DeepMainMast

Job ID : 3d83f65e81bc6c3fac4780f90df9395a

DeepMainmast is a de novo modeling protocol designed to construct an entire protein 3D model directly from an EM map with a resolution of 0-5 A. It generates a file in .pdb format that documents the modeled protein structure derived from the input cryo-EM map. In cases where the cryo-EM map contains DNA/RNA, only the protein structures within the complex are modeled. For modeling the complete complex, we recommend using ComplexModeler (https://em.kiharalab.org/algorithm/ComplexModeler).

Our results webpage comprises three tabs: Results Visualization, Output Logs, and Job Configuration.

Results Visualization:
The "Result Visualization" panel showcases the protein structure generated by DeepMainMast.
On the right-hand side, you'll find the "Download Outputs" button enabling you to download the modeled structure in .pdb format. This file contains four structures (details outlined below). You can visualize or refine this structure using tools like PyMol, Coot, or Chimera. The downloaded .pdb file includes four structures consolidated into one file, each structure's specifics detailed below.
Additionally, you can visualize the map online by clicking the "Show map" button. Once loaded, the default contour level matches your input; however, you can make adjustments by clicking the "..." button beside "isosurface." Within the "Type: Isosurface" option, you can modify the iso-surface value and opacity by scrolling through the bar for precise adjustments. This feature allows you to assess the alignment between the modeled structure and the map.

The output 3D model displays coloration based on the DAQ (AA) score, ranging from red (-1.0) to blue (1.0), signifying the structural quality. Blue highlights well-modeled regions, while red indicates areas potentially less reliable. This 3D model includes either four models (with Rosetta) or two models (without Rosetta).

MODEL1: Ca-only structure, where all modeled positions are colored by the DAQ (AA) score.
MODEL2: Ca-only structure, excluding amino acids with a DAQ (CA) score below -0.5 and replacing amino acids with a DAQ (AA) score below -0.5 with 'UNK'.
MODEL3: Full-atomic structure displaying all modeled positions colored by the DAQ (AA) score. Rosetta is used to build the full atom model.
MODEL4: Full-atomic structure excluding amino acids with a DAQ (CA) score below -0.5 and replacing amino acids with a DAQ (AA) score below -0.5 with 'UNK'. Rosetta is used.

These distinctions enable detailed exploration and comparison of the models, providing insights into specific structural aspects based on the DAQ scores.
Output Logs:
The 'Output Logs' panel compiles all outputs generated by the scripts.
If you're interested in monitoring the job's progress during execution, this section provides a comprehensive overview.

Job Configuration:
In the 'Job Configuration' panel, you'll find the input parameters used for this specific job. These records serve to maintain a log of your submitted input for reference.

Problem Debugging:
For any troubleshooting needs: Should you encounter any issues, please don't hesitate to contact us via email to report the problems. When sending an email, kindly use the subject line format 'DeepMainMast problem: [jobid]', where [jobid] corresponds to the job displayed in the title. This specific identification helps us efficiently locate and debug jobs in the backend, ensuring a prompt response to your concerns.

Contact:
dkihara@purdue.edu, gterashi@purdue.edu, xiaowang20140001@gmail.com.

The 3D model is colored by DAQ(AA) score scaled from red (-1.0) to blue (1.0) with a 19 residues sliding window.
The 3D model contains two MODELs (MODEL1 and MODEL2).
In MODEL1, all modeled positions are colored by DAQ(AA) score.
In MODEL2, amino acids with DAQ(CA) score below -0.5 are excluded, and amino acids with DAQ(AA) score below -0.5 are replaced with UNK.

Download Outputs

DeepMainMast CPU started
rosetta_bin_linux_2021.16.61629_bundle -s

input_resize.mrc
input.fasta
Option -c: 0

Option -t: 896
Option -T: 896
Option MAX Threads -C: 8
Option Max SubThreads: 8
rosetta_bin_linux_2021.16.61629_bundle
initial CA model

