38], ['A', ' HB ', 140.245, 127.62, 107.934], ['A', ' HB ', 139.565, 126.004, 107.847], ['A', ' HG ', 139.011, 126.105, 110.281], ['A', ' HG ', 139.761, 127.7, 110.377], ['A', ' HE ', 137.305, 130.061, 108.986], ['A', ' HE ', 138.529, 129.725, 110.24], ['A', ' HE ', 138.922, 129.538, 108.546]] AA_SCO= 1.9784210526315789 CA_SCO= 1.8890000000000002
[['A', ' N ', 141.462, 125.097, 111.035], ['A', ' CA ', 141.312, 123.964, 111.928], ['A', ' C ', 140.691, 124.327, 113.264], ['A', ' O ', 140.922, 125.39, 113.85], ['A', ' CB ', 142.67, 123.337, 112.187], ['A', ' H ', 141.691, 126.036, 111.382], ['A', ' HA ', 140.666, 123.24, 111.442], ['A', ' HB ', 142.553, 122.46, 112.828], ['A', ' HB ', 143.122, 123.043, 111.251], ['A', ' HB ', 143.318, 124.066, 112.681]] AA_SCO= 2.037894736842105 CA_SCO= 1.8896842105263163
[['A', ' N ', 139.93, 123.402, 113.797], ['A', ' CA ', 139.371, 123.586, 115.113], ['A', ' C ', 139.688, 122.378, 115.94], ['A', ' O ', 139.297, 121.262, 115.594], ['A', ' CB ', 137.865, 123.781, 115.058], ['A', ' CG ', 137.233, 124.084, 116.358], ['A', ' CD ', 135.765, 124.5, 116.232], ['A', ' CE ', 134.839, 123.309, 116.026], ['A', ' NZ ', 133.4, 123.715, 116.059], ['A', ' H ', 139.759, 122.546, 113.262], ['A', ' HA ', 139.836, 124.447, 115.588], ['A', ' HB ', 137.623, 124.536, 114.367], ['A', ' HB ', 137.422, 122.86, 114.737], ['A', ' HG ', 137.305, 123.22, 117.02], ['A', ' HG ', 137.767, 124.895, 116.789], ['A', ' HD ', 135.463, 125.012, 117.152], ['A', ' HD ', 135.646, 125.189, 115.398], ['A', ' HE ', 135.049, 122.841, 115.066], ['A', ' HE ', 135.016, 122.583, 116.82], ['A', ' HZ ', 132.82, 122.899, 115.93], ['A', ' HZ ', 133.177, 124.145, 116.955], ['A', ' HZ ', 133.219, 124.378, 115.321]] AA_SCO= 2.006842105263158 CA_SCO= 1.888684210526316
[['A', ' N ', 140.346, 122.606, 117.056], ['A', ' CA ', 140.729, 121.543, 117.954], ['A', ' C ', 140.027, 121.704, 119.271], ['A', ' O ', 140.095, 122.765, 119.89], ['A', ' CB ', 142.243, 121.553, 118.18], ['A', ' CG1', 142.632, 120.463, 119.182], ['A', ' CG2', 142.945, 121.329, 116.851], ['A', ' H ', 140.602, 123.554, 117.28], ['A', ' HA ', 140.435, 120.593, 117.522], ['A', ' HB ', 142.543, 122.516, 118.599], ['A', ' HG1', 143.702, 120.485, 119.339], ['A', ' HG1', 142.142, 120.627, 120.137], ['A', ' HG1', 142.344, 119.488, 118.796], ['A', ' HG2', 144.026, 121.342, 117.0], ['A', ' HG2', 142.642, 120.37, 116.461], ['A', ' HG2', 142.67, 122.106, 116.147]] AA_SCO= 1.9815789473684209 CA_SCO= 1.8996315789473686
[['A', ' N ', 139.351, 120.652, 119.687], ['A', ' CA ', 138.646, 120.652, 120.949], ['A', ' C ', 138.948, 119.376, 121.699], ['A', ' O ', 138.844, 118.277, 121.159], ['A', ' CB ', 137.133, 120.739, 120.759], ['A', ' CG ', 136.625, 121.998, 120.069], ['A', ' CD ', 135.104, 122.024, 119.881], ['A', ' OE1', 134.48, 121.029, 120.16], ['A', ' OE2', 134.574, 123.032, 119.466], ['A', ' H ', 139.395, 119.809, 119.11], ['A', ' HA ', 138.976, 121.498, 121.541], ['A', ' HB ', 136.789, 119.87, 120.23], ['A', ' HB ', 136.661, 120.713, 121.741], ['A', ' HG ', 136.916, 122.841, 120.669], ['A', ' HG ', 137.107, 122.089, 119.103]] AA_SCO= 2.02578947368421 CA_SCO= 1.8251052631578948
[['A', ' N ', 139.3, 119.505, 122.958], ['A', ' CA ', 139.521, 118.348, 123.815], ['A', ' C ', 140.551, 117.362, 123.264], ['A', ' O ', 140.411, 116.152, 123.427], ['A', ' CB ', 138.209, 117.623, 124.04], ['A', ' CG ', 137.203, 118.486, 124.684], ['A', ' OD1', 137.492, 119.209, 125.646], ['A', ' ND2', 136.003, 118.445, 124.169], ['A', ' H ', 139.415, 120.457, 123.331], ['A', ' HA ', 139.898, 118.705, 124.775], ['A', ' HB ', 137.806, 117.237, 123.107], ['A', ' HB ', 138.384, 116.766, 124.688], ['A', ' HD2', 135.272, 119.01, 124.552], ['A', ' HD2', 135.816, 117.852, 123.384]] AA_SCO= 1.9815789473684209 CA_SCO= 1.837421052631579
[['A', ' N ', 141.588, 117.87, 122.62], ['A', ' CA ', 142.663, 117.032, 122.108], ['A', ' C ', 142.387, 116.397, 120.748], ['A', ' O ', 143.182, 115.579, 120.28], ['A', ' H ', 141.645, 118.872, 122.519], ['A', ' HA ', 143.571, 117.634, 122.039], ['A', ' HA ', 142.872, 116.246, 122.831]] AA_SCO= 1.9221052631578945 CA_SCO= 1.8188421052631578