input_resize.mrc
input.fasta
#CONTOUR: 0

#TIME_TRACE: 896
#TIME_Assemble: 896
#MAX_Threads: 8
rosetta_bin_linux_2021.16.61629_bundle
rosetta_bin_linux_2021.16.61629_bundle
max_jobs: 8
NODE_p0.5.pdb
NODE_p0.3.pdb
NODE_p0.4.pdb
NODE_p0.5.pdb
INFO : C-alpha Node computing Done
max_jobs: 8
PATH_p0.5Nch40.log
PATH_p0.3Nch5.log
PATH_p0.3Nch10.log
PATH_p0.3Nch20.log
PATH_p0.3Nch40.log
PATH_p0.4Nch5.log
PATH_p0.4Nch10.log
PATH_p0.4Nch20.log
PATH_p0.4Nch40.log
PATH_p0.5Nch5.log
PATH_p0.5Nch10.log
PATH_p0.5Nch20.log
PATH_p0.5Nch40.log
INFO : Path Tracing by VRP Done
max_jobs: 8
INP_p0.5Nch40Nali20.txt
INP_p0.3Nch5Nali5.txt
INP_p0.3Nch5Nali10.txt
INP_p0.3Nch5Nali20.txt
INP_p0.3Nch10Nali5.txt
INP_p0.3Nch10Nali10.txt
INP_p0.3Nch10Nali20.txt
INP_p0.3Nch20Nali5.txt
INP_p0.3Nch20Nali10.txt
INP_p0.3Nch20Nali20.txt
INP_p0.3Nch40Nali5.txt
INP_p0.3Nch40Nali10.txt
INP_p0.3Nch40Nali20.txt
INP_p0.4Nch5Nali5.txt
INP_p0.4Nch5Nali10.txt
INP_p0.4Nch5Nali20.txt
INP_p0.4Nch10Nali5.txt
INP_p0.4Nch10Nali10.txt
INP_p0.4Nch10Nali20.txt
INP_p0.4Nch20Nali5.txt
INP_p0.4Nch20Nali10.txt
INP_p0.4Nch20Nali20.txt
INP_p0.4Nch40Nali5.txt
INP_p0.4Nch40Nali10.txt
INP_p0.4Nch40Nali20.txt
INP_p0.5Nch5Nali5.txt
INP_p0.5Nch5Nali10.txt
INP_p0.5Nch5Nali20.txt
INP_p0.5Nch10Nali5.txt
INP_p0.5Nch10Nali10.txt
INP_p0.5Nch10Nali20.txt
INP_p0.5Nch20Nali5.txt
INP_p0.5Nch20Nali10.txt
INP_p0.5Nch20Nali20.txt
INP_p0.5Nch40Nali5.txt
INP_p0.5Nch40Nali10.txt
INP_p0.5Nch40Nali20.txt
INFO : generating INP file Done
max_jobs: 1
OUT_p0.5Nch40Nali20.log
OUT_p0.3Nch5Nali5.log
OUT_p0.3Nch5Nali10.log
OUT_p0.3Nch5Nali20.log
OUT_p0.3Nch10Nali5.log
OUT_p0.3Nch10Nali10.log
OUT_p0.3Nch10Nali20.log
OUT_p0.3Nch20Nali5.log
OUT_p0.3Nch20Nali10.log
OUT_p0.3Nch20Nali20.log
OUT_p0.3Nch40Nali5.log
OUT_p0.3Nch40Nali10.log
OUT_p0.3Nch40Nali20.log
OUT_p0.4Nch5Nali5.log
OUT_p0.4Nch5Nali10.log
OUT_p0.4Nch5Nali20.log
OUT_p0.4Nch10Nali5.log
OUT_p0.4Nch10Nali10.log
OUT_p0.4Nch10Nali20.log
OUT_p0.4Nch20Nali5.log
OUT_p0.4Nch20Nali10.log
OUT_p0.4Nch20Nali20.log
OUT_p0.4Nch40Nali5.log
OUT_p0.4Nch40Nali10.log
OUT_p0.4Nch40Nali20.log
OUT_p0.5Nch5Nali5.log
OUT_p0.5Nch5Nali10.log
OUT_p0.5Nch5Nali20.log
OUT_p0.5Nch10Nali5.log
OUT_p0.5Nch10Nali10.log
OUT_p0.5Nch10Nali20.log
OUT_p0.5Nch20Nali5.log
OUT_p0.5Nch20Nali10.log
OUT_p0.5Nch20Nali20.log
OUT_p0.5Nch40Nali5.log
OUT_p0.5Nch40Nali10.log
OUT_p0.5Nch40Nali20.log
INFO : Assembling Done
INFO : Combine All Models
max_jobs: 1
MTX_DMonly.txt
MTX_DMonly.txt
max_jobs: 1
COMBi_DMonly.log
COMBi_DMonly.log
INFO : Combine All Models Done
INFO : DAQ scoring for CA models
max_jobs: 8
COMBi_DMonly.daq
COMBi_DMonly.daq
INFO : DAQ scoring Done
WARNING: Use StructureBlurrer.gaussian_blur_real_space_box()to blured a map with a user defined defined cubic box
INFO : DOT scoring Done
INFO : CA modeling Done
COMBi_DMonly.pdb 2.1325782943938782
%s total different chains : {'A', 'B', 'C'}
[['A', ' CA ', 129.601, 123.821, 67.819]]
[['A', ' CA ', 131.684, 120.458, 68.483]]
[['A', ' CA ', 133.22, 120.582, 72.165]]
[['A', ' CA ', 136.707, 118.774, 71.884]]
[['A', ' CA ', 137.538, 117.526, 75.757]]
[['A', ' CA ', 141.271, 116.194, 76.008]]
[['A', ' CA ', 141.449, 114.049, 79.448]]
[['A', ' CA ', 144.979, 113.508, 80.689]]
[['A', ' CA ', 145.794, 117.064, 80.801]]
[['A', ' CA ', 149.613, 116.84, 79.485]]
[['A', ' CA ', 152.687, 117.833, 81.544]]
[['A', ' CA ', 150.93, 119.018, 84.963]]
[['A', ' CA ', 150.352, 116.895, 88.161]]
[['A', ' CA ', 147.584, 114.82, 88.696]]
[['A', ' CA ', 143.911, 114.471, 86.655]]
[['A', ' CA ', 141.856, 117.331, 84.938]]
[['A', ' CA ', 140.277, 117.332, 81.377]]
[['A', ' CA ', 139.254, 120.913, 79.948]]
[['A', ' CA ', 136.248, 120.221, 77.37]]
[['A', ' CA ', 136.178, 123.671, 75.373]]
[['A', ' CA ', 133.206, 123.831, 72.579]]
[['A', ' CA ', 134.763, 125.827, 69.851]]
[['A', ' CA ', 132.521, 127.35, 67.06]]
[['A', ' CA ', 133.032, 127.851, 61.944]]
[['A', ' CA ', 136.797, 128.341, 62.575]]
[['A', ' CA ', 137.869, 126.038, 65.861]]
[['A', ' CA ', 138.347, 129.666, 68.551]]
[['A', ' CA ', 136.775, 128.067, 71.709]]
[['A', ' CA ', 133.844, 130.716, 72.63]]
[['A', ' CA ', 133.303, 128.738, 76.86]]
[['A', ' CA ', 135.943, 125.883, 77.734]]
[['A', ' CA ', 135.709, 124.822, 81.805]]
[['A', ' CA ', 138.578, 122.893, 83.036]]
[['A', ' CA ', 137.409, 120.639, 85.849]]
[['A', ' CA ', 139.072, 118.019, 88.15]]
[['A', ' CA ', 138.799, 114.326, 87.36]]
[['A', ' CA ', 140.842, 113.147, 90.182]]
[['A', ' CA ', 139.878, 110.495, 92.706]]
[['A', ' CA ', 138.931, 112.071, 96.06]]
[['A', ' CA ', 141.521, 111.013, 98.751]]
[['A', ' CA ', 138.794, 112.387, 101.694]]
[['A', ' CA ', 142.208, 113.906, 103.487]]
[['A', ' CA ', 140.681, 116.978, 105.645]]
[['A', ' CA ', 137.342, 114.269, 107.075]]
[['A', ' CA ', 140.22, 111.176, 107.677]]
[['A', ' CA ', 142.649, 113.918, 110.074]]
[['A', ' CA ', 138.967, 115.835, 111.58]]
[['A', ' CA ', 137.946, 112.753, 114.296]]
[['A', ' CA ', 142.292, 111.89, 115.034]]
[['A', ' CA ', 144.543, 114.21, 117.445]]
[['A', ' CA ', 146.284, 117.28, 115.652]]
[['A', ' CA ', 150.304, 115.852, 115.149]]
[['A', ' CA ', 148.927, 113.067, 112.427]]
[['A', ' CA ', 146.827, 116.198, 110.296]]
[['A', ' CA ', 150.412, 118.14, 109.488]]
[['A', ' CA ', 151.87, 114.332, 107.777]]
[['A', ' CA ', 148.571, 113.046, 105.95]]
[['A', ' CA ', 147.779, 116.864, 104.881]]
[['A', ' CA ', 151.667, 116.856, 103.514]]
[['A', ' CA ', 150.814, 113.83, 101.395]]
[['A', ' CA ', 148.078, 115.919, 99.308]]
[['A', ' CA ', 150.757, 116.524, 96.806]]
[['A', ' CA ', 154.299, 115.472, 96.505]]
[['A', ' CA ', 155.317, 118.632, 94.384]]
[['A', ' CA ', 153.81, 121.142, 97.275]]
[['A', ' CA ', 154.172, 119.178, 100.81]]
[['A', ' CA ', 156.378, 121.914, 102.787]]
[['A', ' CA ', 153.654, 124.532, 101.996]]
[['A', ' CA ', 150.571, 122.316, 103.437]]
[['A', ' CA ', 152.517, 120.867, 106.562]]
[['A', ' CA ', 153.552, 124.361, 107.922]]
[['A', ' CA ', 149.817, 126.099, 106.873]]
[['A', ' CA ', 147.764, 122.669, 108.728]]
[['A', ' CA ', 150.489, 122.711, 112.152]]
[['A', ' CA ', 150.407, 127.428, 112.044]]
[['A', ' CA ', 146.344, 126.698, 111.668]]
[['A', ' CA ', 145.935, 123.715, 114.553]]
[['A', ' CA ', 149.707, 126.698, 116.716]]
[['A', ' CA ', 146.597, 129.791, 115.987]]
[['A', ' CA ', 142.859, 127.296, 117.463]]
[['A', ' CA ', 145.161, 126.078, 120.736]]
[['A', ' CA ', 147.676, 129.886, 120.449]]
[['A', ' CA ', 151.383, 128.329, 120.965]]
[['A', ' CA ', 153.546, 131.561, 119.624]]
[['A', ' CA ', 156.772, 129.21, 118.057]]
[['A', ' CA ', 160.092, 131.316, 119.245]]
[['A', ' CA ', 161.478, 133.195, 116.01]]
[['A', ' CA ', 164.629, 130.886, 114.598]]
[['A', ' CA ', 161.203, 127.482, 114.309]]
[['A', ' CA ', 158.969, 130.689, 112.108]]
[['A', ' CA ', 162.7, 132.116, 109.894]]
[['A', ' CA ', 164.243, 127.79, 109.393]]
[['A', ' CA ', 159.876, 126.694, 108.209]]
[['A', ' CA ', 159.839, 130.651, 105.739]]
[['A', ' CA ', 163.906, 129.385, 104.517]]
[['A', ' CA ', 162.481, 125.651, 103.785]]
[['A', ' CA ', 159.025, 126.897, 101.911]]
[['A', ' CA ', 161.092, 129.953, 99.973]]
[['A', ' CA ', 164.337, 127.097, 98.826]]
[['A', ' CA ', 160.911, 124.197, 98.139]]
[['A', ' CA ', 159.037, 127.623, 95.904]]
[['A', ' CA ', 162.536, 127.683, 93.678]]
[['A', ' CA ', 162.806, 123.299, 93.528]]
[['A', ' CA ', 158.591, 123.278, 92.669]]
[['A', ' CA ', 158.621, 126.22, 89.937]]
[['A', ' CA ', 162.176, 124.681, 88.485]]
[['A', ' CA ', 160.312, 120.681, 88.291]]
[['A', ' CA ', 156.964, 122.853, 86.527]]
[['A', ' CA ', 159.904, 124.932, 83.794]]
[['A', ' CA ', 161.418, 120.982, 83.085]]
[['A', ' CA ', 157.519, 119.697, 82.362]]
[['A', ' CA ', 155.953, 122.996, 80.541]]
[['A', ' CA ', 159.869, 123.786, 78.917]]
[['A', ' CA ', 159.987, 120.064, 76.768]]
[['A', ' CA ', 157.022, 122.257, 74.028]]
[['A', ' CA ', 158.873, 126.272, 74.828]]
[['A', ' CA ', 162.787, 125.084, 74.941]]
[['A', ' CA ', 163.451, 123.584, 71.15]]
[['A', ' CA ', 164.96, 119.77, 72.195]]
[['A', ' CA ', 169.396, 120.562, 71.428]]
[['A', ' CA ', 169.723, 123.321, 74.926]]
[['A', ' CA ', 166.086, 121.053, 76.719]]
[['A', ' CA ', 169.007, 118.107, 78.081]]
[['A', ' CA ', 171.61, 121.166, 79.498]]
[['A', ' CA ', 168.036, 123.607, 80.543]]
[['A', ' CA ', 166.273, 119.85, 82.792]]
[['A', ' CA ', 170.155, 119.21, 84.168]]
[['A', ' CA ', 170.662, 123.644, 85.145]]
[['A', ' CA ', 166.475, 123.258, 86.985]]
[['A', ' CA ', 167.786, 119.27, 88.727]]
[['A', ' CA ', 171.566, 121.165, 89.935]]
[['A', ' CA ', 169.066, 124.701, 91.423]]
[['A', ' CA ', 166.105, 122.014, 92.895]]
[['A', ' CA ', 169.463, 118.861, 94.339]]
[['A', ' CA ', 171.176, 122.372, 96.468]]
[['A', ' CA ', 167.499, 124.307, 97.488]]
[['A', ' CA ', 166.021, 120.222, 98.596]]
[['A', ' CA ', 169.573, 119.553, 100.74]]
[['A', ' CA ', 168.515, 123.423, 102.987]]
[['A', ' CA ', 164.214, 121.799, 103.097]]
[['A', ' CA ', 165.66, 117.857, 103.753]]
[['A', ' CA ', 168.796, 119.209, 106.542]]
[['A', ' CA ', 165.969, 121.954, 107.862]]
[['A', ' CA ', 162.704, 119.814, 107.938]]
[['A', ' CA ', 163.975, 115.891, 107.754]]
[['A', ' CA ', 163.861, 114.935, 103.739]]
[['A', ' CA ', 162.758, 117.099, 100.832]]
[['A', ' CA ', 159.746, 115.382, 99.478]]
[['A', ' CA ', 157.522, 114.929, 102.507]]
[['A', ' CA ', 158.964, 117.006, 105.366]]
[['A', ' CA ', 158.572, 115.207, 108.84]]
[['A', ' CA ', 160.583, 117.568, 111.587]]
[['A', ' CA ', 158.217, 121.234, 111.107]]
[['A', ' CA ', 155.646, 119.209, 113.573]]
[['A', ' CA ', 153.083, 122.016, 115.515]]
[['A', ' CA ', 155.001, 124.921, 117.982]]
[['A', ' CA ', 157.371, 125.13, 115.447]]
[['A', ' CA ', 160.212, 123.054, 114.52]]
[['A', ' CA ', 161.549, 119.946, 115.627]]
[['A', ' CA ', 165.212, 120.198, 115.983]]
[['A', ' CA ', 167.081, 123.643, 114.504]]
[['A', ' CA ', 170.252, 122.732, 112.185]]
[['A', ' CA ', 173.931, 123.043, 114.285]]
[['A', ' CA ', 175.815, 126.174, 112.677]]
[['A', ' CA ', 178.663, 123.413, 110.012]]
[['A', ' CA ', 174.867, 122.353, 108.024]]
[['A', ' CA ', 173.361, 126.453, 108.253]]
[['A', ' CA ', 177.126, 128.157, 106.804]]
[['A', ' CA ', 177.863, 124.559, 104.433]]
[['A', ' CA ', 173.699, 124.875, 102.676]]
[['A', ' CA ', 174.013, 129.366, 103.036]]
[['A', ' CA ', 177.788, 129.05, 100.899]]
[['A', ' CA ', 176.3, 126.083, 98.145]]
[['A', ' CA ', 172.476, 128.323, 97.737]]
[['A', ' CA ', 174.45, 132.4, 97.455]]
[['A', ' CA ', 177.603, 130.241, 94.681]]
[['A', ' CA ', 173.663, 128.324, 92.823]]
[['A', ' CA ', 171.616, 132.384, 93.14]]
[['A', ' CA ', 174.509, 133.523, 89.874]]
[['A', ' CA ', 173.311, 129.765, 87.483]]
[['A', ' CA ', 169.014, 129.893, 89.067]]
[['A', ' CA ', 169.088, 134.275, 87.952]]
[['A', ' CA ', 171.31, 133.091, 84.263]]
[['A', ' CA ', 168.273, 129.715, 83.622]]
[['A', ' CA ', 164.946, 132.198, 84.897]]
[['A', ' CA ', 166.474, 135.547, 82.317]]
[['A', ' CA ', 167.202, 132.229, 79.054]]
[['A', ' CA ', 163.531, 130.559, 80.149]]
[['A', ' CA ', 161.497, 134.37, 80.32]]
[['A', ' CA ', 164.574, 135.522, 76.626]]
[['A', ' CA ', 162.821, 131.539, 74.946]]
[['A', ' CA ', 158.414, 131.612, 76.283]]
[['A', ' CA ', 158.391, 135.845, 75.493]]
[['A', ' CA ', 160.461, 134.633, 71.397]]
[['A', ' CA ', 157.613, 131.285, 70.814]]
[['A', ' CA ', 154.981, 134.739, 70.811]]
[['A', ' CA ', 151.787, 132.793, 71.664]]
[['A', ' CA ', 149.377, 135.432, 70.219]]
[['A', ' CA ', 149.509, 138.268, 72.872]]
[['A', ' CA ', 146.244, 138.909, 74.933]]
[['A', ' CA ', 145.855, 134.801, 75.627]]
[['A', ' CA ', 144.79, 133.96, 79.183]]
[['A', ' CA ', 143.792, 137.69, 80.142]]
[['A', ' CA ', 140.545, 137.181, 82.029]]
[['A', ' CA ', 139.753, 140.39, 84.554]]
[['A', ' CA ', 138.446, 138.028, 87.848]]
[['A', ' CA ', 140.587, 139.648, 90.592]]
[['A', ' CA ', 144.097, 137.992, 91.699]]
[['A', ' CA ', 144.883, 136.157, 95.065]]
[['A', ' CA ', 147.857, 137.277, 97.463]]
[['A', ' CA ', 148.174, 137.821, 101.204]]
[['A', ' CA ', 152.6, 138.285, 101.459]]
[['A', ' CA ', 154.976, 137.958, 98.661]]
[['A', ' CA ', 156.646, 133.869, 99.932]]
[['A', ' CA ', 155.067, 133.134, 103.764]]
[['A', ' CA ', 151.731, 133.714, 104.509]]
[['A', ' CA ', 150.242, 136.194, 106.892]]
[['A', ' CA ', 146.511, 134.873, 107.72]]
[['A', ' CA ', 144.729, 138.721, 109.076]]
[['A', ' CA ', 145.042, 140.124, 104.993]]
[['A', ' CA ', 142.992, 136.361, 103.793]]
[['A', ' CA ', 139.797, 138.008, 105.789]]
[['A', ' CA ', 137.396, 134.825, 105.831]]
[['A', ' CA ', 133.642, 136.855, 105.963]]
[['A', ' CA ', 134.69, 137.961, 101.945]]
[['A', ' CA ', 135.555, 133.813, 101.733]]
[['A', ' CA ', 133.046, 131.662, 99.536]]
[['A', ' CA ', 132.131, 127.851, 99.618]]
[['A', ' CA ', 131.053, 127.033, 95.788]]
[['A', ' CA ', 130.44, 123.205, 95.042]]
[['A', ' CA ', 130.997, 122.851, 91.507]]
[['A', ' CA ', 127.277, 121.351, 90.291]]
[['A', ' CA ', 125.756, 125.331, 91.04]]
[['A', ' CA ', 129.443, 127.129, 89.055]]
[['A', ' CA ', 129.226, 124.537, 85.682]]
[['A', ' CA ', 125.763, 124.856, 83.915]]
[['A', ' CA ', 125.662, 121.398, 82.11]]
[['A', ' CA ', 124.841, 118.551, 85.581]]
[['A', ' CA ', 127.108, 115.306, 83.903]]
[['A', ' CA ', 130.951, 117.776, 83.882]]
[['A', ' CA ', 129.831, 119.408, 87.987]]
[['A', ' CA ', 128.57, 115.572, 89.347]]
[['A', ' CA ', 132.237, 113.846, 87.31]]
[['A', ' CA ', 134.925, 116.909, 88.655]]
[['A', ' CA ', 135.708, 116.503, 92.612]]
[['A', ' CA ', 136.797, 120.196, 93.314]]
[['A', ' CA ', 134.827, 122.691, 95.483]]
[['A', ' CA ', 135.493, 126.305, 93.531]]
[['A', ' CA ', 136.167, 128.514, 96.923]]
[['A', ' CA ', 135.592, 132.209, 95.13]]
[['A', ' CA ', 136.715, 135.061, 97.925]]
[['A', ' CA ', 133.705, 137.856, 97.931]]
[['A', ' CA ', 131.343, 135.507, 95.506]]
[['A', ' CA ', 133.946, 136.147, 91.925]]
[['A', ' CA ', 136.664, 133.428, 91.309]]
[['A', ' CA ', 140.187, 133.875, 91.795]]
[['A', ' CA ', 143.59, 133.215, 90.215]]
[['A', ' CA ', 145.993, 133.385, 93.402]]
[['A', ' CA ', 149.47, 132.114, 91.731]]
[['A', ' CA ', 153.038, 133.699, 92.042]]
[['A', ' CA ', 152.374, 136.231, 89.087]]
[['A', ' CA ', 149.064, 137.769, 91.369]]
[['A', ' CA ', 151.454, 137.672, 95.011]]
[['A', ' CA ', 154.209, 139.868, 92.147]]
[['A', ' CA ', 151.307, 142.24, 90.601]]
[['A', ' CA ', 149.87, 143.087, 94.735]]
[['A', ' CA ', 153.211, 143.193, 97.296]]
[['A', ' CA ', 156.373, 143.808, 94.398]]
[['A', ' CA ', 154.057, 146.017, 91.364]]
[['A', ' CA ', 154.448, 143.527, 87.723]]
[['A', ' CA ', 150.879, 145.181, 86.185]]
[['A', ' CA ', 151.782, 142.781, 82.49]]
[['A', ' CA ', 148.48, 140.239, 82.919]]
[['A', ' CA ', 148.287, 137.01, 79.722]]
[['A', ' CA ', 149.937, 133.232, 80.202]]
[['A', ' CA ', 153.897, 134.282, 78.797]]
[['A', ' CA ', 153.715, 137.321, 82.12]]
[['A', ' CA ', 152.19, 134.17, 84.729]]
[['A', ' CA ', 155.225, 131.588, 83.257]]
[['A', ' CA ', 158.222, 134.609, 83.349]]
[['A', ' CA ', 156.606, 136.159, 87.099]]
[['A', ' CA ', 157.364, 131.892, 88.702]]
[['A', ' CA ', 161.167, 131.888, 87.023]]
[['A', ' CA ', 161.719, 136.066, 88.481]]
[['A', ' CA ', 159.578, 135.304, 92.225]]
[['A', ' CA ', 162.062, 131.477, 92.477]]
[['A', ' CA ', 165.511, 134.753, 92.412]]
[['A', ' CA ', 163.203, 136.896, 95.367]]
[['A', ' CA ', 162.512, 133.219, 97.794]]
[['A', ' CA ', 166.379, 131.736, 97.201]]
[['A', ' CA ', 168.157, 135.65, 98.226]]
[['A', ' CA ', 165.045, 136.001, 101.631]]
[['A', ' CA ', 166.404, 131.909, 102.531]]
[['A', ' CA ', 170.222, 132.907, 101.995]]
[['A', ' CA ', 169.554, 136.732, 104.134]]
[['A', ' CA ', 167.251, 134.3, 107.159]]
[['A', ' CA ', 170.237, 131.192, 107.124]]
[['A', ' CA ', 173.188, 134.263, 107.682]]
[['A', ' CA ', 170.299, 136.443, 110.722]]
[['A', ' CA ', 168.618, 132.577, 112.415]]
[['A', ' CA ', 171.013, 132.091, 115.719]]
[['A', ' CA ', 170.9, 127.854, 115.572]]
[['A', ' CA ', 171.536, 126.799, 119.339]]
[['A', ' CA ', 168.144, 129.472, 121.119]]
[['A', ' CA ', 165.08, 126.373, 121.012]]
[['A', ' CA ', 162.912, 126.114, 117.93]]
[['A', ' CA ', 159.878, 124.11, 119.285]]
[['A', ' CA ', 157.028, 125.169, 121.64]]
[['A', ' CA ', 155.713, 123.959, 124.905]]
[['A', ' CA ', 151.906, 123.074, 124.791]]
[['A', ' CA ', 147.965, 122.649, 125.719]]
[['A', ' CA ', 147.088, 120.867, 122.518]]
[['A', ' CA ', 143.507, 119.858, 123.587]]
[['A', ' CA ', 142.245, 123.486, 121.894]]
[['A', ' CA ', 138.811, 125.039, 123.371]]
[['A', ' CA ', 137.809, 124.889, 119.566]]
[['A', ' CA ', 138.086, 128.594, 118.191]]
[['A', ' CA ', 139.087, 127.442, 114.471]]
[['A', ' CA ', 143.136, 128.732, 113.637]]
[['A', ' CA ', 143.11, 129.478, 109.438]]
[['A', ' CA ', 147.251, 129.772, 108.909]]
[['A', ' CA ', 147.572, 130.245, 104.696]]
[['A', ' CA ', 151.33, 130.284, 103.734]]
[['A', ' CA ', 151.663, 130.957, 99.756]]
[['A', ' CA ', 152.921, 127.636, 98.387]]
[['A', ' CA ', 154.884, 127.871, 94.819]]
[['A', ' CA ', 151.306, 128.205, 92.972]]
[['A', ' CA ', 149.282, 130.401, 95.413]]
[['A', ' CA ', 147.859, 130.883, 98.977]]
[['A', ' CA ', 146.995, 127.472, 100.62]]
[['A', ' CA ', 145.148, 128.684, 103.579]]
[['A', ' CA ', 143.601, 125.273, 105.62]]
[['A', ' CA ', 141.77, 126.558, 108.954]]
[['A', ' CA ', 140.818, 123.51, 111.319]]
[['A', ' CA ', 139.48, 124.192, 115.135]]
[['A', ' CA ', 140.639, 120.959, 117.62]]
[['A', ' CA ', 138.608, 121.254, 120.857]]
[['A', ' CA ', 139.087, 118.096, 123.273]]
[['A', ' CA ', 143.041, 116.762, 122.213]]
[['A', ' CA ', 141.653, 115.675, 118.068]]
[['A', ' CA ', 140.577, 118.343, 115.468]]
[['A', ' CA ', 136.562, 118.19, 115.005]]
[['A', ' CA ', 136.631, 120.189, 111.253]]
[['A', ' CA ', 140.128, 121.026, 109.265]]
[['A', ' CA ', 139.099, 122.055, 105.55]]
[['A', ' CA ', 142.192, 123.26, 103.514]]
[['A', ' CA ', 141.603, 125.124, 99.99]]
[['A', ' CA ', 144.963, 124.998, 98.488]]
[['A', ' CA ', 145.808, 127.543, 95.868]]
[['A', ' CA ', 145.082, 125.29, 92.438]]
[['A', ' CA ', 141.414, 124.777, 93.617]]
[['A', ' CA ', 140.608, 128.677, 93.256]]
[['A', ' CA ', 142.587, 129.071, 89.661]]
[['A', ' CA ', 140.72, 125.726, 88.524]]
[['A', ' CA ', 137.182, 127.396, 87.723]]
[['A', ' CA ', 139.195, 131.051, 86.099]]
[['A', ' CA ', 141.859, 128.598, 83.677]]
[['A', ' CA ', 138.714, 126.797, 81.884]]
[['A', ' CA ', 136.589, 129.97, 81.083]]
[['A', ' CA ', 140.625, 132.422, 80.142]]
[['A', ' CA ', 141.289, 129.463, 77.019]]
[['A', ' CA ', 137.411, 130.996, 75.351]]
[['A', ' CA ', 138.238, 133.893, 72.426]]
[['A', ' CA ', 141.609, 132.181, 70.567]]
[['A', ' CA ', 142.1, 128.596, 68.586]]
[['A', ' CA ', 141.434, 125.608, 71.285]]
[['A', ' CA ', 145.694, 124.017, 70.651]]
[['A', ' CA ', 146.975, 127.419, 73.051]]
[['A', ' CA ', 143.637, 127.141, 75.341]]
[['A', ' CA ', 145.689, 123.819, 76.898]]
[['A', ' CA ', 149.432, 125.96, 77.376]]
[['A', ' CA ', 147.235, 129.288, 79.378]]
[['A', ' CA ', 145.855, 126.18, 81.997]]
[['A', ' CA ', 149.963, 124.507, 82.001]]
[['A', ' CA ', 151.237, 128.383, 82.676]]
[['A', ' CA ', 149.088, 128.393, 85.944]]
[['A', ' CA ', 151.146, 125.187, 86.833]]
[['A', ' CA ', 148.13, 123.253, 88.069]]
[['A', ' CA ', 148.825, 120.735, 90.822]]
[['A', ' CA ', 145.446, 118.726, 90.69]]
[['A', ' CA ', 146.109, 116.306, 93.604]]
[['A', ' CA ', 146.035, 119.543, 95.859]]
[['A', ' CA ', 142.914, 120.99, 94.047]]
[['A', ' CA ', 140.847, 117.736, 94.761]]
[['A', ' CA ', 142.148, 119.148, 99.634]]
[['A', ' CA ', 129.601, 123.821, 67.819]] AA_SCO= 1.7819999999999996 CA_SCO= -0.032499999999999994
[['A', ' CA ', 131.684, 120.458, 68.483]] AA_SCO= 1.887272727272727 CA_SCO= -0.028363636363636358
[['A', ' CA ', 133.22, 120.582, 72.165]] AA_SCO= 1.9474999999999998 CA_SCO= -0.02466666666666666
[['A', ' CA ', 136.707, 118.774, 71.884]] AA_SCO= 1.7792307692307692 CA_SCO= -0.03915384615384614
[['A', ' CA ', 137.538, 117.526, 75.757]] AA_SCO= 1.8478571428571426 CA_SCO= -0.05921428571428571
[['A', ' CA ', 141.271, 116.194, 76.008]] AA_SCO= 1.924 CA_SCO= -0.05706666666666667
[['A', ' CA ', 141.449, 114.049, 79.448]] AA_SCO= 1.851875 CA_SCO= -0.055125
[['A', ' CA ', 144.979, 113.508, 80.689]] AA_SCO= 1.8523529411764705 CA_SCO= -0.049823529411764704
[['A', ' CA ', 145.794, 117.064, 80.801]] AA_SCO= 1.8999999999999997 CA_SCO= -0.0445
[['A', ' CA ', 149.613, 116.84, 79.485]] AA_SCO= 1.933157894736842 CA_SCO= -0.03889473684210526
[['A', ' CA ', 152.687, 117.833, 81.544]] AA_SCO= 2.121578947368421 CA_SCO= -0.004684210526315791
[['A', ' CA ', 150.93, 119.018, 84.963]] AA_SCO= 2.192105263157895 CA_SCO= -0.004052631578947372
[['A', ' CA ', 150.352, 116.895, 88.161]] AA_SCO= 2.121052631578947 CA_SCO= -0.008684210526315789
[['A', ' CA ', 147.584, 114.82, 88.696]] AA_SCO= 2.0752631578947365 CA_SCO= -0.014315789473684214
[['A', ' CA ', 143.911, 114.471, 86.655]] AA_SCO= 2.0426315789473684 CA_SCO= -0.05057894736842106
[['A', ' CA ', 141.856, 117.331, 84.938]] AA_SCO= 1.9789473684210528 CA_SCO= -0.05673684210526316
[['A', ' CA ', 140.277, 117.332, 81.377]] AA_SCO= 2.053157894736842 CA_SCO= -0.04978947368421052
[['A', ' CA ', 139.254, 120.913, 79.948]] AA_SCO= 1.9836842105263157 CA_SCO= -0.06568421052631578
[['A', ' CA ', 136.248, 120.221, 77.37]] AA_SCO= 2.0194736842105256 CA_SCO= -0.06405263157894736
[['A', ' CA ', 136.178, 123.671, 75.373]] AA_SCO= 1.9989473684210524 CA_SCO= -0.061842105263157886
[['A', ' CA ', 133.206, 123.831, 72.579]] AA_SCO= 1.963157894736842 CA_SCO= -0.06263157894736843
[['A', ' CA ', 134.763, 125.827, 69.851]] AA_SCO= 1.8831578947368421 CA_SCO= -0.060578947368421045
[['A', ' CA ', 132.521, 127.35, 67.06]] AA_SCO= 2.0531578947368425 CA_SCO= -0.046210526315789466
[['A', ' CA ', 133.032, 127.851, 61.944]] AA_SCO= 2.093684210526316 CA_SCO= -0.02799999999999999
[['A', ' CA ', 136.797, 128.341, 62.575]] AA_SCO= 2.121578947368421 CA_SCO= -0.026052631578947362
[['A', ' CA ', 137.869, 126.038, 65.861]] AA_SCO= 2.132631578947368 CA_SCO= -0.02373684210526315
[['A', ' CA ', 138.347, 129.666, 68.551]] AA_SCO= 2.161052631578947 CA_SCO= -0.02663157894736841
[['A', ' CA ', 136.775, 128.067, 71.709]] AA_SCO= 2.1352631578947365 CA_SCO= -0.02699999999999999
[['A', ' CA ', 133.844, 130.716, 72.63]] AA_SCO= 2.173684210526315 CA_SCO= -0.033368421052631575
[['A', ' CA ', 133.303, 128.738, 76.86]] AA_SCO= 2.0989473684210522 CA_SCO= -0.03394736842105263
[['A', ' CA ', 135.943, 125.883, 77.734]] AA_SCO= 2.1347368421052626 CA_SCO= -0.033999999999999975
[['A', ' CA ', 135.709, 124.822, 81.805]] AA_SCO= 2.167368421052631 CA_SCO= -0.03321052631578946
[['A', ' CA ', 138.578, 122.893, 83.036]] AA_SCO= 2.231052631578947 CA_SCO= -0.027789473684210517
[['A', ' CA ', 137.409, 120.639, 85.849]] AA_SCO= 2.2405263157894733 CA_SCO= 0.010105263157894735
[['A', ' CA ', 139.072, 118.019, 88.15]] AA_SCO= 2.30578947368421 CA_SCO= 0.016684210526315787
[['A', ' CA ', 138.799, 114.326, 87.36]] AA_SCO= 2.36 CA_SCO= 0.015315789473684213
[['A', ' CA ', 140.842, 113.147, 90.182]] AA_SCO= 2.3905263157894736 CA_SCO= 0.03210526315789474
[['A', ' CA ', 139.878, 110.495, 92.706]] AA_SCO= 2.3636842105263156 CA_SCO= 0.03210526315789474
[['A', ' CA ', 138.931, 112.071, 96.06]] AA_SCO= 2.36 CA_SCO= 0.03163157894736842
[['A', ' CA ', 141.521, 111.013, 98.751]] AA_SCO= 2.3905263157894736 CA_SCO= 0.035
[['A', ' CA ', 138.794, 112.387, 101.694]] AA_SCO= 2.450526315789473 CA_SCO= 0.027631578947368427
[['A', ' CA ', 142.208, 113.906, 103.487]] AA_SCO= 2.4510526315789476 CA_SCO= 0.024684210526315784
[['A', ' CA ', 140.681, 116.978, 105.645]] AA_SCO= 2.378421052631579 CA_SCO= 0.026578947368421053
[['A', ' CA ', 137.342, 114.269, 107.075]] AA_SCO= 2.202105263157895 CA_SCO= 0.029315789473684208
[['A', ' CA ', 140.22, 111.176, 107.677]] AA_SCO= 2.267894736842105 CA_SCO= 0.031473684210526306
[['A', ' CA ', 142.649, 113.918, 110.074]] AA_SCO= 2.2989473684210524 CA_SCO= 0.03205263157894736
[['A', ' CA ', 138.967, 115.835, 111.58]] AA_SCO= 2.303684210526316 CA_SCO= 0.033210526315789475
[['A', ' CA ', 137.946, 112.753, 114.296]] AA_SCO= 2.2794736842105263 CA_SCO= 0.03905263157894737
[['A', ' CA ', 142.292, 111.89, 115.034]] AA_SCO= 2.2315789473684213 CA_SCO= 0.03952631578947369
[['A', ' CA ', 144.543, 114.21, 117.445]] AA_SCO= 2.2142105263157896 CA_SCO= 0.0366842105263158
[['A', ' CA ', 146.284, 117.28, 115.652]] AA_SCO= 2.237894736842105 CA_SCO= 0.039157894736842114
[['A', ' CA ', 150.304, 115.852, 115.149]] AA_SCO= 2.2694736842105265 CA_SCO= 0.03415789473684211
[['A', ' CA ', 148.927, 113.067, 112.427]] AA_SCO= 2.4 CA_SCO= 0.03373684210526316
[['A', ' CA ', 146.827, 116.198, 110.296]] AA_SCO= 2.4026315789473687 CA_SCO= -0.0032105263157894705
[['A', ' CA ', 150.412, 118.14, 109.488]] AA_SCO= 2.2910526315789475 CA_SCO= -0.012631578947368424
[['A', ' CA ', 151.87, 114.332, 107.777]] AA_SCO= 2.33578947368421 CA_SCO= -0.014631578947368423
[['A', ' CA ', 148.571, 113.046, 105.95]] AA_SCO= 2.3789473684210525 CA_SCO= -0.01684210526315789
[['A', ' CA ', 147.779, 116.864, 104.881]] AA_SCO= 2.3989473684210525 CA_SCO= -0.017842105263157892
[['A', ' CA ', 151.667, 116.856, 103.514]] AA_SCO= 2.3684210526315788 CA_SCO= -0.01889473684210526
[['A', ' CA ', 150.814, 113.83, 101.395]] AA_SCO= 2.44578947368421 CA_SCO= -0.011736842105263157
[['A', ' CA ', 148.078, 115.919, 99.308]] AA_SCO= 2.4142105263157894 CA_SCO= -0.008684210526315789
[['A', ' CA ', 150.757, 116.524, 96.806]] AA_SCO= 2.4257894736842105 CA_SCO= -0.008947368421052634
[['A', ' CA ', 154.299, 115.472, 96.505]] AA_SCO= 2.5100000000000002 CA_SCO= -0.021
[['A', ' CA ', 155.317, 118.632, 94.384]] AA_SCO= 2.3747368421052633 CA_SCO= -0.020842105263157898
[['A', ' CA ', 153.81, 121.142, 97.275]] AA_SCO= 2.352105263157895 CA_SCO= -0.01705263157894737
[['A', ' CA ', 154.172, 119.178, 100.81]] AA_SCO= 2.3647368421052635 CA_SCO= -0.01710526315789473
[['A', ' CA ', 156.378, 121.914, 102.787]] AA_SCO= 2.3184210526315794 CA_SCO= -0.02126315789473684
[['A', ' CA ', 153.654, 124.532, 101.996]] AA_SCO= 2.3826315789473687 CA_SCO= -0.023526315789473676
[['A', ' CA ', 150.571, 122.316, 103.437]] AA_SCO= 2.2721052631578944 CA_SCO= -0.02831578947368421
[['A', ' CA ', 152.517, 120.867, 106.562]] AA_SCO= 2.245263157894737 CA_SCO= -0.030210526315789465
[['A', ' CA ', 153.552, 124.361, 107.922]] AA_SCO= 2.222105263157894 CA_SCO= -0.0258421052631579
[['A', ' CA ', 149.817, 126.099, 106.873]] AA_SCO= 2.127894736842105 CA_SCO= -0.027315789473684206
[['A', ' CA ', 147.764, 122.669, 108.728]] AA_SCO= 2.117368421052632 CA_SCO= 0.009473684210526315
[['A', ' CA ', 150.489, 122.711, 112.152]] AA_SCO= 2.0357894736842104 CA_SCO= 0.020578947368421047