[['A', ' N ', 141.267, 116.73, 120.117], ['A', ' CA ', 140.936, 116.174, 118.812], ['A', ' C ', 140.564, 117.258, 117.832], ['A', ' O ', 140.01, 118.299, 118.19], ['A', ' CB ', 139.801, 115.162, 118.905], ['A', ' CG ', 140.074, 113.927, 119.758], ['A', ' CD ', 141.122, 113.011, 119.114], ['A', ' CE ', 141.25, 111.679, 119.84], ['A', ' NZ ', 141.747, 111.834, 121.243], ['A', ' H ', 140.595, 117.355, 120.57], ['A', ' HA ', 141.799, 115.675, 118.408], ['A', ' HB ', 138.939, 115.654, 119.341], ['A', ' HB ', 139.524, 114.838, 117.897], ['A', ' HG ', 140.419, 114.248, 120.741], ['A', ' HG ', 139.147, 113.374, 119.884], ['A', ' HD ', 140.866, 112.83, 118.067], ['A', ' HD ', 142.089, 113.491, 119.152], ['A', ' HE ', 140.279, 111.188, 119.861], ['A', ' HE ', 141.951, 111.053, 119.289], ['A', ' HZ ', 141.82, 110.924, 121.673], ['A', ' HZ ', 142.657, 112.279, 121.247], ['A', ' HZ ', 141.1, 112.399, 121.772]] AA_SCO= 1.8689473684210525 CA_SCO= 1.7499473684210525
[['A', ' N ', 140.828, 117.012, 116.58], ['A', ' CA ', 140.415, 117.936, 115.567], ['A', ' C ', 138.923, 117.707, 115.39], ['A', ' O ', 138.446, 116.579, 115.419], ['A', ' CB ', 141.204, 117.699, 114.274], ['A', ' CG1', 142.698, 117.951, 114.546], ['A', ' CG2', 140.697, 118.629, 113.181], ['A', ' CD1', 143.609, 117.461, 113.467], ['A', ' H ', 141.299, 116.148, 116.303], ['A', ' HA ', 140.578, 118.956, 115.899], ['A', ' HB ', 141.094, 116.66, 113.96], ['A', ' HG1', 142.863, 119.01, 114.667], ['A', ' HG1', 142.978, 117.444, 115.469], ['A', ' HG2', 141.247, 118.46, 112.279], ['A', ' HG2', 139.648, 118.436, 112.989], ['A', ' HG2', 140.818, 119.667, 113.496], ['A', ' HD1', 144.637, 117.661, 113.744], ['A', ' HD1', 143.474, 116.375, 113.348], ['A', ' HD1', 143.398, 117.951, 112.53]] AA_SCO= 1.8684210526315794 CA_SCO= 1.7100526315789473
[['A', ' N ', 138.159, 118.775, 115.382], ['A', ' CA ', 136.726, 118.671, 115.195], ['A', ' C ', 136.395, 119.135, 113.82], ['A', ' O ', 135.421, 118.705, 113.204], ['A', ' CB ', 135.99, 119.514, 116.207], ['A', ' CG ', 136.242, 119.104, 117.586], ['A', ' CD ', 135.797, 117.718, 117.836], ['A', ' OE1', 134.636, 117.38, 117.602], ['A', ' NE2', 136.697, 116.885, 118.293], ['A', ' H ', 138.604, 119.678, 115.435], ['A', ' HA ', 136.42, 117.63, 115.283], ['A', ' HB ', 136.315, 120.549, 116.111], ['A', ' HB ', 134.92, 119.479, 116.017], ['A', ' HG ', 137.308, 119.184, 117.809], ['A', ' HG ', 135.669, 119.754, 118.227], ['A', ' HE2', 136.457, 115.931, 118.467], ['A', ' HE2', 137.638, 117.204, 118.455]] AA_SCO= 1.926842105263158 CA_SCO= 1.6936315789473682
[['A', ' N ', 137.227, 120.031, 113.345], ['A', ' CA ', 137.061, 120.595, 112.031], ['A', ' C ', 138.38, 120.816, 111.366], ['A', ' O ', 139.328, 121.301, 111.988], ['A', ' CB ', 136.364, 121.939, 112.092], ['A', ' CG ', 136.221, 122.558, 110.799], ['A', ' CD1', 135.166, 122.249, 110.004], ['A', ' CD2', 137.168, 123.456, 110.344], ['A', ' CE1', 135.039, 122.82, 108.785], ['A', ' CE2', 137.038, 124.016, 109.123], ['A', ' CZ ', 135.971, 123.702, 108.348], ['A', ' H ', 137.972, 120.355, 113.965], ['A', ' HA ', 136.478, 119.905, 111.419], ['A', ' HB ', 135.384, 121.833, 112.544], ['A', ' HB ', 136.931, 122.603, 112.682], ['A', ' HD1', 134.418, 121.537, 110.356], ['A', ' HD2', 138.03, 123.708, 110.969], ['A', ' HE1', 134.188, 122.57, 108.152], ['A', ' HE2', 137.779, 124.712, 108.753], ['A', ' HZ ', 135.866, 124.155, 107.37]] AA_SCO= 2.0226315789473683 CA_SCO= 1.6947368421052633
[['A', ' N ', 138.44, 120.482, 110.105], ['A', ' CA ', 139.591, 120.779, 109.302], ['A', ' C ', 139.192, 120.865, 107.857], ['A', ' O ', 138.457, 120.011, 107.358], ['A', ' CB ', 140.69, 119.749, 109.501], ['A', ' CG ', 141.82, 119.964, 108.589], ['A', ' CD1', 142.793, 120.886, 108.863], ['A', ' CD2', 141.859, 119.243, 107.45], ['A', ' CE1', 143.806, 121.086, 107.97], ['A', ' CE2', 142.855, 119.429, 106.557], ['A', ' CZ ', 143.821, 120.347, 106.803], ['A', ' OH ', 144.801, 120.517, 105.88], ['A', ' H ', 137.645, 120.036, 109.664], ['A', ' HA ', 139.969, 121.75, 109.593], ['A', ' HB ', 141.063, 119.824, 110.509], ['A', ' HB ', 140.306, 118.745, 109.355], ['A', ' HD1', 142.747, 121.458, 109.775], ['A', ' HD2', 141.073, 118.519, 107.258], ['A', ' HE1', 144.582, 121.823, 108.172], ['A', ' HE2', 142.879, 118.848, 105.634], ['A', ' HH ', 145.332, 121.306, 106.085]] AA_SCO= 2.0457894736842106 CA_SCO= 1.6949473684210523
[['A', ' N ', 139.675, 121.896, 107.186], ['A', ' CA ', 139.443, 122.056, 105.758], ['A', ' C ', 140.502, 122.939, 105.156], ['A', ' O ', 141.187, 123.671, 105.88], ['A', ' CB ', 138.093, 122.661, 105.476], ['A', ' OG ', 138.043, 123.989, 105.902], ['A', ' H ', 140.226, 122.591, 107.702], ['A', ' HA ', 139.495, 121.081, 105.288], ['A', ' HB ', 137.893, 122.607, 104.405], ['A', ' HB ', 137.322, 122.081, 105.981], ['A', ' HG ', 137.192, 124.321, 105.617]] AA_SCO= 2.0805263157894736 CA_SCO= 1.6716315789473681