[['A', ' CA ', 150.407, 127.428, 112.044]] AA_SCO= 1.928947368421053 CA_SCO= 0.020105263157894734
[['A', ' CA ', 146.344, 126.698, 111.668]] AA_SCO= 1.8615789473684212 CA_SCO= 0.02221052631578947
[['A', ' CA ', 145.935, 123.715, 114.553]] AA_SCO= 1.9563157894736842 CA_SCO= 0.024052631578947364
[['A', ' CA ', 149.707, 126.698, 116.716]] AA_SCO= 1.9142105263157894 CA_SCO= 0.023210526315789473
[['A', ' CA ', 146.597, 129.791, 115.987]] AA_SCO= 1.8463157894736841 CA_SCO= 0.02368421052631579
[['A', ' CA ', 142.859, 127.296, 117.463]] AA_SCO= 1.8594736842105262 CA_SCO= 0.021157894736842108
[['A', ' CA ', 145.161, 126.078, 120.736]] AA_SCO= 1.891578947368421 CA_SCO= 0.02142105263157895
[['A', ' CA ', 147.676, 129.886, 120.449]] AA_SCO= 1.9236842105263157 CA_SCO= 0.03347368421052632
[['A', ' CA ', 151.383, 128.329, 120.965]] AA_SCO= 2.0857894736842106 CA_SCO= 0.03347368421052632
[['A', ' CA ', 153.546, 131.561, 119.624]] AA_SCO= 2.1010526315789475 CA_SCO= 0.03063157894736842
[['A', ' CA ', 156.772, 129.21, 118.057]] AA_SCO= 1.8842105263157893 CA_SCO= 0.03057894736842105
[['A', ' CA ', 160.092, 131.316, 119.245]] AA_SCO= 1.888421052631579 CA_SCO= 0.03526315789473685
[['A', ' CA ', 161.478, 133.195, 116.01]] AA_SCO= 1.767368421052632 CA_SCO= 0.03331578947368421
[['A', ' CA ', 164.629, 130.886, 114.598]] AA_SCO= 1.8694736842105264 CA_SCO= 0.04100000000000001
[['A', ' CA ', 161.203, 127.482, 114.309]] AA_SCO= 1.8631578947368421 CA_SCO= 0.04263157894736844
[['A', ' CA ', 158.969, 130.689, 112.108]] AA_SCO= 1.9078947368421053 CA_SCO= 0.04336842105263159
[['A', ' CA ', 162.7, 132.116, 109.894]] AA_SCO= 1.734736842105263 CA_SCO= 0.045052631578947386
[['A', ' CA ', 164.243, 127.79, 109.393]] AA_SCO= 1.784736842105263 CA_SCO= 0.045105263157894745
[['A', ' CA ', 159.876, 126.694, 108.209]] AA_SCO= 1.7721052631578944 CA_SCO= 0.04273684210526316
[['A', ' CA ', 159.839, 130.651, 105.739]] AA_SCO= 1.8531578947368417 CA_SCO= 0.04436842105263159
[['A', ' CA ', 163.906, 129.385, 104.517]] AA_SCO= 1.8668421052631574 CA_SCO= 0.04326315789473686
[['A', ' CA ', 162.481, 125.651, 103.785]] AA_SCO= 1.7999999999999998 CA_SCO= 0.041263157894736856
[['A', ' CA ', 159.025, 126.897, 101.911]] AA_SCO= 1.8378947368421052 CA_SCO= 0.03400000000000001
[['A', ' CA ', 161.092, 129.953, 99.973]] AA_SCO= 1.8563157894736844 CA_SCO= 0.03373684210526317
[['A', ' CA ', 164.337, 127.097, 98.826]] AA_SCO= 1.8363157894736846 CA_SCO= 0.03626315789473686
[['A', ' CA ', 160.911, 124.197, 98.139]] AA_SCO= 1.8368421052631583 CA_SCO= 0.036105263157894744
[['A', ' CA ', 159.037, 127.623, 95.904]] AA_SCO= 1.8710526315789475 CA_SCO= 0.036105263157894744
[['A', ' CA ', 162.536, 127.683, 93.678]] AA_SCO= 1.8689473684210525 CA_SCO= 0.036105263157894744
[['A', ' CA ', 162.806, 123.299, 93.528]] AA_SCO= 1.8289473684210527 CA_SCO= 0.038526315789473686
[['A', ' CA ', 158.591, 123.278, 92.669]] AA_SCO= 2.0352631578947364 CA_SCO= 0.03789473684210527
[['A', ' CA ', 158.621, 126.22, 89.937]] AA_SCO= 2.0794736842105257 CA_SCO= 0.03773684210526316
[['A', ' CA ', 162.176, 124.681, 88.485]] AA_SCO= 2.1763157894736844 CA_SCO= 0.03715789473684211
[['A', ' CA ', 160.312, 120.681, 88.291]] AA_SCO= 2.1947368421052627 CA_SCO= 0.03426315789473684
[['A', ' CA ', 156.964, 122.853, 86.527]] AA_SCO= 2.0989473684210527 CA_SCO= 0.03331578947368421
[['A', ' CA ', 159.904, 124.932, 83.794]] AA_SCO= 2.139473684210526 CA_SCO= 0.033210526315789475
[['A', ' CA ', 161.418, 120.982, 83.085]] AA_SCO= 2.2815789473684216 CA_SCO= 0.03368421052631578
[['A', ' CA ', 157.519, 119.697, 82.362]] AA_SCO= 2.2068421052631577 CA_SCO= 0.029578947368421055
[['A', ' CA ', 155.953, 122.996, 80.541]] AA_SCO= 2.1910526315789474 CA_SCO= 0.031947368421052634
[['A', ' CA ', 159.869, 123.786, 78.917]] AA_SCO= 2.0826315789473684 CA_SCO= 0.03278947368421053
[['A', ' CA ', 159.987, 120.064, 76.768]] AA_SCO= 1.934736842105263 CA_SCO= 0.033947368421052636
[['A', ' CA ', 157.022, 122.257, 74.028]] AA_SCO= 1.9373684210526316 CA_SCO= 0.025947368421052632
[['A', ' CA ', 158.873, 126.272, 74.828]] AA_SCO= 1.9421052631578946 CA_SCO= 0.035
[['A', ' CA ', 162.787, 125.084, 74.941]] AA_SCO= 1.934736842105263 CA_SCO= 0.03536842105263158
[['A', ' CA ', 163.451, 123.584, 71.15]] AA_SCO= 1.8726315789473684 CA_SCO= 0.028999999999999998
[['A', ' CA ', 164.96, 119.77, 72.195]] AA_SCO= 1.8173684210526317 CA_SCO= 0.019842105263157894
[['A', ' CA ', 169.396, 120.562, 71.428]] AA_SCO= 1.7542105263157894 CA_SCO= 0.019842105263157894
[['A', ' CA ', 169.723, 123.321, 74.926]] AA_SCO= 1.736315789473684 CA_SCO= 0.019842105263157897
[['A', ' CA ', 166.086, 121.053, 76.719]] AA_SCO= 1.7584210526315787 CA_SCO= 0.019052631578947366
[['A', ' CA ', 169.007, 118.107, 78.081]] AA_SCO= 1.771052631578947 CA_SCO= 0.019736842105263157
[['A', ' CA ', 171.61, 121.166, 79.498]] AA_SCO= 1.777368421052631 CA_SCO= 0.019894736842105264
[['A', ' CA ', 168.036, 123.607, 80.543]] AA_SCO= 1.7989473684210522 CA_SCO= 0.024473684210526314
[['A', ' CA ', 166.273, 119.85, 82.792]] AA_SCO= 1.6205263157894734 CA_SCO= 0.026473684210526316
[['A', ' CA ', 170.155, 119.21, 84.168]] AA_SCO= 1.7221052631578946 CA_SCO= 0.029052631578947365
[['A', ' CA ', 170.662, 123.644, 85.145]] AA_SCO= 1.7099999999999997 CA_SCO= 0.029263157894736845
[['A', ' CA ', 166.475, 123.258, 86.985]] AA_SCO= 1.7999999999999998 CA_SCO= 0.029263157894736838
[['A', ' CA ', 167.786, 119.27, 88.727]] AA_SCO= 1.8168421052631576 CA_SCO= 0.03347368421052632
[['A', ' CA ', 171.566, 121.165, 89.935]] AA_SCO= 1.9789473684210523 CA_SCO= 0.03321052631578948
[['A', ' CA ', 169.066, 124.701, 91.423]] AA_SCO= 2.021578947368421 CA_SCO= 0.033210526315789475
[['A', ' CA ', 166.105, 122.014, 92.895]] AA_SCO= 2.2457894736842103 CA_SCO= 0.03326315789473685
[['A', ' CA ', 169.463, 118.861, 94.339]] AA_SCO= 2.269473684210526 CA_SCO= 0.043263157894736844
[['A', ' CA ', 171.176, 122.372, 96.468]] AA_SCO= 2.2563157894736845 CA_SCO= 0.04321052631578947
[['A', ' CA ', 167.499, 124.307, 97.488]] AA_SCO= 2.254210526315789 CA_SCO= 0.03421052631578948
[['A', ' CA ', 166.021, 120.222, 98.596]] AA_SCO= 2.2642105263157895 CA_SCO= 0.036368421052631585
[['A', ' CA ', 169.573, 119.553, 100.74]] AA_SCO= 2.290526315789474 CA_SCO= 0.031000000000000003
[['A', ' CA ', 168.515, 123.423, 102.987]] AA_SCO= 2.3057894736842104 CA_SCO= 0.02573684210526316
[['A', ' CA ', 164.214, 121.799, 103.097]] AA_SCO= 2.377368421052631 CA_SCO= 0.02457894736842106
[['A', ' CA ', 165.66, 117.857, 103.753]] AA_SCO= 2.409473684210526 CA_SCO= 0.021105263157894745
[['A', ' CA ', 168.796, 119.209, 106.542]] AA_SCO= 2.3973684210526316 CA_SCO= 0.01915789473684211
[['A', ' CA ', 165.969, 121.954, 107.862]] AA_SCO= 2.3099999999999996 CA_SCO= 0.011157894736842108
[['A', ' CA ', 162.704, 119.814, 107.938]] AA_SCO= 2.3094736842105266 CA_SCO= 0.011473684210526315
[['A', ' CA ', 163.975, 115.891, 107.754]] AA_SCO= 2.4794736842105265 CA_SCO= 0.01236842105263158
[['A', ' CA ', 163.861, 114.935, 103.739]] AA_SCO= 2.488421052631579 CA_SCO= 0.01
[['A', ' CA ', 162.758, 117.099, 100.832]] AA_SCO= 2.460526315789474 CA_SCO= -0.024842105263157895
[['A', ' CA ', 159.746, 115.382, 99.478]] AA_SCO= 2.437894736842105 CA_SCO= -0.04184210526315789
[['A', ' CA ', 157.522, 114.929, 102.507]] AA_SCO= 2.4557894736842103 CA_SCO= -0.04663157894736842
[['A', ' CA ', 158.964, 117.006, 105.366]] AA_SCO= 2.401578947368421 CA_SCO= -0.053947368421052626
[['A', ' CA ', 158.572, 115.207, 108.84]] AA_SCO= 2.3957894736842102 CA_SCO= -0.056368421052631575
[['A', ' CA ', 160.583, 117.568, 111.587]] AA_SCO= 2.369473684210526 CA_SCO= -0.056842105263157895
[['A', ' CA ', 158.217, 121.234, 111.107]] AA_SCO= 2.372105263157895 CA_SCO= -0.05863157894736842
[['A', ' CA ', 155.646, 119.209, 113.573]] AA_SCO= 2.3721052631578954 CA_SCO= -0.0584736842105263
[['A', ' CA ', 153.083, 122.016, 115.515]] AA_SCO= 2.3442105263157895 CA_SCO= -0.05394736842105261
[['A', ' CA ', 155.001, 124.921, 117.982]] AA_SCO= 2.3926315789473684 CA_SCO= -0.060578947368421045
[['A', ' CA ', 157.371, 125.13, 115.447]] AA_SCO= 2.381052631578948 CA_SCO= -0.04647368421052631
[['A', ' CA ', 160.212, 123.054, 114.52]] AA_SCO= 2.4231578947368426 CA_SCO= -0.041421052631578935
[['A', ' CA ', 161.549, 119.946, 115.627]] AA_SCO= 2.3452631578947374 CA_SCO= -0.040263157894736834
[['A', ' CA ', 165.212, 120.198, 115.983]] AA_SCO= 2.345789473684211 CA_SCO= -0.03810526315789473
[['A', ' CA ', 167.081, 123.643, 114.504]] AA_SCO= 2.36421052631579 CA_SCO= -0.036105263157894724
[['A', ' CA ', 170.252, 122.732, 112.185]] AA_SCO= 2.470526315789474 CA_SCO= -0.028105263157894727
[['A', ' CA ', 173.931, 123.043, 114.285]] AA_SCO= 2.4563157894736847 CA_SCO= -0.028105263157894727
[['A', ' CA ', 175.815, 126.174, 112.677]] AA_SCO= 2.432105263157895 CA_SCO= -0.028105263157894717
[['A', ' CA ', 178.663, 123.413, 110.012]] AA_SCO= 2.4394736842105265 CA_SCO= -0.025684210526315768
[['A', ' CA ', 174.867, 122.353, 108.024]] AA_SCO= 2.4547368421052633 CA_SCO= 0.009210526315789473
[['A', ' CA ', 173.361, 126.453, 108.253]] AA_SCO= 2.464736842105263 CA_SCO= 0.02636842105263158
[['A', ' CA ', 177.126, 128.157, 106.804]] AA_SCO= 2.4715789473684207 CA_SCO= 0.03115789473684211
[['A', ' CA ', 177.863, 124.559, 104.433]] AA_SCO= 2.537894736842105 CA_SCO= 0.03873684210526317
[['A', ' CA ', 173.699, 124.875, 102.676]] AA_SCO= 2.5936842105263156 CA_SCO= 0.041157894736842116
[['A', ' CA ', 174.013, 129.366, 103.036]] AA_SCO= 2.560526315789473 CA_SCO= 0.041157894736842116
[['A', ' CA ', 177.788, 129.05, 100.899]] AA_SCO= 2.5599999999999996 CA_SCO= 0.04294736842105264
[['A', ' CA ', 176.3, 126.083, 98.145]] AA_SCO= 2.6089473684210525 CA_SCO= 0.04294736842105264
[['A', ' CA ', 172.476, 128.323, 97.737]] AA_SCO= 2.5873684210526315 CA_SCO= 0.04400000000000001
[['A', ' CA ', 174.45, 132.4, 97.455]] AA_SCO= 2.6573684210526314 CA_SCO= 0.054631578947368434
[['A', ' CA ', 177.603, 130.241, 94.681]] AA_SCO= 2.6731578947368417 CA_SCO= 0.05510526315789475
[['A', ' CA ', 173.663, 128.324, 92.823]] AA_SCO= 2.642631578947368 CA_SCO= 0.05515789473684211
[['A', ' CA ', 171.616, 132.384, 93.14]] AA_SCO= 2.532631578947368 CA_SCO= 0.055105263157894734
[['A', ' CA ', 174.509, 133.523, 89.874]] AA_SCO= 2.528947368421053 CA_SCO= 0.057578947368421056
[['A', ' CA ', 173.311, 129.765, 87.483]] AA_SCO= 2.527894736842106 CA_SCO= 0.05668421052631579
[['A', ' CA ', 169.014, 129.893, 89.067]] AA_SCO= 2.491052631578947 CA_SCO= 0.056
[['A', ' CA ', 169.088, 134.275, 87.952]] AA_SCO= 2.426842105263159 CA_SCO= 0.05310526315789473
[['A', ' CA ', 171.31, 133.091, 84.263]] AA_SCO= 2.442105263157895 CA_SCO= 0.05294736842105263
[['A', ' CA ', 168.273, 129.715, 83.622]] AA_SCO= 2.4289473684210527 CA_SCO= 0.05263157894736842
[['A', ' CA ', 164.946, 132.198, 84.897]] AA_SCO= 2.353157894736842 CA_SCO= 0.052000000000000005
[['A', ' CA ', 166.474, 135.547, 82.317]] AA_SCO= 2.3136842105263153 CA_SCO= 0.05157894736842106
[['A', ' CA ', 167.202, 132.229, 79.054]] AA_SCO= 2.2994736842105263 CA_SCO= 0.03310526315789475
[['A', ' CA ', 163.531, 130.559, 80.149]] AA_SCO= 2.296315789473684 CA_SCO= 0.029842105263157902
[['A', ' CA ', 161.497, 134.37, 80.32]] AA_SCO= 2.3310526315789475 CA_SCO= 0.02889473684210527
[['A', ' CA ', 164.574, 135.522, 76.626]] AA_SCO= 2.2368421052631584 CA_SCO= 0.02494736842105264
[['A', ' CA ', 162.821, 131.539, 74.946]] AA_SCO= 2.22421052631579 CA_SCO= 0.011947368421052639
[['A', ' CA ', 158.414, 131.612, 76.283]] AA_SCO= 2.1984210526315793 CA_SCO= 0.010210526315789479
[['A', ' CA ', 158.391, 135.845, 75.493]] AA_SCO= 2.2563157894736845 CA_SCO= 0.009052631578947373
[['A', ' CA ', 160.461, 134.633, 71.397]] AA_SCO= 2.2042105263157894 CA_SCO= -0.004947368421052628
[['A', ' CA ', 157.613, 131.285, 70.814]] AA_SCO= 2.090526315789474 CA_SCO= -0.006052631578947367
[['A', ' CA ', 154.981, 134.739, 70.811]] AA_SCO= 2.0526315789473686 CA_SCO= -0.006052631578947369
[['A', ' CA ', 151.787, 132.793, 71.664]] AA_SCO= 2.116842105263158 CA_SCO= -0.005999999999999998
[['A', ' CA ', 149.377, 135.432, 70.219]] AA_SCO= 2.039473684210526 CA_SCO= -0.005999999999999999
[['A', ' CA ', 149.509, 138.268, 72.872]] AA_SCO= 2.0173684210526317 CA_SCO= -0.005157894736842107
[['A', ' CA ', 146.244, 138.909, 74.933]] AA_SCO= 2.023684210526316 CA_SCO= -0.004578947368421054
[['A', ' CA ', 145.855, 134.801, 75.627]] AA_SCO= 2.0784210526315796 CA_SCO= -0.0063684210526315805
[['A', ' CA ', 144.79, 133.96, 79.183]] AA_SCO= 1.9610526315789476 CA_SCO= -0.03215789473684211
[['A', ' CA ', 143.792, 137.69, 80.142]] AA_SCO= 2.0078947368421054 CA_SCO= -0.03526315789473684
[['A', ' CA ', 140.545, 137.181, 82.029]] AA_SCO= 2.024736842105263 CA_SCO= -0.036421052631578944
[['A', ' CA ', 139.753, 140.39, 84.554]] AA_SCO= 2.033684210526316 CA_SCO= -0.03826315789473684
[['A', ' CA ', 138.446, 138.028, 87.848]] AA_SCO= 2.0763157894736843 CA_SCO= -0.02521052631578947
[['A', ' CA ', 140.587, 139.648, 90.592]] AA_SCO= 2.08 CA_SCO= -0.034999999999999996
[['A', ' CA ', 144.097, 137.992, 91.699]] AA_SCO= 1.9463157894736844 CA_SCO= -0.0438421052631579
[['A', ' CA ', 144.883, 136.157, 95.065]] AA_SCO= 2.076315789473684 CA_SCO= -0.0428421052631579
[['A', ' CA ', 147.857, 137.277, 97.463]] AA_SCO= 1.9789473684210528 CA_SCO= -0.03431578947368421
[['A', ' CA ', 148.174, 137.821, 101.204]] AA_SCO= 1.9826315789473685 CA_SCO= -0.03689473684210526
[['A', ' CA ', 152.6, 138.285, 101.459]] AA_SCO= 2.024736842105263 CA_SCO= -0.032736842105263154
[['A', ' CA ', 154.976, 137.958, 98.661]] AA_SCO= 2.0178947368421047 CA_SCO= -0.019210526315789477
[['A', ' CA ', 156.646, 133.869, 99.932]] AA_SCO= 2.130526315789473 CA_SCO= -0.021263157894736845
[['A', ' CA ', 155.067, 133.134, 103.764]] AA_SCO= 1.987368421052631 CA_SCO= -0.024736842105263158
[['A', ' CA ', 151.731, 133.714, 104.509]] AA_SCO= 2.0852631578947367 CA_SCO= -0.027
[['A', ' CA ', 150.242, 136.194, 106.892]] AA_SCO= 2.187894736842105 CA_SCO= -0.02763157894736841
[['A', ' CA ', 146.511, 134.873, 107.72]] AA_SCO= 2.11578947368421 CA_SCO= -0.03157894736842105
[['A', ' CA ', 144.729, 138.721, 109.076]] AA_SCO= 1.9889473684210521 CA_SCO= -0.034052631578947355
[['A', ' CA ', 145.042, 140.124, 104.993]] AA_SCO= 1.9573684210526314 CA_SCO= -0.029473684210526308
[['A', ' CA ', 142.992, 136.361, 103.793]] AA_SCO= 1.916315789473684 CA_SCO= -0.008052631578947372
[['A', ' CA ', 139.797, 138.008, 105.789]] AA_SCO= 1.892631578947368 CA_SCO= -0.010842105263157898
[['A', ' CA ', 137.396, 134.825, 105.831]] AA_SCO= 1.9026315789473685 CA_SCO= -0.009105263157894738
[['A', ' CA ', 133.642, 136.855, 105.963]] AA_SCO= 1.8194736842105264 CA_SCO= -0.007000000000000004
[['A', ' CA ', 134.69, 137.961, 101.945]] AA_SCO= 1.9184210526315788 CA_SCO= -0.002789473684210529
[['A', ' CA ', 135.555, 133.813, 101.733]] AA_SCO= 1.9505263157894734 CA_SCO= 0.009947368421052632
[['A', ' CA ', 133.046, 131.662, 99.536]] AA_SCO= 2.0273684210526315 CA_SCO= 0.0037894736842105266
[['A', ' CA ', 132.131, 127.851, 99.618]] AA_SCO= 1.9652631578947366 CA_SCO= -0.0012105263157894733
[['A', ' CA ', 131.053, 127.033, 95.788]] AA_SCO= 2.0763157894736843 CA_SCO= -0.004684210526315788
[['A', ' CA ', 130.44, 123.205, 95.042]] AA_SCO= 2.076842105263158 CA_SCO= -0.0007894736842105266
[['A', ' CA ', 130.997, 122.851, 91.507]] AA_SCO= 2.0242105263157897 CA_SCO= -0.004105263157894737
[['A', ' CA ', 127.277, 121.351, 90.291]] AA_SCO= 2.0105263157894733 CA_SCO= -0.003578947368421053
[['A', ' CA ', 125.756, 125.331, 91.04]] AA_SCO= 1.8326315789473684 CA_SCO= -0.0004736842105263162
[['A', ' CA ', 129.443, 127.129, 89.055]] AA_SCO= 2.0594736842105266 CA_SCO= 0.0030000000000000005
[['A', ' CA ', 129.226, 124.537, 85.682]] AA_SCO= 2.0015789473684213 CA_SCO= 0.005157894736842104
[['A', ' CA ', 125.763, 124.856, 83.915]] AA_SCO= 1.7847368421052634 CA_SCO= -0.0010526315789473708
[['A', ' CA ', 125.662, 121.398, 82.11]] AA_SCO= 1.763684210526316 CA_SCO= 0.0026315789473684193
[['A', ' CA ', 124.841, 118.551, 85.581]] AA_SCO= 1.8584210526315794 CA_SCO= 0.005105263157894734
[['A', ' CA ', 127.108, 115.306, 83.903]] AA_SCO= 1.8847368421052633 CA_SCO= 0.00489473684210526
[['A', ' CA ', 130.951, 117.776, 83.882]] AA_SCO= 2.071578947368421 CA_SCO= 0.009210526315789471
[['A', ' CA ', 129.831, 119.408, 87.987]] AA_SCO= 2.0005263157894735 CA_SCO= 0.015421052631578943
[['A', ' CA ', 128.57, 115.572, 89.347]] AA_SCO= 2.015263157894737 CA_SCO= 0.015368421052631575
[['A', ' CA ', 132.237, 113.846, 87.31]] AA_SCO= 2.090526315789474 CA_SCO= 0.011473684210526315
[['A', ' CA ', 134.925, 116.909, 88.655]] AA_SCO= 1.9615789473684213 CA_SCO= 0.007842105263157892
[['A', ' CA ', 135.708, 116.503, 92.612]] AA_SCO= 1.9452631578947368 CA_SCO= 0.0037894736842105266
[['A', ' CA ', 136.797, 120.196, 93.314]] AA_SCO= 1.9763157894736845 CA_SCO= 0.012999999999999998
[['A', ' CA ', 134.827, 122.691, 95.483]] AA_SCO= 2.012631578947369 CA_SCO= 0.021210526315789468
[['A', ' CA ', 135.493, 126.305, 93.531]] AA_SCO= 2.0005263157894735 CA_SCO= 0.02226315789473683
[['A', ' CA ', 136.167, 128.514, 96.923]] AA_SCO= 1.9805263157894735 CA_SCO= 0.01447368421052631
[['A', ' CA ', 135.592, 132.209, 95.13]] AA_SCO= 1.9826315789473685 CA_SCO= 0.0026842105263157785
[['A', ' CA ', 136.715, 135.061, 97.925]] AA_SCO= 2.04 CA_SCO= -0.004368421052631585
[['A', ' CA ', 133.705, 137.856, 97.931]] AA_SCO= 2.2573684210526315 CA_SCO= -0.007894736842105267
[['A', ' CA ', 131.343, 135.507, 95.506]] AA_SCO= 2.215263157894737 CA_SCO= -0.008578947368421061
[['A', ' CA ', 133.946, 136.147, 91.925]] AA_SCO= 2.273157894736842 CA_SCO= -0.008578947368421054
[['A', ' CA ', 136.664, 133.428, 91.309]] AA_SCO= 2.4878947368421045 CA_SCO= -0.002368421052631586
[['A', ' CA ', 140.187, 133.875, 91.795]] AA_SCO= 2.597368421052631 CA_SCO= -0.0020526315789473697
[['A', ' CA ', 143.59, 133.215, 90.215]] AA_SCO= 2.603157894736842 CA_SCO= -0.0018947368421052678
[['A', ' CA ', 145.993, 133.385, 93.402]] AA_SCO= 2.657894736842105 CA_SCO= -0.001578947368421057
[['A', ' CA ', 149.47, 132.114, 91.731]] AA_SCO= 2.562105263157895 CA_SCO= -0.0021052631578947407
[['A', ' CA ', 153.038, 133.699, 92.042]] AA_SCO= 2.5505263157894738 CA_SCO= -0.013684210526315794
[['A', ' CA ', 152.374, 136.231, 89.087]] AA_SCO= 2.616842105263158 CA_SCO= -0.02521052631578948
[['A', ' CA ', 149.064, 137.769, 91.369]] AA_SCO= 2.6357894736842105 CA_SCO= -0.021421052631578952
[['A', ' CA ', 151.454, 137.672, 95.011]] AA_SCO= 2.5842105263157897 CA_SCO= -0.02347368421052632
[['A', ' CA ', 154.209, 139.868, 92.147]] AA_SCO= 2.5752631578947374 CA_SCO= -0.02010526315789474
[['A', ' CA ', 151.307, 142.24, 90.601]] AA_SCO= 2.5721052631578947 CA_SCO= -0.0168421052631579
[['A', ' CA ', 149.87, 143.087, 94.735]] AA_SCO= 2.580526315789474 CA_SCO= -0.02305263157894737
[['A', ' CA ', 153.211, 143.193, 97.296]] AA_SCO= 2.538421052631579 CA_SCO= -0.016315789473684218
[['A', ' CA ', 156.373, 143.808, 94.398]] AA_SCO= 2.552105263157895 CA_SCO= -0.00810526315789474
[['A', ' CA ', 154.057, 146.017, 91.364]] AA_SCO= 2.5731578947368416 CA_SCO= 0.0021052631578947364
[['A', ' CA ', 154.448, 143.527, 87.723]] AA_SCO= 2.441052631578947 CA_SCO= 0.006315789473684209
[['A', ' CA ', 150.879, 145.181, 86.185]] AA_SCO= 2.406842105263158 CA_SCO= 0.009894736842105262
[['A', ' CA ', 151.782, 142.781, 82.49]] AA_SCO= 2.407368421052632 CA_SCO= 0.010736842105263156
[['A', ' CA ', 148.48, 140.239, 82.919]] AA_SCO= 2.4073684210526314 CA_SCO= 0.01026315789473684
[['A', ' CA ', 148.287, 137.01, 79.722]] AA_SCO= 2.349473684210526 CA_SCO= 0.010894736842105261
[['A', ' CA ', 149.937, 133.232, 80.202]] AA_SCO= 2.3499999999999996 CA_SCO= 0.01089473684210526
[['A', ' CA ', 153.897, 134.282, 78.797]] AA_SCO= 2.3521052631578945 CA_SCO= 0.01084210526315789
[['A', ' CA ', 153.715, 137.321, 82.12]] AA_SCO= 2.361052631578947 CA_SCO= 0.006052631578947365
[['A', ' CA ', 152.19, 134.17, 84.729]] AA_SCO= 2.406315789473684 CA_SCO= 0.006789473684210525
[['A', ' CA ', 155.225, 131.588, 83.257]] AA_SCO= 2.4126315789473685 CA_SCO= 0.01836842105263158
[['A', ' CA ', 158.222, 134.609, 83.349]] AA_SCO= 2.3652631578947365 CA_SCO= 0.029842105263157892
[['A', ' CA ', 156.606, 136.159, 87.099]] AA_SCO= 2.374736842105263 CA_SCO= 0.03010526315789474
[['A', ' CA ', 157.364, 131.892, 88.702]] AA_SCO= 2.3578947368421055 CA_SCO= 0.037052631578947365
[['A', ' CA ', 161.167, 131.888, 87.023]] AA_SCO= 2.375263157894737 CA_SCO= 0.03810526315789473
[['A', ' CA ', 161.719, 136.066, 88.481]] AA_SCO= 2.358421052631579 CA_SCO= 0.04052631578947369
[['A', ' CA ', 159.578, 135.304, 92.225]] AA_SCO= 2.3578947368421055 CA_SCO= 0.04689473684210527
[['A', ' CA ', 162.062, 131.477, 92.477]] AA_SCO= 2.4084210526315797 CA_SCO= 0.04705263157894737
[['A', ' CA ', 165.511, 134.753, 92.412]] AA_SCO= 2.426315789473685 CA_SCO= 0.04705263157894737
[['A', ' CA ', 163.203, 136.896, 95.367]] AA_SCO= 2.407368421052632 CA_SCO= 0.047578947368421054
[['A', ' CA ', 162.512, 133.219, 97.794]] AA_SCO= 2.5068421052631575 CA_SCO= 0.050368421052631576
[['A', ' CA ', 166.379, 131.736, 97.201]] AA_SCO= 2.4721052631578946 CA_SCO= 0.04994736842105263
[['A', ' CA ', 168.157, 135.65, 98.226]] AA_SCO= 2.4878947368421045 CA_SCO= 0.04873684210526317
[['A', ' CA ', 165.045, 136.001, 101.631]] AA_SCO= 2.4326315789473685 CA_SCO= 0.04873684210526317
[['A', ' CA ', 166.404, 131.909, 102.531]] AA_SCO= 2.416842105263158 CA_SCO= 0.04605263157894738
[['A', ' CA ', 170.222, 132.907, 101.995]] AA_SCO= 2.3447368421052635 CA_SCO= 0.04205263157894738
[['A', ' CA ', 169.554, 136.732, 104.134]] AA_SCO= 2.3515789473684214 CA_SCO= 0.04194736842105264
[['A', ' CA ', 167.251, 134.3, 107.159]] AA_SCO= 2.3552631578947367 CA_SCO= 0.045894736842105266
[['A', ' CA ', 170.237, 131.192, 107.124]] AA_SCO= 2.3168421052631585 CA_SCO= 0.04331578947368422
[['A', ' CA ', 173.188, 134.263, 107.682]] AA_SCO= 2.3852631578947374 CA_SCO= 0.042421052631578963
[['A', ' CA ', 170.299, 136.443, 110.722]] AA_SCO= 2.3710526315789475 CA_SCO= 0.03347368421052633
[['A', ' CA ', 168.618, 132.577, 112.415]] AA_SCO= 2.3026315789473686 CA_SCO= -0.0054736842105263086
[['A', ' CA ', 171.013, 132.091, 115.719]] AA_SCO= 2.356315789473684 CA_SCO= -0.03578947368421053
[['A', ' CA ', 170.9, 127.854, 115.572]] AA_SCO= 2.279473684210526 CA_SCO= -0.06757894736842107
[['A', ' CA ', 171.536, 126.799, 119.339]] AA_SCO= 2.1605263157894736 CA_SCO= -0.07842105263157895
[['A', ' CA ', 168.144, 129.472, 121.119]] AA_SCO= 2.1873684210526307 CA_SCO= -0.08273684210526315
[['A', ' CA ', 165.08, 126.373, 121.012]] AA_SCO= 2.1926315789473687 CA_SCO= -0.08447368421052633
[['A', ' CA ', 162.912, 126.114, 117.93]] AA_SCO= 2.0694736842105264 CA_SCO= -0.10163157894736842
[['A', ' CA ', 159.878, 124.11, 119.285]] AA_SCO= 1.953157894736842 CA_SCO= -0.11226315789473684
[['A', ' CA ', 157.028, 125.169, 121.64]] AA_SCO= 1.958421052631579 CA_SCO= -0.11584210526315787
[['A', ' CA ', 155.713, 123.959, 124.905]] AA_SCO= 1.9778947368421047 CA_SCO= -0.11873684210526314
[['A', ' CA ', 151.906, 123.074, 124.791]] AA_SCO= 1.9789473684210528 CA_SCO= -0.11842105263157894
[['A', ' CA ', 147.965, 122.649, 125.719]] AA_SCO= 1.9573684210526319 CA_SCO= -0.11810526315789473
[['A', ' CA ', 147.088, 120.867, 122.518]] AA_SCO= 1.9731578947368422 CA_SCO= -0.12773684210526315
[['A', ' CA ', 143.507, 119.858, 123.587]] AA_SCO= 2.021052631578948 CA_SCO= -0.124
[['A', ' CA ', 142.245, 123.486, 121.894]] AA_SCO= 1.885789473684211 CA_SCO= -0.12394736842105263
[['A', ' CA ', 138.811, 125.039, 123.371]] AA_SCO= 1.8189473684210526 CA_SCO= -0.1238421052631579
[['A', ' CA ', 137.809, 124.889, 119.566]] AA_SCO= 1.838421052631579 CA_SCO= -0.12394736842105263
[['A', ' CA ', 138.086, 128.594, 118.191]] AA_SCO= 1.8547368421052628 CA_SCO= -0.13831578947368425
[['A', ' CA ', 139.087, 127.442, 114.471]] AA_SCO= 1.859473684210526 CA_SCO= -0.13047368421052633
[['A', ' CA ', 143.136, 128.732, 113.637]] AA_SCO= 1.9294736842105262 CA_SCO= -0.09594736842105264
[['A', ' CA ', 143.11, 129.478, 109.438]] AA_SCO= 1.9357894736842103 CA_SCO= -0.06610526315789475
[['A', ' CA ', 147.251, 129.772, 108.909]] AA_SCO= 1.933157894736842 CA_SCO= -0.035157894736842096
[['A', ' CA ', 147.572, 130.245, 104.696]] AA_SCO= 2.059473684210526 CA_SCO= -0.023947368421052627
[['A', ' CA ', 151.33, 130.284, 103.734]] AA_SCO= 2.007894736842105 CA_SCO= -0.020894736842105268
[['A', ' CA ', 151.663, 130.957, 99.756]] AA_SCO= 2.0373684210526317 CA_SCO= -0.019842105263157894
[['A', ' CA ', 152.921, 127.636, 98.387]] AA_SCO= 2.1426315789473684 CA_SCO= -0.0026842105263157924
[['A', ' CA ', 154.884, 127.871, 94.819]] AA_SCO= 2.1873684210526316 CA_SCO= 0.01268421052631579
[['A', ' CA ', 151.306, 128.205, 92.972]] AA_SCO= 2.18 CA_SCO= 0.016473684210526317
[['A', ' CA ', 149.282, 130.401, 95.413]] AA_SCO= 2.0421052631578944 CA_SCO= 0.018526315789473682
[['A', ' CA ', 147.859, 130.883, 98.977]] AA_SCO= 2.0294736842105263 CA_SCO= 0.01794736842105263
[['A', ' CA ', 146.995, 127.472, 100.62]] AA_SCO= 2.0805263157894736 CA_SCO= 0.018210526315789476
[['A', ' CA ', 145.148, 128.684, 103.579]] AA_SCO= 1.9589473684210532 CA_SCO= 0.03042105263157895
[['A', ' CA ', 143.601, 125.273, 105.62]] AA_SCO= 1.9831578947368425 CA_SCO= 0.029105263157894738
[['A', ' CA ', 141.77, 126.558, 108.954]] AA_SCO= 2.0084210526315793 CA_SCO= 0.027842105263157897
[['A', ' CA ', 140.818, 123.51, 111.319]] AA_SCO= 2.0826315789473693 CA_SCO= 0.028578947368421054
[['A', ' CA ', 139.48, 124.192, 115.135]] AA_SCO= 2.0752631578947374 CA_SCO= 0.030263157894736846
[['A', ' CA ', 140.639, 120.959, 117.62]] AA_SCO= 2.0368421052631587 CA_SCO= 0.04363157894736844
[['A', ' CA ', 138.608, 121.254, 120.857]] AA_SCO= 2.0468421052631585 CA_SCO= 0.04405263157894738
[['A', ' CA ', 139.087, 118.096, 123.273]] AA_SCO= 2.0236842105263158 CA_SCO= 0.04563157894736843
[['A', ' CA ', 143.041, 116.762, 122.213]] AA_SCO= 1.9763157894736845 CA_SCO= 0.044210526315789485
[['A', ' CA ', 141.653, 115.675, 118.068]] AA_SCO= 1.9494736842105262 CA_SCO= 0.04326315789473686
[['A', ' CA ', 140.577, 118.343, 115.468]] AA_SCO= 1.9431578947368422 CA_SCO= 0.04289473684210527
[['A', ' CA ', 136.562, 118.19, 115.005]] AA_SCO= 1.9731578947368422 CA_SCO= 0.0418421052631579
[['A', ' CA ', 136.631, 120.189, 111.253]] AA_SCO= 2.075789473684211 CA_SCO= 0.04110526315789475
[['A', ' CA ', 140.128, 121.026, 109.265]] AA_SCO= 2.1157894736842104 CA_SCO= 0.04110526315789474