[['A', ' N ', 140.626, 122.942, 103.831], ['A', ' CA ', 141.593, 123.854, 103.259], ['A', ' C ', 141.172, 124.41, 101.894], ['A', ' O ', 140.51, 123.746, 101.103], ['A', ' CB ', 142.919, 123.138, 103.174], ['A', ' H ', 140.075, 122.3, 103.246], ['A', ' HA ', 141.686, 124.703, 103.928], ['A', ' HB ', 143.654, 123.823, 102.818], ['A', ' HB ', 143.21, 122.787, 104.166], ['A', ' HB ', 142.837, 122.289, 102.5]] AA_SCO= 2.1257894736842107 CA_SCO= 1.671421052631579
[['A', ' N ', 141.579, 125.659, 101.651], ['A', ' CA ', 141.384, 126.395, 100.404], ['A', ' C ', 142.757, 126.607, 99.851], ['A', ' O ', 143.483, 127.495, 100.304], ['A', ' CB ', 140.792, 127.763, 100.697], ['A', ' CG ', 139.575, 127.787, 101.541], ['A', ' CD1', 139.258, 129.244, 101.857], ['A', ' CD2', 138.451, 127.081, 100.824], ['A', ' H ', 142.113, 126.11, 102.392], ['A', ' HA ', 140.797, 125.811, 99.693], ['A', ' HB ', 141.529, 128.385, 101.152], ['A', ' HB ', 140.523, 128.211, 99.741], ['A', ' HG ', 139.764, 127.277, 102.486], ['A', ' HD1', 138.38, 129.295, 102.49], ['A', ' HD1', 140.103, 129.694, 102.379], ['A', ' HD1', 139.078, 129.78, 100.937], ['A', ' HD2', 137.552, 127.1, 101.44], ['A', ' HD2', 138.252, 127.569, 99.887], ['A', ' HD2', 138.715, 126.043, 100.632]] AA_SCO= 2.276842105263158 CA_SCO= 1.6705263157894736
[['A', ' N ', 143.12, 125.81, 98.902], ['A', ' CA ', 144.485, 125.757, 98.468], ['A', ' C ', 144.493, 126.153, 96.947], ['A', ' O ', 143.415, 126.274, 96.349], ['A', ' CB ', 144.962, 124.355, 98.958], ['A', ' CG1', 146.304, 124.095, 98.729], ['A', ' CG2', 144.705, 124.189, 100.391], ['A', ' H ', 142.424, 125.158, 98.524], ['A', ' HA ', 145.037, 126.506, 99.007], ['A', ' HB ', 144.417, 123.657, 98.472], ['A', ' HG1', 146.521, 123.096, 99.071], ['A', ' HG1', 146.499, 124.192, 97.713], ['A', ' HG1', 146.888, 124.778, 99.275], ['A', ' HG2', 145.015, 123.197, 100.7], ['A', ' HG2', 145.261, 124.933, 100.959], ['A', ' HG2', 143.677, 124.284, 100.586]] AA_SCO= 2.289473684210526 CA_SCO= 1.687421052631579
[['A', ' N ', 145.615, 126.617, 96.343], ['A', ' CA ', 145.691, 127.116, 94.991], ['A', ' C ', 145.193, 126.339, 93.816], ['A', ' O ', 144.802, 126.952, 92.818], ['A', ' CB ', 147.183, 127.302, 94.832], ['A', ' CG ', 147.795, 126.556, 95.942], ['A', ' CD ', 146.864, 126.833, 97.011], ['A', ' HA ', 145.224, 128.089, 94.982], ['A', ' HB ', 147.5, 126.932, 93.846], ['A', ' HB ', 147.402, 128.351, 94.855], ['A', ' HG ', 147.905, 125.495, 95.705], ['A', ' HG ', 148.804, 126.941, 96.145], ['A', ' HD ', 147.062, 126.327, 97.867], ['A', ' HD ', 146.949, 127.887, 97.174]] AA_SCO= 2.289473684210526 CA_SCO= 1.6868947368421054
[['A', ' N ', 145.176, 125.035, 93.844], ['A', ' CA ', 144.67, 124.464, 92.622], ['A', ' C ', 143.204, 124.766, 92.432], ['A', ' O ', 142.798, 125.084, 91.309], ['A', ' CB ', 144.923, 122.978, 92.505], ['A', ' OG1', 146.349, 122.742, 92.46], ['A', ' CG2', 144.265, 122.441, 91.253], ['A', ' H ', 145.456, 124.457, 94.649], ['A', ' HA ', 145.203, 124.927, 91.792], ['A', ' HB ', 144.508, 122.485, 93.372], ['A', ' HG1', 146.747, 123.009, 93.321], ['A', ' HG2', 144.435, 121.401, 91.178], ['A', ' HG2', 143.202, 122.603, 91.293], ['A', ' HG2', 144.669, 122.941, 90.388]] AA_SCO= 2.4431578947368418 CA_SCO= 1.6863684210526315
[['A', ' N ', 142.386, 124.675, 93.484], ['A', ' CA ', 140.987, 124.885, 93.212], ['A', ' C ', 140.676, 126.349, 93.208], ['A', ' O ', 139.683, 126.753, 92.613], ['A', ' CB ', 140.057, 124.177, 94.177], ['A', ' OG1', 140.169, 124.726, 95.471], ['A', ' CG2', 140.371, 122.703, 94.202], ['A', ' H ', 142.706, 124.436, 94.431], ['A', ' HA ', 140.765, 124.498, 92.22], ['A', ' HB ', 139.049, 124.314, 93.84], ['A', ' HG1', 141.067, 124.594, 95.817], ['A', ' HG2', 139.689, 122.213, 94.89], ['A', ' HG2', 140.258, 122.305, 93.201], ['A', ' HG2', 141.385, 122.537, 94.524]] AA_SCO= 2.4584210526315786 CA_SCO= 1.641473684210526