[['A', ' CA ', 139.099, 122.055, 105.55]] AA_SCO= 2.150526315789474 CA_SCO= 0.03978947368421054
[['A', ' CA ', 142.192, 123.26, 103.514]] AA_SCO= 2.1889473684210525 CA_SCO= 0.037105263157894745
[['A', ' CA ', 141.603, 125.124, 99.99]] AA_SCO= 2.3410526315789477 CA_SCO= 0.03631578947368422
[['A', ' CA ', 144.963, 124.998, 98.488]] AA_SCO= 2.365263157894737 CA_SCO= 0.03489473684210527
[['A', ' CA ', 145.808, 127.543, 95.868]] AA_SCO= 2.365263157894737 CA_SCO= 0.034315789473684216
[['A', ' CA ', 145.082, 125.29, 92.438]] AA_SCO= 2.500526315789474 CA_SCO= 0.0338421052631579
[['A', ' CA ', 141.414, 124.777, 93.617]] AA_SCO= 2.491578947368421 CA_SCO= 0.035473684210526324
[['A', ' CA ', 140.608, 128.677, 93.256]] AA_SCO= 2.551052631578948 CA_SCO= 0.035631578947368424
[['A', ' CA ', 142.587, 129.071, 89.661]] AA_SCO= 2.503684210526316 CA_SCO= 0.035526315789473684
[['A', ' CA ', 140.72, 125.726, 88.524]] AA_SCO= 2.4115789473684215 CA_SCO= 0.03531578947368422
[['A', ' CA ', 137.182, 127.396, 87.723]] AA_SCO= 2.4373684210526316 CA_SCO= 0.03694736842105264
[['A', ' CA ', 139.195, 131.051, 86.099]] AA_SCO= 2.460000000000001 CA_SCO= 0.034473684210526316
[['A', ' CA ', 141.859, 128.598, 83.677]] AA_SCO= 2.506842105263158 CA_SCO= 0.03531578947368421
[['A', ' CA ', 138.714, 126.797, 81.884]] AA_SCO= 2.5284210526315793 CA_SCO= 0.03689473684210527
[['A', ' CA ', 136.589, 129.97, 81.083]] AA_SCO= 2.653684210526316 CA_SCO= 0.037842105263157906
[['A', ' CA ', 140.625, 132.422, 80.142]] AA_SCO= 2.652631578947368 CA_SCO= 0.03878947368421053
[['A', ' CA ', 141.289, 129.463, 77.019]] AA_SCO= 2.668421052631579 CA_SCO= 0.040000000000000015
[['A', ' CA ', 137.411, 130.996, 75.351]] AA_SCO= 2.571578947368421 CA_SCO= 0.04047368421052632
[['A', ' CA ', 138.238, 133.893, 72.426]] AA_SCO= 2.53421052631579 CA_SCO= 0.040157894736842115
[['A', ' CA ', 141.609, 132.181, 70.567]] AA_SCO= 2.5531578947368416 CA_SCO= 0.040789473684210535
[['A', ' CA ', 142.1, 128.596, 68.586]] AA_SCO= 2.5489473684210524 CA_SCO= 0.04136842105263159
[['A', ' CA ', 141.434, 125.608, 71.285]] AA_SCO= 2.541578947368421 CA_SCO= 0.04352631578947369
[['A', ' CA ', 145.694, 124.017, 70.651]] AA_SCO= 2.563684210526316 CA_SCO= 0.04631578947368423
[['A', ' CA ', 146.975, 127.419, 73.051]] AA_SCO= 2.412631578947368 CA_SCO= 0.037210526315789486
[['A', ' CA ', 143.637, 127.141, 75.341]] AA_SCO= 2.4105263157894736 CA_SCO= 0.03721052631578949
[['A', ' CA ', 145.689, 123.819, 76.898]] AA_SCO= 2.444210526315789 CA_SCO= 0.036947368421052645
[['A', ' CA ', 149.432, 125.96, 77.376]] AA_SCO= 2.483684210526316 CA_SCO= 0.03368421052631579
[['A', ' CA ', 147.235, 129.288, 79.378]] AA_SCO= 2.4236842105263157 CA_SCO= 0.021842105263157892
[['A', ' CA ', 145.855, 126.18, 81.997]] AA_SCO= 2.488947368421053 CA_SCO= 0.019052631578947366
[['A', ' CA ', 149.963, 124.507, 82.001]] AA_SCO= 2.466315789473684 CA_SCO= 0.018368421052631576
[['A', ' CA ', 151.237, 128.383, 82.676]] AA_SCO= 2.437894736842105 CA_SCO= 0.021263157894736838
[['A', ' CA ', 149.088, 128.393, 85.944]] AA_SCO= 2.1652631578947363 CA_SCO= 0.013736842105263153
[['A', ' CA ', 151.146, 125.187, 86.833]] AA_SCO= 2.1722222222222225 CA_SCO= 0.01133333333333333
[['A', ' CA ', 148.13, 123.253, 88.069]] AA_SCO= 2.0923529411764705 CA_SCO= 0.009235294117647057
[['A', ' CA ', 148.825, 120.735, 90.822]] AA_SCO= 2.0725000000000002 CA_SCO= 0.0060624999999999984
[['A', ' CA ', 145.446, 118.726, 90.69]] AA_SCO= 2.02 CA_SCO= 0.0037999999999999996
[['A', ' CA ', 146.109, 116.306, 93.604]] AA_SCO= 1.9285714285714284 CA_SCO= 0.0009285714285714274
[['A', ' CA ', 146.035, 119.543, 95.859]] AA_SCO= 1.8869230769230767 CA_SCO= -0.0033076923076923084
[['A', ' CA ', 142.914, 120.99, 94.047]] AA_SCO= 1.854166666666667 CA_SCO= -0.007583333333333335
[['A', ' CA ', 140.847, 117.736, 94.761]] AA_SCO= 1.729090909090909 CA_SCO= -0.010272727272727274
[['A', ' CA ', 142.148, 119.148, 99.634]] AA_SCO= 1.6600000000000001 CA_SCO= -0.0175
[['B', ' CA ', 142.641, 116.11, 98.037]]
[['B', ' CA ', 163.485, 99.773, 77.396]]
[['B', ' CA ', 160.14, 101.961, 77.421]]
[['B', ' CA ', 158.236, 102.261, 80.99]]
[['B', ' CA ', 155.048, 104.762, 81.342]]
[['B', ' CA ', 154.371, 106.351, 85.121]]
[['B', ' CA ', 150.55, 106.094, 84.923]]
[['B', ' CA ', 149.356, 107.777, 88.171]]
[['B', ' CA ', 146.189, 106.365, 89.625]]
[['B', ' CA ', 145.653, 108.416, 92.841]]
[['B', ' CA ', 150.551, 112.144, 95.132]]
[['B', ' CA ', 152.697, 113.033, 92.721]]
[['B', ' CA ', 155.995, 112.896, 95.212]]
[['B', ' CA ', 157.073, 109.253, 93.496]]
[['B', ' CA ', 157.543, 110.412, 89.529]]
[['B', ' CA ', 159.567, 114.093, 91.098]]
[['B', ' CA ', 161.811, 111.346, 93.637]]
[['B', ' CA ', 162.787, 109.241, 89.834]]
[['B', ' CA ', 163.732, 113.264, 88.17]]
[['B', ' CA ', 165.642, 114.24, 91.828]]
[['B', ' CA ', 168.619, 111.129, 90.872]]
[['B', ' CA ', 169.599, 115.094, 89.038]]
[['B', ' CA ', 173.493, 114.311, 87.791]]
[['B', ' CA ', 172.191, 110.91, 84.917]]
[['B', ' CA ', 167.819, 112.017, 84.853]]
[['B', ' CA ', 168.191, 114.367, 81.366]]
[['B', ' CA ', 170.767, 110.874, 79.858]]
[['B', ' CA ', 168.005, 108.142, 81.875]]
[['B', ' CA ', 164.577, 109.739, 80.198]]
[['B', ' CA ', 166.372, 110.585, 76.297]]
[['B', ' CA ', 169.592, 108.02, 75.895]]
[['B', ' CA ', 169.16, 104.772, 78.083]]
[['B', ' CA ', 164.965, 104.087, 79.198]]
[['B', ' CA ', 162.145, 106.705, 76.979]]
[['B', ' CA ', 158.95, 106.771, 79.254]]
[['B', ' CA ', 155.82, 107.147, 76.331]]
[['B', ' CA ', 152.598, 107.479, 78.169]]
[['B', ' CA ', 153.067, 109.294, 81.789]]
[['B', ' CA ', 150.734, 112.272, 80.619]]
[['B', ' CA ', 152.578, 114.204, 83.687]]
[['B', ' CA ', 156.538, 114.224, 81.794]]
[['B', ' CA ', 155.389, 113.522, 77.4]]
[['B', ' CA ', 151.452, 114.515, 75.982]]
[['B', ' CA ', 149.867, 110.673, 73.635]]
[['B', ' CA ', 146.848, 109.218, 75.742]]
[['B', ' CA ', 145.674, 105.818, 74.574]]
[['B', ' CA ', 148.404, 103.71, 75.862]]
[['B', ' CA ', 151.135, 102.364, 73.661]]
[['B', ' CA ', 152.736, 98.886, 74.741]]
[['B', ' CA ', 155.508, 99.835, 77.184]]
[['B', ' CA ', 157.533, 96.607, 78.88]]
[['B', ' CA ', 157.625, 97.949, 83.062]]
[['B', ' CA ', 154.798, 100.694, 83.492]]
[['B', ' CA ', 155.432, 101.578, 87.266]]
[['B', ' CA ', 151.852, 102.939, 88.493]]
[['B', ' CA ', 151.954, 105.57, 91.354]]
[['B', ' CA ', 149.467, 105.286, 94.016]]
[['B', ' CA ', 145.917, 104.117, 94.931]]
[['B', ' CA ', 143.105, 102.296, 93.726]]
[['B', ' CA ', 139.896, 103.977, 94.732]]
[['B', ' CA ', 137.438, 101.157, 93.263]]
[['B', ' CA ', 133.684, 103.478, 93.234]]
[['B', ' CA ', 135.405, 105.971, 90.152]]
[['B', ' CA ', 135.507, 103.295, 87.114]]
[['B', ' CA ', 138.745, 105.665, 84.638]]
[['B', ' CA ', 141.813, 104.371, 87.356]]
[['B', ' CA ', 140.408, 100.586, 87.701]]
[['B', ' CA ', 139.484, 100.286, 83.407]]
[['B', ' CA ', 143.27, 102.309, 82.598]]
[['B', ' CA ', 145.328, 99.676, 85.429]]
[['B', ' CA ', 143.022, 96.056, 83.645]]
[['B', ' CA ', 144.361, 97.868, 79.544]]
[['B', ' CA ', 148.29, 98.713, 81.422]]
[['B', ' CA ', 148.113, 94.761, 82.989]]
[['B', ' CA ', 147.065, 93.671, 79.405]]
[['B', ' CA ', 149.87, 96.149, 77.219]]
[['B', ' CA ', 153.058, 97.135, 80.373]]
[['B', ' CA ', 154.67, 93.508, 80.608]]
[['B', ' CA ', 155.61, 93.91, 84.22]]
[['B', ' CA ', 153.836, 96.819, 86.014]]
[['B', ' CA ', 155.811, 97.31, 89.474]]
[['B', ' CA ', 153.822, 100.069, 91.594]]
[['B', ' CA ', 156.18, 102.478, 92.911]]
[['B', ' CA ', 155.605, 103.999, 96.0]]
[['B', ' CA ', 153.854, 102.948, 98.753]]
[['B', ' CA ', 150.552, 103.972, 97.715]]
[['B', ' CA ', 150.029, 101.306, 94.879]]
[['B', ' CA ', 151.901, 98.447, 96.69]]
[['B', ' CA ', 150.195, 98.682, 100.608]]
[['B', ' CA ', 148.034, 101.417, 100.814]]
[['B', ' CA ', 149.922, 104.231, 102.651]]
[['B', ' CA ', 147.776, 106.859, 103.935]]
[['B', ' CA ', 144.897, 106.167, 101.609]]
[['B', ' CA ', 143.777, 103.139, 103.813]]
[['B', ' CA ', 142.877, 105.656, 106.91]]
[['B', ' CA ', 140.208, 107.828, 104.098]]
[['B', ' CA ', 136.652, 107.029, 105.491]]
[['B', ' CA ', 134.615, 108.575, 102.362]]
[['B', ' CA ', 132.515, 111.879, 102.76]]
[['B', ' CA ', 134.736, 115.008, 101.741]]
[['B', ' CA ', 133.624, 117.645, 99.145]]
[['B', ' CA ', 133.929, 117.128, 95.513]]
[['B', ' CA ', 132.752, 113.741, 95.228]]
[['B', ' CA ', 131.865, 112.62, 98.994]]
[['B', ' CA ', 131.105, 108.307, 98.082]]
[['B', ' CA ', 135.145, 107.378, 96.586]]
[['B', ' CA ', 135.968, 106.28, 100.67]]
[['B', ' CA ', 137.46, 102.739, 99.36]]
[['B', ' CA ', 141.087, 103.09, 97.763]]
[['B', ' CA ', 143.19, 99.538, 98.241]]
[['B', ' CA ', 146.981, 99.815, 96.847]]
[['B', ' CA ', 146.521, 98.288, 92.792]]
[['B', ' CA ', 148.036, 94.611, 93.414]]
[['B', ' CA ', 144.369, 93.218, 95.157]]
[['B', ' CA ', 142.56, 94.064, 91.181]]
[['B', ' CA ', 145.831, 93.735, 88.634]]
[['B', ' CA ', 148.815, 91.053, 89.51]]
[['B', ' CA ', 151.947, 92.772, 90.34]]
[['B', ' CA ', 155.206, 91.502, 89.028]]
[['B', ' CA ', 157.628, 93.891, 91.375]]
[['B', ' CA ', 155.829, 96.268, 94.605]]
[['B', ' CA ', 158.951, 99.189, 94.978]]
[['B', ' CA ', 157.771, 100.762, 98.517]]
[['B', ' CA ', 158.562, 104.13, 100.001]]
[['B', ' CA ', 156.831, 107.821, 101.575]]
[['B', ' CA ', 158.779, 109.169, 98.821]]
[['B', ' CA ', 160.521, 106.028, 96.779]]
[['B', ' CA ', 163.981, 107.327, 97.888]]
[['B', ' CA ', 165.173, 108.717, 93.944]]
[['B', ' CA ', 168.854, 106.17, 93.926]]
[['B', ' CA ', 166.697, 102.505, 94.35]]
[['B', ' CA ', 163.927, 103.558, 91.522]]
[['B', ' CA ', 167.238, 104.972, 89.043]]
[['B', ' CA ', 169.764, 101.557, 90.458]]
[['B', ' CA ', 166.15, 98.805, 90.2]]
[['B', ' CA ', 164.945, 100.784, 86.399]]
[['B', ' CA ', 169.146, 100.599, 85.023]]
[['B', ' CA ', 169.304, 96.654, 86.578]]
[['B', ' CA ', 165.469, 95.744, 84.403]]
[['B', ' CA ', 167.593, 98.051, 81.03]]
[['B', ' CA ', 171.308, 95.887, 81.74]]
[['B', ' CA ', 167.186, 92.364, 83.2]]
[['B', ' CA ', 169.991, 91.646, 86.889]]
[['B', ' CA ', 166.333, 90.592, 88.147]]
[['B', ' CA ', 168.602, 88.56, 91.414]]
[['B', ' CA ', 168.967, 92.593, 93.225]]
[['B', ' CA ', 164.882, 93.161, 92.014]]
[['B', ' CA ', 163.895, 89.114, 93.119]]
[['B', ' CA ', 163.869, 90.802, 97.232]]
[['B', ' CA ', 161.148, 93.981, 95.488]]
[['B', ' CA ', 159.191, 91.071, 92.99]]
[['B', ' CA ', 158.773, 88.614, 96.822]]
[['B', ' CA ', 157.372, 92.356, 98.664]]
[['B', ' CA ', 154.691, 92.924, 95.263]]
[['B', ' CA ', 152.716, 89.862, 97.817]]
[['B', ' CA ', 152.743, 92.23, 101.217]]
[['B', ' CA ', 150.151, 95.003, 100.352]]
[['B', ' CA ', 148.956, 96.106, 103.959]]
[['B', ' CA ', 152.252, 97.478, 105.572]]
[['B', ' CA ', 151.839, 99.467, 109.127]]
[['B', ' CA ', 155.016, 99.519, 112.368]]
[['B', ' CA ', 153.114, 96.734, 114.92]]
[['B', ' CA ', 153.862, 94.131, 111.073]]
[['B', ' CA ', 158.015, 94.858, 112.897]]
[['B', ' CA ', 156.2, 93.719, 116.825]]
[['B', ' CA ', 154.002, 90.851, 115.106]]
[['B', ' CA ', 156.167, 89.58, 111.975]]
[['B', ' CA ', 160.072, 90.163, 113.513]]
[['B', ' CA ', 160.558, 91.438, 117.805]]
[['B', ' CA ', 157.188, 88.965, 119.066]]
[['B', ' CA ', 158.611, 85.604, 116.868]]
[['B', ' CA ', 162.109, 86.837, 119.188]]
[['B', ' CA ', 164.095, 87.954, 115.864]]
[['B', ' CA ', 164.646, 92.155, 116.902]]
[['B', ' CA ', 167.997, 92.786, 117.742]]
[['B', ' CA ', 167.89, 96.765, 118.95]]
[['B', ' CA ', 168.909, 98.108, 115.79]]
[['B', ' CA ', 167.184, 101.22, 115.124]]
[['B', ' CA ', 167.088, 100.422, 110.789]]
[['B', ' CA ', 163.316, 100.535, 111.166]]
[['B', ' CA ', 163.357, 104.284, 113.369]]
[['B', ' CA ', 166.514, 105.526, 110.651]]
[['B', ' CA ', 163.991, 104.477, 107.441]]
[['B', ' CA ', 160.629, 105.727, 108.976]]
[['B', ' CA ', 160.288, 108.722, 106.684]]
[['B', ' CA ', 157.093, 110.364, 108.733]]
[['B', ' CA ', 159.509, 110.067, 112.025]]
[['B', ' CA ', 156.872, 108.154, 114.099]]
[['B', ' CA ', 158.704, 104.966, 115.549]]
[['B', ' CA ', 161.828, 106.04, 117.794]]
[['B', ' CA ', 163.379, 102.895, 119.566]]
[['B', ' CA ', 163.078, 103.217, 123.638]]
[['B', ' CA ', 164.978, 100.581, 125.69]]
[['B', ' CA ', 166.768, 99.135, 122.277]]
[['B', ' CA ', 163.312, 97.417, 120.375]]
[['B', ' CA ', 161.478, 100.367, 118.271]]
[['B', ' CA ', 157.85, 101.999, 119.851]]
[['B', ' CA ', 156.078, 103.602, 116.891]]
[['B', ' CA ', 153.562, 106.636, 117.896]]
[['B', ' CA ', 150.911, 105.105, 115.444]]
[['B', ' CA ', 148.968, 109.074, 114.637]]
[['B', ' CA ', 152.501, 110.121, 112.343]]
[['B', ' CA ', 152.198, 106.069, 110.954]]
[['B', ' CA ', 151.332, 106.431, 107.323]]
[['B', ' CA ', 150.851, 102.812, 106.496]]
[['B', ' CA ', 153.865, 102.336, 103.951]]
[['B', ' CA ', 155.567, 98.96, 105.536]]
[['B', ' CA ', 159.371, 100.668, 104.457]]
[['B', ' CA ', 160.579, 100.293, 108.216]]
[['B', ' CA ', 159.889, 96.474, 108.084]]
[['B', ' CA ', 161.472, 95.957, 104.337]]
[['B', ' CA ', 164.8, 97.831, 105.729]]
[['B', ' CA ', 164.365, 95.561, 109.601]]
[['B', ' CA ', 167.691, 93.486, 108.6]]
[['B', ' CA ', 165.777, 90.444, 110.499]]
[['B', ' CA ', 162.708, 90.543, 107.728]]
[['B', ' CA ', 164.681, 89.25, 104.709]]
[['B', ' CA ', 168.726, 89.594, 104.369]]
[['B', ' CA ', 170.02, 89.84, 100.732]]
[['B', ' CA ', 173.786, 88.37, 101.79]]
[['B', ' CA ', 175.635, 87.701, 98.39]]
[['B', ' CA ', 174.142, 91.21, 96.277]]
[['B', ' CA ', 175.597, 93.269, 99.542]]
[['B', ' CA ', 179.053, 91.328, 99.676]]
[['B', ' CA ', 179.063, 91.322, 95.466]]
[['B', ' CA ', 178.719, 95.821, 95.636]]
[['B', ' CA ', 181.125, 96.218, 98.69]]
[['B', ' CA ', 142.641, 116.11, 98.037]] AA_SCO= -1.2433333333333334 CA_SCO= 0.007333333333333331
[['B', ' CA ', 163.485, 99.773, 77.396]] AA_SCO= -0.9445454545454548 CA_SCO= -0.011818181818181821
[['B', ' CA ', 160.14, 101.961, 77.421]] AA_SCO= -0.6975000000000002 CA_SCO= -0.008750000000000003
[['B', ' CA ', 158.236, 102.261, 80.99]] AA_SCO= -0.4438461538461541 CA_SCO= -0.007769230769230772
[['B', ' CA ', 155.048, 104.762, 81.342]] AA_SCO= -0.3385714285714288 CA_SCO= -0.028142857142857143
[['B', ' CA ', 154.371, 106.351, 85.121]] AA_SCO= -0.15533333333333352 CA_SCO= -0.023600000000000003
[['B', ' CA ', 150.55, 106.094, 84.923]] AA_SCO= -0.03437500000000017 CA_SCO= -0.018250000000000002
[['B', ' CA ', 149.356, 107.777, 88.171]] AA_SCO= 0.10588235294117632 CA_SCO= -0.014352941176470591
[['B', ' CA ', 146.189, 106.365, 89.625]] AA_SCO= 0.23888888888888873 CA_SCO= -0.018333333333333337
[['B', ' CA ', 145.653, 108.416, 92.841]] AA_SCO= 0.5327777777777778 CA_SCO= -0.013888888888888892
[['B', ' CA ', 150.551, 112.144, 95.132]] AA_SCO= 0.6273684210526316 CA_SCO= -0.009894736842105267
[['B', ' CA ', 152.697, 113.033, 92.721]] AA_SCO= 0.8326315789473685 CA_SCO= -0.009368421052631578
[['B', ' CA ', 155.995, 112.896, 95.212]] AA_SCO= 0.9347368421052632 CA_SCO= -0.006473684210526315
[['B', ' CA ', 157.073, 109.253, 93.496]] AA_SCO= 1.1426315789473684 CA_SCO= -0.011263157894736843
[['B', ' CA ', 157.543, 110.412, 89.529]] AA_SCO= 1.1742105263157894 CA_SCO= -0.016473684210526317
[['B', ' CA ', 159.567, 114.093, 91.098]] AA_SCO= 1.335263157894737 CA_SCO= -0.01942105263157895
[['B', ' CA ', 161.811, 111.346, 93.637]] AA_SCO= 1.541578947368421 CA_SCO= -0.02121052631578947
[['B', ' CA ', 162.787, 109.241, 89.834]] AA_SCO= 1.6463157894736842 CA_SCO= -0.02299999999999999
[['B', ' CA ', 163.732, 113.264, 88.17]] AA_SCO= 1.7221052631578944 CA_SCO= -0.01357894736842105
[['B', ' CA ', 165.642, 114.24, 91.828]] AA_SCO= 1.9984210526315789 CA_SCO= -0.00894736842105263
[['B', ' CA ', 168.619, 111.129, 90.872]] AA_SCO= 1.8494736842105268 CA_SCO= -0.008789473684210526
[['B', ' CA ', 169.599, 115.094, 89.038]] AA_SCO= 1.882105263157895 CA_SCO= -0.01026315789473684
[['B', ' CA ', 173.493, 114.311, 87.791]] AA_SCO= 1.793157894736842 CA_SCO= -0.0075263157894736865
[['B', ' CA ', 172.191, 110.91, 84.917]] AA_SCO= 1.874736842105263 CA_SCO= 0.010421052631578947
[['B', ' CA ', 167.819, 112.017, 84.853]] AA_SCO= 1.8499999999999999 CA_SCO= 0.011473684210526316
[['B', ' CA ', 168.191, 114.367, 81.366]] AA_SCO= 1.9015789473684208 CA_SCO= 0.011473684210526316
[['B', ' CA ', 170.767, 110.874, 79.858]] AA_SCO= 1.8989473684210525 CA_SCO= 0.0074736842105263155
[['B', ' CA ', 168.005, 108.142, 81.875]] AA_SCO= 1.9621052631578948 CA_SCO= 0.006578947368421052
[['B', ' CA ', 164.577, 109.739, 80.198]] AA_SCO= 2.0231578947368423 CA_SCO= -0.006052631578947368
[['B', ' CA ', 166.372, 110.585, 76.297]] AA_SCO= 2.058947368421053 CA_SCO= -0.006210526315789474
[['B', ' CA ', 169.592, 108.02, 75.895]] AA_SCO= 2.0726315789473686 CA_SCO= -0.006421052631578948
[['B', ' CA ', 169.16, 104.772, 78.083]] AA_SCO= 2.0278947368421054 CA_SCO= -0.005263157894736844
[['B', ' CA ', 164.965, 104.087, 79.198]] AA_SCO= 2.075789473684211 CA_SCO= -0.0007368421052631586
[['B', ' CA ', 162.145, 106.705, 76.979]] AA_SCO= 2.1678947368421055 CA_SCO= 0.0013684210526315793
[['B', ' CA ', 158.95, 106.771, 79.254]] AA_SCO= 2.048421052631579 CA_SCO= 0.004105263157894737
[['B', ' CA ', 155.82, 107.147, 76.331]] AA_SCO= 2.0084210526315793 CA_SCO= -0.01457894736842105
[['B', ' CA ', 152.598, 107.479, 78.169]] AA_SCO= 2.005789473684211 CA_SCO= -0.02089473684210526
[['B', ' CA ', 153.067, 109.294, 81.789]] AA_SCO= 2.187894736842105 CA_SCO= -0.021842105263157895
[['B', ' CA ', 150.734, 112.272, 80.619]] AA_SCO= 2.238947368421053 CA_SCO= -0.03226315789473684
[['B', ' CA ', 152.578, 114.204, 83.687]] AA_SCO= 2.265263157894737 CA_SCO= -0.02236842105263158
[['B', ' CA ', 156.538, 114.224, 81.794]] AA_SCO= 2.307894736842105 CA_SCO= -0.020157894736842107
[['B', ' CA ', 155.389, 113.522, 77.4]] AA_SCO= 2.30421052631579 CA_SCO= -0.019842105263157894
[['B', ' CA ', 151.452, 114.515, 75.982]] AA_SCO= 2.2436842105263164 CA_SCO= -0.019157894736842106
[['B', ' CA ', 149.867, 110.673, 73.635]] AA_SCO= 2.2478947368421056 CA_SCO= -0.025421052631578945
[['B', ' CA ', 146.848, 109.218, 75.742]] AA_SCO= 2.2463157894736847 CA_SCO= -0.02594736842105263
[['B', ' CA ', 145.674, 105.818, 74.574]] AA_SCO= 2.2557894736842106 CA_SCO= -0.021263157894736838
[['B', ' CA ', 148.404, 103.71, 75.862]] AA_SCO= 2.1384210526315783 CA_SCO= -0.014315789473684205
[['B', ' CA ', 151.135, 102.364, 73.661]] AA_SCO= 2.151578947368421 CA_SCO= -0.01436842105263158
[['B', ' CA ', 152.736, 98.886, 74.741]] AA_SCO= 2.081578947368421 CA_SCO= -0.0148421052631579
[['B', ' CA ', 155.508, 99.835, 77.184]] AA_SCO= 2.083684210526316 CA_SCO= -0.014947368421052633
[['B', ' CA ', 157.533, 96.607, 78.88]] AA_SCO= 2.0731578947368416 CA_SCO= -0.01663157894736842
[['B', ' CA ', 157.625, 97.949, 83.062]] AA_SCO= 2.101578947368421 CA_SCO= -0.024894736842105258
[['B', ' CA ', 154.798, 100.694, 83.492]] AA_SCO= 2.015263157894737 CA_SCO= -0.02152631578947368
[['B', ' CA ', 155.432, 101.578, 87.266]] AA_SCO= 2.127894736842105 CA_SCO= -0.01842105263157894
[['B', ' CA ', 151.852, 102.939, 88.493]] AA_SCO= 2.0521052631578947 CA_SCO= 0.002052631578947369
[['B', ' CA ', 151.954, 105.57, 91.354]] AA_SCO= 2.1436842105263154 CA_SCO= 0.010736842105263157
[['B', ' CA ', 149.467, 105.286, 94.016]] AA_SCO= 2.096315789473684 CA_SCO= 0.013789473684210527
[['B', ' CA ', 145.917, 104.117, 94.931]] AA_SCO= 2.063684210526316 CA_SCO= 0.023894736842105264
[['B', ' CA ', 143.105, 102.296, 93.726]] AA_SCO= 2.0810526315789475 CA_SCO= 0.025421052631578945
[['B', ' CA ', 139.896, 103.977, 94.732]] AA_SCO= 2.0278947368421054 CA_SCO= 0.02431578947368421
[['B', ' CA ', 137.438, 101.157, 93.263]] AA_SCO= 2.127894736842105 CA_SCO= 0.02431578947368421
[['B', ' CA ', 133.684, 103.478, 93.234]] AA_SCO= 2.1894736842105265 CA_SCO= 0.023736842105263157
[['B', ' CA ', 135.405, 105.971, 90.152]] AA_SCO= 2.217368421052632 CA_SCO= 0.027631578947368424
[['B', ' CA ', 135.507, 103.295, 87.114]] AA_SCO= 2.2115789473684213 CA_SCO= 0.028157894736842107
[['B', ' CA ', 138.745, 105.665, 84.638]] AA_SCO= 2.222631578947368 CA_SCO= 0.028210526315789474
[['B', ' CA ', 141.813, 104.371, 87.356]] AA_SCO= 2.2642105263157895 CA_SCO= 0.024684210526315784
[['B', ' CA ', 140.408, 100.586, 87.701]] AA_SCO= 2.2657894736842104 CA_SCO= 0.03631578947368421
[['B', ' CA ', 139.484, 100.286, 83.407]] AA_SCO= 2.297368421052632 CA_SCO= 0.03505263157894737
[['B', ' CA ', 143.27, 102.309, 82.598]] AA_SCO= 2.3115789473684214 CA_SCO= 0.025684210526315795
[['B', ' CA ', 145.328, 99.676, 85.429]] AA_SCO= 2.314736842105264 CA_SCO= 0.02363157894736842
[['B', ' CA ', 143.022, 96.056, 83.645]] AA_SCO= 2.320526315789474 CA_SCO= 0.032157894736842114
[['B', ' CA ', 144.361, 97.868, 79.544]] AA_SCO= 2.403684210526316 CA_SCO= 0.03263157894736843
[['B', ' CA ', 148.29, 98.713, 81.422]] AA_SCO= 2.3747368421052633 CA_SCO= 0.02721052631578947
[['B', ' CA ', 148.113, 94.761, 82.989]] AA_SCO= 2.4831578947368422 CA_SCO= 0.015684210526315787
[['B', ' CA ', 147.065, 93.671, 79.405]] AA_SCO= 2.4615789473684213 CA_SCO= -0.009315789473684208
[['B', ' CA ', 149.87, 96.149, 77.219]] AA_SCO= 2.394736842105263 CA_SCO= -0.016157894736842104
[['B', ' CA ', 153.058, 97.135, 80.373]] AA_SCO= 2.4042105263157887 CA_SCO= -0.021999999999999995
[['B', ' CA ', 154.67, 93.508, 80.608]] AA_SCO= 2.426315789473684 CA_SCO= -0.023157894736842103
[['B', ' CA ', 155.61, 93.91, 84.22]] AA_SCO= 2.4247368421052626 CA_SCO= -0.021368421052631578
[['B', ' CA ', 153.836, 96.819, 86.014]] AA_SCO= 2.3584210526315785 CA_SCO= -0.03821052631578947
[['B', ' CA ', 155.811, 97.31, 89.474]] AA_SCO= 2.2847368421052634 CA_SCO= -0.04473684210526315
[['B', ' CA ', 153.822, 100.069, 91.594]] AA_SCO= 2.352105263157895 CA_SCO= -0.043526315789473684
[['B', ' CA ', 156.18, 102.478, 92.911]] AA_SCO= 2.3342105263157897 CA_SCO= -0.04378947368421051
[['B', ' CA ', 155.605, 103.999, 96.0]] AA_SCO= 2.2042105263157894 CA_SCO= -0.043842105263157884
[['B', ' CA ', 153.854, 102.948, 98.753]] AA_SCO= 2.2394736842105263 CA_SCO= -0.03857894736842103
[['B', ' CA ', 150.552, 103.972, 97.715]] AA_SCO= 2.281052631578947 CA_SCO= -0.037368421052631565
[['B', ' CA ', 150.029, 101.306, 94.879]] AA_SCO= 2.2926315789473684 CA_SCO= -0.03789473684210525
[['B', ' CA ', 151.901, 98.447, 96.69]] AA_SCO= 2.3021052631578947 CA_SCO= -0.028052631578947353
[['B', ' CA ', 150.195, 98.682, 100.608]] AA_SCO= 2.2984210526315794 CA_SCO= -0.0284736842105263
[['B', ' CA ', 148.034, 101.417, 100.814]] AA_SCO= 2.305789473684211 CA_SCO= -0.028789473684210504
[['B', ' CA ', 149.922, 104.231, 102.651]] AA_SCO= 2.337368421052632 CA_SCO= -0.03068421052631577
[['B', ' CA ', 147.776, 106.859, 103.935]] AA_SCO= 2.3610526315789473 CA_SCO= -0.03347368421052629
[['B', ' CA ', 144.897, 106.167, 101.609]] AA_SCO= 2.3610526315789473 CA_SCO= -0.02357894736842104
[['B', ' CA ', 143.777, 103.139, 103.813]] AA_SCO= 2.3426315789473677 CA_SCO= -0.0008421052631578962
[['B', ' CA ', 142.877, 105.656, 106.91]] AA_SCO= 2.4315789473684206 CA_SCO= 0.0008421052631578937
[['B', ' CA ', 140.208, 107.828, 104.098]] AA_SCO= 2.3473684210526318 CA_SCO= 0.005842105263157896
[['B', ' CA ', 136.652, 107.029, 105.491]] AA_SCO= 2.328421052631579 CA_SCO= 0.006999999999999999
[['B', ' CA ', 134.615, 108.575, 102.362]] AA_SCO= 2.2510526315789474 CA_SCO= -0.007315789473684213
[['B', ' CA ', 132.515, 111.879, 102.76]] AA_SCO= 2.3010526315789477 CA_SCO= 0.008526315789473686
[['B', ' CA ', 134.736, 115.008, 101.741]] AA_SCO= 2.398947368421053 CA_SCO= 0.015684210526315794
[['B', ' CA ', 133.624, 117.645, 99.145]] AA_SCO= 2.310526315789474 CA_SCO= 0.01578947368421053
[['B', ' CA ', 133.929, 117.128, 95.513]] AA_SCO= 2.3552631578947367 CA_SCO= 0.012736842105263163
[['B', ' CA ', 132.752, 113.741, 95.228]] AA_SCO= 2.478421052631579 CA_SCO= 0.012631578947368424
[['B', ' CA ', 131.865, 112.62, 98.994]] AA_SCO= 2.428947368421053 CA_SCO= 0.012263157894736842
[['B', ' CA ', 131.105, 108.307, 98.082]] AA_SCO= 2.328421052631579 CA_SCO= -0.0019473684210526319
[['B', ' CA ', 135.145, 107.378, 96.586]] AA_SCO= 2.3326315789473684 CA_SCO= -0.005157894736842106
[['B', ' CA ', 135.968, 106.28, 100.67]] AA_SCO= 2.31 CA_SCO= -0.008210526315789474
[['B', ' CA ', 137.46, 102.739, 99.36]] AA_SCO= 2.261052631578947 CA_SCO= -0.006263157894736843
[['B', ' CA ', 141.087, 103.09, 97.763]] AA_SCO= 2.2415789473684207 CA_SCO= -0.008052631578947367
[['B', ' CA ', 143.19, 99.538, 98.241]] AA_SCO= 2.1915789473684213 CA_SCO= -0.020736842105263154
[['B', ' CA ', 146.981, 99.815, 96.847]] AA_SCO= 2.1294736842105264 CA_SCO= -0.015
[['B', ' CA ', 146.521, 98.288, 92.792]] AA_SCO= 2.0205263157894735 CA_SCO= -0.013947368421052632
[['B', ' CA ', 148.036, 94.611, 93.414]] AA_SCO= 1.993684210526316 CA_SCO= -0.012368421052631579
[['B', ' CA ', 144.369, 93.218, 95.157]] AA_SCO= 1.9494736842105258 CA_SCO= -0.010842105263157896
[['B', ' CA ', 142.56, 94.064, 91.181]] AA_SCO= 2.015263157894737 CA_SCO= -0.04889473684210527
[['B', ' CA ', 145.831, 93.735, 88.634]] AA_SCO= 2.0642105263157897 CA_SCO= -0.093
[['B', ' CA ', 148.815, 91.053, 89.51]] AA_SCO= 2.1094736842105264 CA_SCO= -0.0868421052631579
[['B', ' CA ', 151.947, 92.772, 90.34]] AA_SCO= 2.105263157894737 CA_SCO= -0.09810526315789474
[['B', ' CA ', 155.206, 91.502, 89.028]] AA_SCO= 2.0773684210526313 CA_SCO= -0.09810526315789474
[['B', ' CA ', 157.628, 93.891, 91.375]] AA_SCO= 2.1257894736842107 CA_SCO= -0.09715789473684211
[['B', ' CA ', 155.829, 96.268, 94.605]] AA_SCO= 2.0821052631578945 CA_SCO= -0.09389473684210528
[['B', ' CA ', 158.951, 99.189, 94.978]] AA_SCO= 2.0794736842105257 CA_SCO= -0.09978947368421053
[['B', ' CA ', 157.771, 100.762, 98.517]] AA_SCO= 2.1152631578947365 CA_SCO= -0.09947368421052634
[['B', ' CA ', 158.562, 104.13, 100.001]] AA_SCO= 2.1478947368421055 CA_SCO= -0.0853157894736842
[['B', ' CA ', 156.831, 107.821, 101.575]] AA_SCO= 2.1294736842105264 CA_SCO= -0.08005263157894738
[['B', ' CA ', 158.779, 109.169, 98.821]] AA_SCO= 2.0447368421052636 CA_SCO= -0.0766842105263158
[['B', ' CA ', 160.521, 106.028, 96.779]] AA_SCO= 2.0978947368421057 CA_SCO= -0.0743684210526316
[['B', ' CA ', 163.981, 107.327, 97.888]] AA_SCO= 2.0015789473684213 CA_SCO= -0.07189473684210528
[['B', ' CA ', 165.173, 108.717, 93.944]] AA_SCO= 2.018947368421053 CA_SCO= -0.05731578947368421
[['B', ' CA ', 168.854, 106.17, 93.926]] AA_SCO= 2.0910526315789477 CA_SCO= -0.05484210526315789
[['B', ' CA ', 166.697, 102.505, 94.35]] AA_SCO= 2.125263157894737 CA_SCO= -0.05463157894736842
[['B', ' CA ', 163.927, 103.558, 91.522]] AA_SCO= 2.157368421052632 CA_SCO= -0.06221052631578948