[['A', ' N ', 141.542, 127.185, 93.782], ['A', ' CA ', 141.276, 128.603, 93.635], ['A', ' C ', 141.335, 128.925, 92.139], ['A', ' O ', 140.512, 129.688, 91.638], ['A', ' CB ', 142.322, 129.479, 94.323], ['A', ' CG ', 142.219, 129.702, 95.812], ['A', ' CD1', 143.054, 129.257, 96.764], ['A', ' CD2', 141.259, 130.478, 96.493], ['A', ' NE1', 142.658, 129.671, 97.978], ['A', ' CE2', 141.571, 130.414, 97.844], ['A', ' CE3', 140.186, 131.209, 96.09], ['A', ' CZ2', 140.842, 131.051, 98.779], ['A', ' CZ3', 139.447, 131.843, 97.035], ['A', ' CH2', 139.77, 131.77, 98.349], ['A', ' H ', 142.317, 126.832, 94.356], ['A', ' HA ', 140.284, 128.833, 94.021], ['A', ' HB ', 143.262, 129.008, 94.142], ['A', ' HB ', 142.352, 130.456, 93.832], ['A', ' HD1', 143.907, 128.672, 96.6], ['A', ' HE1', 143.132, 129.455, 98.868], ['A', ' HE3', 139.919, 131.272, 95.034], ['A', ' HZ2', 141.097, 131.0, 99.836], ['A', ' HZ3', 138.593, 132.401, 96.698], ['A', ' HH2', 139.175, 132.292, 99.072]] AA_SCO= 2.537894736842105 CA_SCO= 1.632315789473684
[['A', ' N ', 142.309, 128.332, 91.43], ['A', ' CA ', 142.482, 128.573, 90.004], ['A', ' C ', 141.578, 127.8, 89.037], ['A', ' O ', 141.227, 128.342, 87.988], ['A', ' CB ', 143.926, 128.378, 89.636], ['A', ' CG ', 144.755, 129.504, 90.121], ['A', ' OD1', 144.266, 130.634, 90.257], ['A', ' ND2', 145.984, 129.255, 90.384], ['A', ' H ', 142.995, 127.749, 91.924], ['A', ' HA ', 142.252, 129.625, 89.838], ['A', ' HB ', 144.289, 127.448, 90.085], ['A', ' HB ', 144.032, 128.291, 88.557], ['A', ' HD2', 146.586, 130.006, 90.706], ['A', ' HD2', 146.363, 128.336, 90.28]] AA_SCO= 2.50578947368421 CA_SCO= 1.6323684210526312
[['A', ' N ', 141.115, 126.598, 89.365], ['A', ' CA ', 140.293, 125.877, 88.382], ['A', ' C ', 139.12, 126.669, 87.784], ['A', ' O ', 138.948, 126.627, 86.56], ['A', ' CB ', 139.848, 124.48, 88.875], ['A', ' CG1', 141.06, 123.537, 88.919], ['A', ' CG2', 138.76, 123.946, 87.988], ['A', ' CD1', 140.829, 122.234, 89.665], ['A', ' H ', 141.437, 126.15, 90.23], ['A', ' HA ', 140.918, 125.669, 87.543], ['A', ' HB ', 139.484, 124.534, 89.887], ['A', ' HG1', 141.339, 123.289, 87.9], ['A', ' HG1', 141.884, 124.054, 89.375], ['A', ' HG2', 138.45, 122.986, 88.337], ['A', ' HG2', 137.886, 124.593, 87.988], ['A', ' HG2', 139.135, 123.862, 86.975], ['A', ' HD1', 141.736, 121.64, 89.637], ['A', ' HD1', 140.573, 122.45, 90.699], ['A', ' HD1', 140.031, 121.667, 89.206]] AA_SCO= 2.438421052631579 CA_SCO= 1.6357368421052627
[['A', ' N ', 138.294, 127.373, 88.564], ['A', ' CA ', 137.174, 128.181, 88.128], ['A', ' C ', 137.584, 129.348, 87.226], ['A', ' O ', 136.739, 129.951, 86.569], ['A', ' CB ', 136.634, 128.712, 89.446], ['A', ' CG ', 137.13, 127.762, 90.455], ['A', ' CD ', 138.432, 127.35, 90.0], ['A', ' HA ', 136.435, 127.538, 87.627], ['A', ' HB ', 136.994, 129.724, 89.613], ['A', ' HB ', 135.539, 128.754, 89.424], ['A', ' HG ', 137.227, 128.249, 91.435], ['A', ' HG ', 136.446, 126.933, 90.563], ['A', ' HD ', 139.154, 128.085, 90.344], ['A', ' HD ', 138.609, 126.382, 90.405]] AA_SCO= 2.436315789473684 CA_SCO= 1.63978947368421
[['A', ' N ', 138.87, 129.691, 87.218], ['A', ' CA ', 139.376, 130.783, 86.414], ['A', ' C ', 140.068, 130.236, 85.185], ['A', ' O ', 140.11, 130.89, 84.141], ['A', ' CB ', 140.378, 131.639, 87.222], ['A', ' OG1', 139.735, 132.142, 88.387], ['A', ' CG2', 140.872, 132.814, 86.406], ['A', ' H ', 139.556, 129.173, 87.755], ['A', ' HA ', 138.542, 131.404, 86.093], ['A', ' HB ', 141.229, 131.023, 87.525], ['A', ' HG1', 139.688, 131.434, 89.042], ['A', ' HG2', 141.551, 133.395, 87.01], ['A', ' HG2', 141.396, 132.473, 85.519], ['A', ' HG2', 140.03, 133.437, 86.113]] AA_SCO= 2.4368421052631577 CA_SCO= 1.7122631578947365
[['A', ' N ', 140.627, 129.031, 85.293], ['A', ' CA ', 141.349, 128.453, 84.175], ['A', ' C ', 140.46, 128.05, 83.024], ['A', ' O ', 140.795, 128.292, 81.88], ['A', ' CB ', 142.127, 127.232, 84.611], ['A', ' CG ', 143.277, 127.54, 85.451], ['A', ' SD ', 144.355, 126.152, 85.708], ['A', ' CE ', 143.479, 125.214, 86.879], ['A', ' H ', 140.583, 128.54, 86.185], ['A', ' HA ', 142.049, 129.2, 83.806], ['A', ' HB ', 141.456, 126.58, 85.168], ['A', ' HB ', 142.467, 126.689, 83.759], ['A', ' HG ', 143.803, 128.309, 84.987], ['A', ' HG ', 142.952, 127.902, 86.399], ['A', ' HE ', 144.004, 124.322, 87.111], ['A', ' HE ', 143.337, 125.792, 87.781], ['A', ' HE ', 142.554, 124.948, 86.463]] AA_SCO= 2.476842105263158 CA_SCO= 1.7305789473684208
[['A', ' N ', 139.298, 127.484, 83.299], ['A', ' CA ', 138.44, 127.04, 82.194], ['A', ' C ', 138.231, 128.128, 81.141], ['A', ' O ', 138.649, 127.971, 79.99], ['A', ' H ', 139.057, 127.299, 84.281], ['A', ' HA ', 138.909, 126.192, 81.708], ['A', ' HA ', 137.493, 126.683, 82.578]] AA_SCO= 2.512631578947368 CA_SCO= 1.7421052631578948
[['A', ' N ', 137.642, 129.261, 81.52], ['A', ' CA ', 137.328, 130.407, 80.697], ['A', ' C ', 138.555, 131.097, 80.116], ['A', ' O ', 138.441, 131.946, 79.239], ['A', ' CB ', 136.625, 131.342, 81.674], ['A', ' CG ', 136.121, 130.457, 82.764], ['A', ' CD ', 137.148, 129.403, 82.901], ['A', ' HA ', 136.643, 130.086, 79.9], ['A', ' HB ', 137.332, 132.086, 82.043], ['A', ' HB ', 135.822, 131.886, 81.148], ['A', ' HG ', 135.99, 131.029, 83.699], ['A', ' HG ', 135.133, 130.05, 82.495], ['A', ' HD ', 137.924, 129.756, 83.561], ['A', ' HD ', 136.649, 128.516, 83.282]] AA_SCO= 2.641578947368421 CA_SCO= 1.8107894736842105
[['A', ' N ', 139.739, 130.766, 80.599], ['A', ' CA ', 140.951, 131.423, 80.166], ['A', ' C ', 141.306, 131.071, 78.744], ['A', ' O ', 142.155, 131.724, 78.13], ['A', ' CB ', 142.081, 131.039, 81.092], ['A', ' H ', 139.863, 129.995, 81.253], ['A', ' HA ', 140.782, 132.495, 80.219], ['A', ' HB ', 142.977, 131.571, 80.804], ['A', ' HB ', 141.831, 131.278, 82.107], ['A', ' HB ', 142.244, 129.979, 81.026]] AA_SCO= 2.662631578947368 CA_SCO= 1.8323157894736841
[['A', ' N ', 140.694, 130.02, 78.218], ['A', ' CA ', 140.997, 129.578, 76.876], ['A', ' C ', 140.088, 130.267, 75.841], ['A', ' O ', 140.306, 130.141, 74.63], ['A', ' CB ', 140.844, 128.056, 76.784], ['A', ' OG1', 139.48, 127.688, 76.959], ['A', ' CG2', 141.654, 127.413, 77.935], ['A', ' H ', 140.005, 129.488, 78.77], ['A', ' HA ', 142.031, 129.837, 76.65], ['A', ' HB ', 141.198, 127.705, 75.815], ['A', ' HG1', 139.361, 126.771, 76.694], ['A', ' HG2', 141.562, 126.333, 77.888], ['A', ' HG2', 142.688, 127.687, 77.842], ['A', ' HG2', 141.282, 127.759, 78.901]] AA_SCO= 2.6810526315789467 CA_SCO= 1.8156315789473685
[['A', ' N ', 139.067, 130.973, 76.315], ['A', ' CA ', 138.076, 131.556, 75.428], ['A', ' C ', 138.674, 132.694, 74.611], ['A', ' O ', 139.464, 133.501, 75.1], ['A', ' CB ', 136.881, 132.029, 76.256], ['A', ' CG ', 136.115, 130.873, 76.925], ['A', ' CD ', 134.99, 131.316, 77.862], ['A', ' OE1', 134.795, 132.494, 78.001], ['A', ' OE2', 134.333, 130.455, 78.459], ['A', ' H ', 138.963, 131.119, 77.323], ['A', ' HA ', 137.734, 130.789, 74.736], ['A', ' HB ', 137.22, 132.713, 77.034], ['A', ' HB ', 136.184, 132.568, 75.615], ['A', ' HG ', 135.696, 130.27, 76.135], ['A', ' HG ', 136.818, 130.25, 77.471]] AA_SCO= 2.5984210526315783 CA_SCO= 1.8155789473684212
[['A', ' N ', 138.263, 132.764, 73.352], ['A', ' CA ', 138.678, 133.785, 72.405], ['A', ' C ', 139.847, 133.338, 71.539], ['A', ' O ', 140.197, 134.006, 70.567], ['A', ' H ', 137.609, 132.06, 73.025], ['A', ' HA ', 137.833, 134.042, 71.766], ['A', ' HA ', 138.955, 134.686, 72.947]] AA_SCO= 2.5568421052631574 CA_SCO= 1.7602631578947368
[['A', ' N ', 140.436, 132.196, 71.866], ['A', ' CA ', 141.581, 131.687, 71.134], ['A', ' C ', 141.386, 130.32, 70.537], ['A', ' O ', 140.519, 129.553, 70.95], ['A', ' CB ', 142.8, 131.715, 72.031], ['A', ' CG ', 143.207, 133.097, 72.321], ['A', ' CD1', 142.658, 133.809, 73.369], ['A', ' CD2', 144.149, 133.707, 71.524], ['A', ' CE1', 143.039, 135.098, 73.59], ['A', ' CE2', 144.528, 134.99, 71.757], ['A', ' CZ ', 143.974, 135.684, 72.778], ['A', ' H ', 140.118, 131.671, 72.689], ['A', ' HA ', 141.777, 132.369, 70.308], ['A', ' HB ', 142.568, 131.215, 72.976], ['A', ' HB ', 143.629, 131.183, 71.567], ['A', ' HD1', 141.906, 133.344, 74.017], ['A', ' HD2', 144.592, 133.155, 70.695], ['A', ' HE1', 142.6, 135.668, 74.417], ['A', ' HE2', 145.264, 135.477, 71.125], ['A', ' HZ ', 144.284, 136.717, 72.947]] AA_SCO= 2.5747368421052634 CA_SCO= 1.782842105263158
[['A', ' N ', 142.19, 130.012, 69.529], ['A', ' CA ', 142.121, 128.703, 68.909], ['A', ' C ', 142.359, 127.676, 69.99], ['A', ' O ', 143.259, 127.842, 70.818], ['A', ' CB ', 143.148, 128.567, 67.8], ['A', ' CG ', 142.968, 127.357, 66.981], ['A', ' ND1', 143.318, 126.099, 67.413], ['A', ' CD2', 142.489, 127.207, 65.731], ['A', ' CE1', 143.059, 125.227, 66.464], ['A', ' NE2', 142.558, 125.871, 65.429], ['A', ' H ', 142.864, 130.687, 69.198], ['A', ' HA ', 141.152, 128.519, 68.48], ['A', ' HB ', 143.092, 129.434, 67.144], ['A', ' HB ', 144.147, 128.541, 68.224], ['A', ' HD2', 142.122, 128.001, 65.079], ['A', ' HE1', 143.24, 124.155, 66.522], ['A', ' HE2', 142.273, 125.452, 64.551]] AA_SCO= 2.5500000000000003 CA_SCO= 1.7826842105263163
[['A', ' N ', 141.592, 126.593, 69.96], ['A', ' CA ', 141.65, 125.558, 70.978], ['A', ' C ', 143.027, 124.973, 71.181], ['A', ' O ', 143.333, 124.527, 72.287], ['A', ' CB ', 140.673, 124.421, 70.701], ['A', ' CG ', 141.019, 123.555, 69.58], ['A', ' ND1', 141.83, 122.453, 69.727], ['A', ' CD2', 140.629, 123.565, 68.295], ['A', ' CE1', 141.939, 121.837, 68.574], ['A', ' NE2', 141.217, 122.488, 67.686], ['A', ' H ', 140.883, 126.516, 69.237], ['A', ' HA ', 141.358, 125.998, 71.928], ['A', ' HB ', 140.574, 123.806, 71.58], ['A', ' HB ', 139.7, 124.846, 70.499], ['A', ' HD2', 139.967, 124.282, 67.828], ['A', ' HE1', 142.52, 120.934, 68.387], ['A', ' HE2', 141.107, 122.234, 66.714]] AA_SCO= 2.5563157894736843 CA_SCO= 1.7850000000000004
[['A', ' N ', 143.909, 125.031, 70.183], ['A', ' CA ', 145.248, 124.479, 70.344], ['A', ' C ', 146.019, 125.189, 71.449], ['A', ' O ', 147.017, 124.668, 71.942], ['A', ' CB ', 146.06, 124.575, 69.057], ['A', ' CG ', 146.488, 125.989, 68.653], ['A', ' CD ', 147.19, 125.997, 67.33], ['A', ' OE1', 147.626, 124.946, 66.918], ['A', ' OE2', 147.271, 127.027, 66.708], ['A', ' H ', 143.643, 125.407, 69.265], ['A', ' HA ', 145.15, 123.427, 70.614], ['A', ' HB ', 146.963, 123.974, 69.157], ['A', ' HB ', 145.48, 124.158, 68.236], ['A', ' HG ', 145.636, 126.65, 68.624], ['A', ' HG ', 147.176, 126.378, 69.402]] AA_SCO= 2.5868421052631576 CA_SCO= 1.785421052631579
[['A', ' N ', 145.586, 126.388, 71.831], ['A', ' CA ', 146.248, 127.135, 72.872], ['A', ' C ', 145.666, 126.844, 74.233], ['A', ' O ', 146.263, 127.179, 75.258], ['A', ' CB ', 146.148, 128.618, 72.616], ['A', ' CG ', 146.903, 129.066, 71.457], ['A', ' CD1', 146.245, 129.446, 70.325], ['A', ' CD2', 148.272, 129.084, 71.513], ['A', ' CE1', 146.959, 129.854, 69.236], ['A', ' CE2', 148.988, 129.485, 70.43], ['A', ' CZ ', 148.34, 129.87, 69.293], ['A', ' OH ', 149.067, 130.279, 68.201], ['A', ' H ', 144.753, 126.787, 71.39], ['A', ' HA ', 147.282, 126.844, 72.883], ['A', ' HB ', 145.1, 128.893, 72.474], ['A', ' HB ', 146.499, 129.13, 73.468], ['A', ' HD1', 145.159, 129.424, 70.289], ['A', ' HD2', 148.782, 128.776, 72.423], ['A', ' HE1', 146.442, 130.157, 68.327], ['A', ' HE2', 150.075, 129.503, 70.462], ['A', ' HH ', 150.006, 130.216, 68.395]] AA_SCO= 2.420526315789474 CA_SCO= 1.7762631578947365
[['A', ' N ', 144.526, 126.182, 74.266], ['A', ' CA ', 143.836, 125.89, 75.499], ['A', ' C ', 144.789, 125.276, 76.506], ['A', ' O ', 144.854, 125.726, 77.655], ['A', ' H ', 144.121, 125.829, 73.401], ['A', ' HA ', 143.444, 126.82, 75.89], ['A', ' HA ', 142.987, 125.238, 75.312]] AA_SCO= 2.4121052631578945 CA_SCO= 1.7666842105263159
[['A', ' N ', 145.453, 124.169, 76.152], ['A', ' CA ', 146.412, 123.475, 76.964], ['A', ' C ', 147.607, 124.328, 77.388], ['A', ' O ', 148.254, 124.006, 78.376], ['A', ' CB ', 146.841, 122.328, 76.054], ['A', ' CG ', 145.674, 122.114, 75.138], ['A', ' CD ', 145.148, 123.475, 74.881], ['A', ' HA ', 145.901, 123.062, 77.837], ['A', ' HB ', 147.757, 122.611, 75.512], ['A', ' HB ', 147.079, 121.441, 76.657], ['A', ' HG ', 146.0, 121.607, 74.216], ['A', ' HG ', 144.932, 121.461, 75.617], ['A', ' HD ', 145.714, 123.895, 74.044], ['A', ' HD ', 144.074, 123.415, 74.674]] AA_SCO= 2.450526315789473 CA_SCO= 1.8112631578947365
[['A', ' N ', 147.939, 125.406, 76.667], ['A', ' CA ', 149.065, 126.219, 77.092], ['A', ' C ', 148.61, 127.097, 78.217], ['A', ' O ', 149.369, 127.406, 79.139], ['A', ' CB ', 149.604, 127.125, 75.983], ['A', ' CG ', 150.424, 126.465, 74.943], ['A', ' ND1', 151.679, 125.976, 75.206], ['A', ' CD2', 150.204, 126.233, 73.638], ['A', ' CE1', 152.19, 125.471, 74.105], ['A', ' NE2', 151.314, 125.612, 73.142], ['A', ' H ', 147.417, 125.725, 75.858], ['A', ' HA ', 149.875, 125.587, 77.45], ['A', ' HB ', 148.769, 127.621, 75.486], ['A', ' HB ', 150.205, 127.901, 76.443], ['A', ' HD2', 149.34, 126.482, 73.069], ['A', ' HE1', 153.169, 125.011, 74.007], ['A', ' HE2', 151.431, 125.316, 72.181]] AA_SCO= 2.458947368421052 CA_SCO= 1.791736842105263
[['A', ' N ', 147.35, 127.484, 78.156], ['A', ' CA ', 146.82, 128.367, 79.157], ['A', ' C ', 146.685, 127.668, 80.478], ['A', ' O ', 147.157, 128.176, 81.497], ['A', ' CB ', 145.444, 128.876, 78.725], ['A', ' CG1', 144.816, 129.645, 79.785], ['A', ' CG2', 145.546, 129.734, 77.512], ['A', ' H ', 146.775, 127.185, 77.36], ['A', ' HA ', 147.501, 129.184, 79.288], ['A', ' HB ', 144.821, 128.029, 78.508], ['A', ' HG1', 143.87, 129.948, 79.397], ['A', ' HG1', 144.671, 129.05, 80.684], ['A', ' HG1', 145.423, 130.518, 80.023], ['A', ' HG2', 144.55, 130.063, 77.216], ['A', ' HG2', 146.134, 130.583, 77.736], ['A', ' HG2', 145.995, 129.18, 76.702]] AA_SCO= 2.318421052631579 CA_SCO= 1.4710000000000005
[['A', ' N ', 146.085, 126.487, 80.473], ['A', ' CA ', 145.917, 125.827, 81.751], ['A', ' C ', 147.268, 125.387, 82.292], ['A', ' O ', 147.489, 125.404, 83.497], ['A', ' CB ', 144.905, 124.659, 81.681], ['A', ' CG1', 145.411, 123.551, 80.75], ['A', ' CG2', 143.541, 125.206, 81.184], ['A', ' CD1', 144.636, 122.272, 80.783], ['A', ' H ', 145.723, 126.111, 79.589], ['A', ' HA ', 145.501, 126.549, 82.452], ['A', ' HB ', 144.781, 124.234, 82.681], ['A', ' HG1', 145.382, 123.943, 79.754], ['A', ' HG1', 146.423, 123.28, 80.993], ['A', ' HG2', 142.803, 124.42, 81.161], ['A', ' HG2', 143.205, 125.978, 81.846], ['A', ' HG2', 143.652, 125.625, 80.182], ['A', ' HD1', 145.074, 121.569, 80.075], ['A', ' HD1', 144.695, 121.856, 81.784], ['A', ' HD1', 143.608, 122.434, 80.523]] AA_SCO= 2.371052631578947 CA_SCO= 1.4332105263157893
[['A', ' N ', 148.197, 125.06, 81.405], ['A', ' CA ', 149.525, 124.658, 81.79], ['A', ' C ', 150.3, 125.806, 82.427], ['A', ' O ', 150.974, 125.613, 83.432], ['A', ' CB ', 150.209, 124.132, 80.568], ['A', ' CG ', 151.511, 123.548, 80.712], ['A', ' CD ', 152.036, 123.214, 79.361], ['A', ' NE ', 151.146, 122.3, 78.634], ['A', ' CZ ', 150.966, 122.287, 77.289], ['A', ' NH1', 151.599, 123.139, 76.515], ['A', ' NH2', 150.142, 121.403, 76.751], ['A', ' H ', 147.981, 125.04, 80.407], ['A', ' HA ', 149.434, 123.857, 82.514], ['A', ' HB ', 149.586, 123.337, 80.195], ['A', ' HB ', 150.258, 124.908, 79.808], ['A', ' HG ', 152.141, 124.275, 81.186], ['A', ' HG ', 151.465, 122.644, 81.312], ['A', ' HD ', 152.142, 124.134, 78.793], ['A', ' HD ', 153.012, 122.727, 79.45], ['A', ' HE ', 150.632, 121.623, 79.174], ['A', ' HH1', 152.239, 123.818, 76.918], ['A', ' HH1', 151.473, 123.108, 75.517], ['A', ' HH2', 149.639, 120.757, 77.34], ['A', ' HH2', 150.012, 121.379, 75.75]] AA_SCO= 2.373157894736842 CA_SCO= 0.737
[['A', ' N ', 150.154, 127.026, 81.902], ['A', ' CA ', 150.843, 128.206, 82.434], ['A', ' C ', 150.504, 128.443, 83.9], ['A', ' O ', 151.366, 128.878, 84.674], ['A', ' CB ', 150.47, 129.431, 81.624], ['A', ' H ', 149.621, 127.136, 81.036], ['A', ' HA ', 151.914, 128.037, 82.354], ['A', ' HB ', 151.002, 130.301, 81.997], ['A', ' HB ', 150.736, 129.259, 80.584], ['A', ' HB ', 149.395, 129.601, 81.701]] AA_SCO= 2.2431578947368425 CA_SCO= 0.6254736842105263
[['A', ' N ', 149.278, 128.114, 84.289], ['A', ' CA ', 148.84, 128.271, 85.669], ['A', ' C ', 149.501, 127.27, 86.603], ['A', ' O ', 149.57, 127.493, 87.816], ['A', ' CB ', 147.337, 128.135, 85.782], ['A', ' CG ', 146.569, 129.321, 85.381], ['A', ' CD1', 145.99, 129.383, 84.153], ['A', ' CD2', 146.414, 130.344, 86.267], ['A', ' CE1', 145.245, 130.473, 83.791], ['A', ' CE2', 145.684, 131.432, 85.921], ['A', ' CZ ', 145.093, 131.507, 84.693], ['A', ' OH ', 144.371, 132.622, 84.346], ['A', ' H ', 148.606, 127.813, 83.57], ['A', ' HA ', 149.12, 129.273, 85.995], ['A', ' HB ', 147.028, 127.32, 85.141], ['A', ' HB ', 147.062, 127.876, 86.804], ['A', ' HD1', 146.112, 128.565, 83.478], ['A', ' HD2', 146.877, 130.292, 87.253], ['A', ' HE1', 144.781, 130.516, 82.808], ['A', ' HE2', 145.572, 132.244, 86.626], ['A', ' HH ', 144.531, 133.348, 84.998]] AA_SCO= 1.9942105263157894 CA_SCO= 0.37521052631578955
[['A', ' N ', 149.973, 126.168, 86.052], ['A', ' CA ', 150.602, 125.065, 86.754], ['A', ' C ', 149.772, 124.526, 87.918], ['A', ' O ', 150.145, 124.725, 89.072], ['A', ' CB ', 151.95, 125.495, 87.297], ['A', ' CG ', 152.951, 124.361, 87.533], ['A', ' OD1', 153.004, 123.414, 86.743], ['A', ' OD2', 153.751, 124.489, 88.43], ['A', ' H ', 149.97, 126.092, 85.035], ['A', ' HA ', 150.77, 124.268, 86.041], ['A', ' HB ', 152.383, 126.199, 86.607], ['A', ' HB ', 151.81, 126.008, 88.237]] AA_SCO= 2.0011111111111113 CA_SCO= 0.29455555555555574
[['A', ' N ', 148.552, 124.054, 87.711], ['A', ' CA ', 147.742, 123.436, 88.725], ['A', ' C ', 148.271, 122.068, 89.079], ['A', ' O ', 148.939, 121.445, 88.267], ['A', ' CB ', 146.409, 123.36, 88.049], ['A', ' CG ', 146.753, 123.3, 86.576], ['A', ' CD ', 147.853, 124.259, 86.452], ['A', ' HA ', 147.702, 124.086, 89.615], ['A', ' HB ', 145.858, 122.539, 88.435], ['A', ' HB ', 145.853, 124.26, 88.316], ['A', ' HG ', 147.102, 122.296, 86.306], ['A', ' HG ', 145.9, 123.525, 85.928], ['A', ' HD ', 148.43, 124.085, 85.588], ['A', ' HD ', 147.416, 125.256, 86.43]] AA_SCO= 1.9294117647058826 CA_SCO= 0.19905882352941198
[['A', ' N ', 147.959, 121.585, 90.273], ['A', ' CA ', 148.344, 120.24, 90.668], ['A', ' C ', 147.335, 119.179, 90.244], ['A', ' O ', 147.684, 118.034, 89.972], ['A', ' CB ', 148.573, 120.253, 92.13], ['A', ' SG ', 150.024, 121.162, 92.556], ['A', ' H ', 147.432, 122.145, 90.94], ['A', ' HA ', 149.294, 120.006, 90.19], ['A', ' HB ', 147.739, 120.701, 92.619], ['A', ' HB ', 148.637, 119.31, 92.486], ['A', ' HG ', 150.137, 120.684, 93.806]] AA_SCO= 1.8725000000000003 CA_SCO= 0.11300000000000021
[['A', ' N ', 146.076, 119.567, 90.199], ['A', ' CA ', 144.946, 118.781, 89.697], ['A', ' C ', 144.767, 117.401, 90.299], ['A', ' O ', 143.859, 117.153, 91.097], ['A', ' CB ', 145.187, 118.616, 88.21], ['A', ' CG ', 145.326, 119.897, 87.458], ['A', ' CD1', 145.766, 119.575, 86.076], ['A', ' CD2', 144.036, 120.719, 87.502], ['A', ' H ', 145.899, 120.511, 90.494], ['A', ' HA ', 144.03, 119.331, 89.886], ['A', ' HB ', 146.099, 118.059, 88.035], ['A', ' HB ', 144.37, 118.038, 87.782], ['A', ' HG ', 146.122, 120.456, 87.893], ['A', ' HD1', 145.942, 120.472, 85.509], ['A', ' HD1', 146.691, 119.009, 86.121], ['A', ' HD1', 145.033, 118.999, 85.609], ['A', ' HD2', 144.213, 121.623, 86.967], ['A', ' HD2', 143.22, 120.184, 87.052], ['A', ' HD2', 143.771, 120.973, 88.512]] AA_SCO= 1.802 CA_SCO= 0.03193333333333343
[['A', ' N ', 145.674, 116.494, 89.952], ['A', ' CA ', 145.615, 115.122, 90.486], ['A', ' C ', 145.794, 115.093, 91.987], ['A', ' O ', 145.161, 114.296, 92.692], ['A', ' CB ', 146.721, 114.28, 89.917], ['A', ' OG ', 147.944, 114.716, 90.435], ['A', ' H ', 146.437, 116.784, 89.347], ['A', ' HA ', 144.662, 114.687, 90.245], ['A', ' HB ', 146.546, 113.244, 90.188], ['A', ' HB ', 146.734, 114.341, 88.858], ['A', ' HG ', 148.629, 114.201, 90.001]] AA_SCO= 1.7035714285714287 CA_SCO= -0.1062142857142857
[['A', ' N ', 146.585, 116.052, 92.466], ['A', ' CA ', 146.938, 116.347, 93.8], ['A', ' C ', 146.474, 117.742, 93.935], ['A', ' O ', 147.183, 118.611, 94.441], ['A', ' CB ', 148.44, 116.089, 94.035], ['A', ' SG ', 149.745, 117.04, 93.045], ['A', ' H ', 147.061, 116.592, 91.72], ['A', ' HA ', 146.371, 115.724, 94.498], ['A', ' HB ', 148.58, 116.274, 94.995], ['A', ' HB ', 148.648, 115.023, 93.902]] AA_SCO= 1.6515384615384614 CA_SCO= -0.18507692307692308
[['A', ' N ', 145.254, 117.997, 93.428], ['A', ' CA ', 144.808, 119.338, 93.503], ['A', ' C ', 145.069, 119.716, 94.878], ['A', ' O ', 144.567, 119.135, 95.845], ['A', ' CB ', 143.331, 119.501, 93.185], ['A', ' H ', 144.68, 117.281, 92.98], ['A', ' HA ', 145.413, 119.955, 92.851], ['A', ' HB ', 143.045, 120.54, 93.315], ['A', ' HB ', 143.128, 119.205, 92.171], ['A', ' HB ', 142.751, 118.88, 93.862]] AA_SCO= 1.6116666666666666 CA_SCO= -0.36341666666666655
[['A', ' N ', 145.815, 120.75, 94.97], ['A', ' CA ', 146.169, 121.297, 96.208], ['A', ' C ', 144.94, 122.081, 96.527], ['A', ' O ', 144.927, 123.27, 96.193], ['A', ' CB ', 147.397, 122.179, 96.036], ['A', ' OG1', 147.117, 123.163, 95.003], ['A', ' CG2', 148.553, 121.352, 95.686], ['A', ' H ', 146.197, 121.161, 94.135], ['A', ' HA ', 146.358, 120.515, 96.943], ['A', ' HB ', 147.646, 122.655, 96.914], ['A', ' HG1', 146.34, 123.718, 95.298], ['A', ' HG2', 149.397, 121.984, 95.566], ['A', ' HG2', 148.73, 120.643, 96.473], ['A', ' HG2', 148.354, 120.829, 94.802]] AA_SCO= 1.4954545454545454 CA_SCO= -0.5746363636363636
[['A', ' N ', 143.889, 121.364, 97.052], ['A', ' CA ', 142.487, 121.735, 97.354], ['A', ' C ', 142.158, 123.233, 97.22], ['A', ' O ', 142.44, 123.842, 96.187], ['A', ' OXT', 141.379, 123.775, 97.997], ['A', ' CB ', 142.072, 121.169, 98.769], ['A', ' CG ', 142.089, 119.613, 98.853], ['A', ' ND1', 141.222, 118.823, 98.127], ['A', ' CD2', 142.871, 118.758, 99.563], ['A', ' CE1', 141.478, 117.548, 98.386], ['A', ' NE2', 142.472, 117.485, 99.255], ['A', ' H ', 144.122, 120.38, 97.205], ['A', ' HA ', 141.858, 121.237, 96.623], ['A', ' HB ', 142.734, 121.579, 99.544], ['A', ' HB ', 141.056, 121.498, 99.029], ['A', ' HD2', 143.666, 119.031, 100.247], ['A', ' HE1', 140.956, 116.694, 97.954], ['A', ' HE2', 142.876, 116.647, 99.627]] AA_SCO= 1.3719999999999999 CA_SCO= -0.8291000000000001
INFO : DeepMainmast Computation Done with FullAtom Model
INFO : DeepMainMast Done