[['B', ' CA ', 167.238, 104.972, 89.043]] AA_SCO= 2.1152631578947365 CA_SCO= -0.08089473684210527
[['B', ' CA ', 169.764, 101.557, 90.458]] AA_SCO= 2.0915789473684208 CA_SCO= -0.04410526315789473
[['B', ' CA ', 166.15, 98.805, 90.2]] AA_SCO= 1.9121052631578948 CA_SCO= -0.00310526315789474
[['B', ' CA ', 164.945, 100.784, 86.399]] AA_SCO= 1.9357894736842105 CA_SCO= 0.004210526315789475
[['B', ' CA ', 169.146, 100.599, 85.023]] AA_SCO= 1.9505263157894739 CA_SCO= 0.016000000000000007
[['B', ' CA ', 169.304, 96.654, 86.578]] AA_SCO= 1.956842105263158 CA_SCO= 0.015105263157894745
[['B', ' CA ', 165.469, 95.744, 84.403]] AA_SCO= 1.851578947368421 CA_SCO= 0.015052631578947373
[['B', ' CA ', 167.593, 98.051, 81.03]] AA_SCO= 1.6268421052631576 CA_SCO= 0.014684210526315791
[['B', ' CA ', 171.308, 95.887, 81.74]] AA_SCO= 1.677894736842105 CA_SCO= 0.014157894736842109
[['B', ' CA ', 167.186, 92.364, 83.2]] AA_SCO= 1.545263157894737 CA_SCO= 0.014210526315789474
[['B', ' CA ', 169.991, 91.646, 86.889]] AA_SCO= 1.4889473684210526 CA_SCO= 0.014263157894736837
[['B', ' CA ', 166.333, 90.592, 88.147]] AA_SCO= 1.5099999999999998 CA_SCO= 0.014157894736842105
[['B', ' CA ', 168.602, 88.56, 91.414]] AA_SCO= 1.5710526315789473 CA_SCO= 0.010473684210526314
[['B', ' CA ', 168.967, 92.593, 93.225]] AA_SCO= 1.584736842105263 CA_SCO= 0.006684210526315786
[['B', ' CA ', 164.882, 93.161, 92.014]] AA_SCO= 1.6521052631578943 CA_SCO= 0.002999999999999998
[['B', ' CA ', 163.895, 89.114, 93.119]] AA_SCO= 1.5321052631578944 CA_SCO= 0.0008421052631578933
[['B', ' CA ', 163.869, 90.802, 97.232]] AA_SCO= 1.4110526315789471 CA_SCO= 0.0007368421052631564
[['B', ' CA ', 161.148, 93.981, 95.488]] AA_SCO= 1.4957894736842103 CA_SCO= 0.0008421052631578937
[['B', ' CA ', 159.191, 91.071, 92.99]] AA_SCO= 1.4605263157894737 CA_SCO= 0.006421052631578945
[['B', ' CA ', 158.773, 88.614, 96.822]] AA_SCO= 1.5226315789473686 CA_SCO= 0.02736842105263158
[['B', ' CA ', 157.372, 92.356, 98.664]] AA_SCO= 1.3026315789473686 CA_SCO= 0.029736842105263155
[['B', ' CA ', 154.691, 92.924, 95.263]] AA_SCO= 1.4600000000000002 CA_SCO= 0.031210526315789473
[['B', ' CA ', 152.716, 89.862, 97.817]] AA_SCO= 1.4857894736842108 CA_SCO= 0.032578947368421055
[['B', ' CA ', 152.743, 92.23, 101.217]] AA_SCO= 1.4878947368421054 CA_SCO= 0.022631578947368423
[['B', ' CA ', 150.151, 95.003, 100.352]] AA_SCO= 1.2942105263157897 CA_SCO= 0.021684210526315785
[['B', ' CA ', 148.956, 96.106, 103.959]] AA_SCO= 1.3736842105263158 CA_SCO= 0.021947368421052632
[['B', ' CA ', 152.252, 97.478, 105.572]] AA_SCO= 1.6005263157894738 CA_SCO= 0.022368421052631583
[['B', ' CA ', 151.839, 99.467, 109.127]] AA_SCO= 1.5526315789473686 CA_SCO= 0.028526315789473688
[['B', ' CA ', 155.016, 99.519, 112.368]] AA_SCO= 1.7057894736842107 CA_SCO= 0.028526315789473688
[['B', ' CA ', 153.114, 96.734, 114.92]] AA_SCO= 1.7326315789473685 CA_SCO= 0.028105263157894737
[['B', ' CA ', 153.862, 94.131, 111.073]] AA_SCO= 1.724736842105263 CA_SCO= 0.026052631578947365
[['B', ' CA ', 158.015, 94.858, 112.897]] AA_SCO= 1.7668421052631575 CA_SCO= 0.026526315789473686
[['B', ' CA ', 156.2, 93.719, 116.825]] AA_SCO= 1.8094736842105263 CA_SCO= 0.029105263157894738
[['B', ' CA ', 154.002, 90.851, 115.106]] AA_SCO= 1.6857894736842105 CA_SCO= 0.01642105263157895
[['B', ' CA ', 156.167, 89.58, 111.975]] AA_SCO= 1.8010526315789472 CA_SCO= 0.013052631578947371
[['B', ' CA ', 160.072, 90.163, 113.513]] AA_SCO= 1.9621052631578948 CA_SCO= -0.007105263157894737
[['B', ' CA ', 160.558, 91.438, 117.805]] AA_SCO= 1.9700000000000004 CA_SCO= -0.013894736842105264
[['B', ' CA ', 157.188, 88.965, 119.066]] AA_SCO= 1.9926315789473688 CA_SCO= -0.023210526315789477
[['B', ' CA ', 158.611, 85.604, 116.868]] AA_SCO= 2.068947368421053 CA_SCO= -0.04273684210526316
[['B', ' CA ', 162.109, 86.837, 119.188]] AA_SCO= 2.311052631578948 CA_SCO= -0.04273684210526316
[['B', ' CA ', 164.095, 87.954, 115.864]] AA_SCO= 2.3163157894736845 CA_SCO= -0.04078947368421053
[['B', ' CA ', 164.646, 92.155, 116.902]] AA_SCO= 2.284736842105263 CA_SCO= -0.05352631578947368
[['B', ' CA ', 167.997, 92.786, 117.742]] AA_SCO= 2.3547368421052637 CA_SCO= -0.04631578947368421
[['B', ' CA ', 167.89, 96.765, 118.95]] AA_SCO= 2.5515789473684216 CA_SCO= -0.045052631578947365
[['B', ' CA ', 168.909, 98.108, 115.79]] AA_SCO= 2.540526315789474 CA_SCO= -0.04526315789473684
[['B', ' CA ', 167.184, 101.22, 115.124]] AA_SCO= 2.5726315789473686 CA_SCO= -0.04610526315789474
[['B', ' CA ', 167.088, 100.422, 110.789]] AA_SCO= 2.564736842105263 CA_SCO= -0.04568421052631579
[['B', ' CA ', 163.316, 100.535, 111.166]] AA_SCO= 2.544736842105263 CA_SCO= -0.045684210526315785
[['B', ' CA ', 163.357, 104.284, 113.369]] AA_SCO= 2.5394736842105265 CA_SCO= -0.04547368421052631
[['B', ' CA ', 166.514, 105.526, 110.651]] AA_SCO= 2.599473684210526 CA_SCO= -0.04294736842105262
[['B', ' CA ', 163.991, 104.477, 107.441]] AA_SCO= 2.553684210526316 CA_SCO= -0.040210526315789454
[['B', ' CA ', 160.629, 105.727, 108.976]] AA_SCO= 2.5031578947368422 CA_SCO= -0.042947368421052616
[['B', ' CA ', 160.288, 108.722, 106.684]] AA_SCO= 2.676842105263158 CA_SCO= -0.03321052631578946
[['B', ' CA ', 157.093, 110.364, 108.733]] AA_SCO= 2.7052631578947364 CA_SCO= -0.03668421052631577
[['B', ' CA ', 159.509, 110.067, 112.025]] AA_SCO= 2.671578947368421 CA_SCO= -0.020789473684210517
[['B', ' CA ', 156.872, 108.154, 114.099]] AA_SCO= 2.65578947368421 CA_SCO= -0.014000000000000004
[['B', ' CA ', 158.704, 104.966, 115.549]] AA_SCO= 2.632631578947368 CA_SCO= -0.0026842105263157924
[['B', ' CA ', 161.828, 106.04, 117.794]] AA_SCO= 2.578421052631579 CA_SCO= 0.017894736842105265
[['B', ' CA ', 163.379, 102.895, 119.566]] AA_SCO= 2.5342105263157895 CA_SCO= 0.01642105263157895
[['B', ' CA ', 163.078, 103.217, 123.638]] AA_SCO= 2.468947368421053 CA_SCO= 0.016578947368421054
[['B', ' CA ', 164.978, 100.581, 125.69]] AA_SCO= 2.5173684210526317 CA_SCO= 0.027105263157894736
[['B', ' CA ', 166.768, 99.135, 122.277]] AA_SCO= 2.503684210526316 CA_SCO= 0.029947368421052636
[['B', ' CA ', 163.312, 97.417, 120.375]] AA_SCO= 2.3205263157894738 CA_SCO= 0.01936842105263158
[['B', ' CA ', 161.478, 100.367, 118.271]] AA_SCO= 2.3247368421052634 CA_SCO= 0.018052631578947365
[['B', ' CA ', 157.85, 101.999, 119.851]] AA_SCO= 2.357894736842105 CA_SCO= 0.01021052631578947
[['B', ' CA ', 156.078, 103.602, 116.891]] AA_SCO= 2.365263157894737 CA_SCO= 0.009842105263157895
[['B', ' CA ', 153.562, 106.636, 117.896]] AA_SCO= 2.261578947368421 CA_SCO= 0.009789473684210527
[['B', ' CA ', 150.911, 105.105, 115.444]] AA_SCO= 2.362631578947368 CA_SCO= 0.008210526315789472
[['B', ' CA ', 148.968, 109.074, 114.637]] AA_SCO= 2.3415789473684208 CA_SCO= 0.008000000000000002
[['B', ' CA ', 152.501, 110.121, 112.343]] AA_SCO= 2.374736842105263 CA_SCO= 0.006947368421052632
[['B', ' CA ', 152.198, 106.069, 110.954]] AA_SCO= 2.3278947368421052 CA_SCO= 0.010105263157894737
[['B', ' CA ', 151.332, 106.431, 107.323]] AA_SCO= 2.3968421052631577 CA_SCO= -0.021684210526315792
[['B', ' CA ', 150.851, 102.812, 106.496]] AA_SCO= 2.301578947368421 CA_SCO= -0.01531578947368421
[['B', ' CA ', 153.865, 102.336, 103.951]] AA_SCO= 2.3236842105263156 CA_SCO= -0.013052631578947366
[['B', ' CA ', 155.567, 98.96, 105.536]] AA_SCO= 2.317894736842105 CA_SCO= -0.015368421052631578
[['B', ' CA ', 159.371, 100.668, 104.457]] AA_SCO= 2.4921052631578946 CA_SCO= -0.01505263157894737
[['B', ' CA ', 160.579, 100.293, 108.216]] AA_SCO= 2.5973684210526318 CA_SCO= -0.015263157894736841
[['B', ' CA ', 159.889, 96.474, 108.084]] AA_SCO= 2.6310526315789473 CA_SCO= -0.014315789473684212
[['B', ' CA ', 161.472, 95.957, 104.337]] AA_SCO= 2.673157894736842 CA_SCO= -0.022210526315789476
[['B', ' CA ', 164.8, 97.831, 105.729]] AA_SCO= 2.627894736842105 CA_SCO= -0.022894736842105266
[['B', ' CA ', 164.365, 95.561, 109.601]] AA_SCO= 2.5415789473684214 CA_SCO= -0.02584210526315789
[['B', ' CA ', 167.691, 93.486, 108.6]] AA_SCO= 2.7078947368421056 CA_SCO= -0.014789473684210524
[['B', ' CA ', 165.777, 90.444, 110.499]] AA_SCO= 2.7094736842105265 CA_SCO= -0.019894736842105264
[['B', ' CA ', 162.708, 90.543, 107.728]] AA_SCO= 2.6631578947368424 CA_SCO= -0.01542105263157895
[['B', ' CA ', 164.681, 89.25, 104.709]] AA_SCO= 2.6136842105263156 CA_SCO= -0.020842105263157898
[['B', ' CA ', 168.726, 89.594, 104.369]] AA_SCO= 2.677368421052632 CA_SCO= -0.053947368421052626
[['B', ' CA ', 170.02, 89.84, 100.732]] AA_SCO= 2.631666666666667 CA_SCO= -0.058499999999999996
[['B', ' CA ', 173.786, 88.37, 101.79]] AA_SCO= 2.597058823529412 CA_SCO= -0.0653529411764706
[['B', ' CA ', 175.635, 87.701, 98.39]] AA_SCO= 2.60375 CA_SCO= -0.0715
[['B', ' CA ', 174.142, 91.21, 96.277]] AA_SCO= 2.6700000000000004 CA_SCO= -0.07933333333333333
[['B', ' CA ', 175.597, 93.269, 99.542]] AA_SCO= 2.572857142857143 CA_SCO= -0.037285714285714276
[['B', ' CA ', 179.053, 91.328, 99.676]] AA_SCO= 2.689230769230769 CA_SCO= -0.04107692307692307
[['B', ' CA ', 179.063, 91.322, 95.466]] AA_SCO= 2.644166666666667 CA_SCO= -0.04633333333333333
[['B', ' CA ', 178.719, 95.821, 95.636]] AA_SCO= 2.6927272727272733 CA_SCO= -0.051727272727272726
[['B', ' CA ', 181.125, 96.218, 98.69]] AA_SCO= 2.4519999999999995 CA_SCO= -0.0621
[['C', ' CA ', 183.25, 93.267, 98.5]]
[['C', ' CA ', 186.92, 85.122, 109.817]]
[['C', ' CA ', 184.821, 87.092, 106.785]]
[['C', ' CA ', 186.619, 89.677, 104.007]]
[['C', ' CA ', 190.341, 89.986, 104.925]]
[['C', ' CA ', 192.645, 93.127, 104.01]]
[['C', ' CA ', 194.999, 92.651, 107.099]]
[['C', ' CA ', 194.148, 91.695, 110.919]]
[['C', ' CA ', 197.015, 93.145, 113.566]]
[['C', ' CA ', 196.225, 93.922, 117.149]]
[['C', ' CA ', 197.568, 97.963, 117.78]]
[['C', ' CA ', 195.917, 100.127, 120.922]]
[['C', ' CA ', 196.117, 104.109, 119.873]]
[['C', ' CA ', 198.9, 105.976, 121.557]]
[['C', ' CA ', 197.651, 109.198, 122.907]]
[['C', ' CA ', 197.79, 107.383, 126.58]]
[['C', ' CA ', 194.472, 109.923, 128.093]]
[['C', ' CA ', 191.765, 107.825, 125.203]]
[['C', ' CA ', 193.913, 103.938, 126.196]]
[['C', ' CA ', 193.164, 104.847, 130.583]]
[['C', ' CA ', 188.744, 105.943, 129.697]]
[['C', ' CA ', 188.179, 103.37, 126.051]]
[['C', ' CA ', 188.026, 99.145, 126.869]]
[['C', ' CA ', 191.007, 97.412, 124.998]]
[['C', ' CA ', 193.47, 100.023, 123.356]]
[['C', ' CA ', 190.734, 102.824, 122.187]]
[['C', ' CA ', 191.449, 102.189, 118.403]]
[['C', ' CA ', 187.477, 102.77, 117.133]]
[['C', ' CA ', 187.313, 106.479, 119.299]]
[['C', ' CA ', 191.737, 107.006, 118.048]]
[['C', ' CA ', 190.694, 105.95, 113.952]]
[['C', ' CA ', 186.973, 107.871, 114.228]]
[['C', ' CA ', 188.04, 111.24, 116.443]]
[['C', ' CA ', 192.015, 111.3, 114.041]]
[['C', ' CA ', 189.42, 110.406, 110.349]]
[['C', ' CA ', 186.95, 113.591, 111.966]]
[['C', ' CA ', 190.281, 116.173, 113.095]]
[['C', ' CA ', 192.334, 115.362, 109.357]]
[['C', ' CA ', 187.973, 115.978, 107.878]]
[['C', ' CA ', 187.2, 112.105, 105.52]]
[['C', ' CA ', 183.743, 111.598, 108.35]]
[['C', ' CA ', 183.24, 115.675, 109.679]]
[['C', ' CA ', 180.792, 113.871, 113.013]]
[['C', ' CA ', 180.292, 109.643, 113.418]]
[['C', ' CA ', 177.187, 108.549, 115.914]]
[['C', ' CA ', 178.831, 106.123, 118.673]]
[['C', ' CA ', 176.476, 105.376, 121.685]]
[['C', ' CA ', 177.809, 107.682, 124.802]]
[['C', ' CA ', 176.144, 109.844, 127.22]]
[['C', ' CA ', 172.643, 107.774, 128.623]]
[['C', ' CA ', 170.013, 109.111, 131.083]]
[['C', ' CA ', 170.003, 106.25, 133.96]]
[['C', ' CA ', 174.117, 105.23, 133.964]]
[['C', ' CA ', 174.94, 102.135, 131.886]]
[['C', ' CA ', 172.06, 102.399, 129.079]]
[['C', ' CA ', 174.287, 104.393, 126.505]]
[['C', ' CA ', 171.584, 106.456, 123.931]]
[['C', ' CA ', 173.763, 106.7, 120.685]]
[['C', ' CA ', 174.195, 110.83, 120.042]]
[['C', ' CA ', 176.575, 111.714, 116.729]]
[['C', ' CA ', 179.55, 113.743, 118.36]]
[['C', ' CA ', 181.12, 115.64, 115.494]]
[['C', ' CA ', 184.332, 117.169, 117.822]]
[['C', ' CA ', 186.6, 114.031, 118.775]]
[['C', ' CA ', 186.517, 115.372, 123.521]]
[['C', ' CA ', 181.924, 114.011, 122.87]]
[['C', ' CA ', 183.419, 110.505, 121.139]]
[['C', ' CA ', 186.667, 110.09, 123.924]]
[['C', ' CA ', 183.462, 110.718, 127.027]]
[['C', ' CA ', 180.725, 108.057, 124.615]]
[['C', ' CA ', 184.924, 105.368, 124.632]]
[['C', ' CA ', 184.194, 102.659, 127.452]]
[['C', ' CA ', 181.752, 99.235, 125.776]]
[['C', ' CA ', 178.363, 99.147, 127.899]]
[['C', ' CA ', 176.992, 95.729, 126.108]]
[['C', ' CA ', 172.704, 96.447, 126.965]]
[['C', ' CA ', 171.631, 97.746, 123.348]]
[['C', ' CA ', 172.015, 101.134, 122.064]]
[['C', ' CA ', 170.361, 100.954, 118.723]]
[['C', ' CA ', 172.817, 103.939, 117.086]]
[['C', ' CA ', 171.856, 103.345, 113.351]]
[['C', ' CA ', 168.572, 105.41, 113.759]]
[['C', ' CA ', 170.266, 109.156, 114.746]]
[['C', ' CA ', 172.892, 108.549, 111.31]]
[['C', ' CA ', 169.395, 110.032, 108.907]]
[['C', ' CA ', 168.768, 113.306, 111.647]]
[['C', ' CA ', 173.131, 113.707, 112.087]]
[['C', ' CA ', 173.7, 113.637, 107.812]]
[['C', ' CA ', 170.463, 116.081, 107.149]]
[['C', ' CA ', 169.657, 118.821, 110.358]]
[['C', ' CA ', 173.215, 118.585, 112.123]]
[['C', ' CA ', 174.303, 118.795, 107.663]]
[['C', ' CA ', 177.507, 116.248, 108.04]]
[['C', ' CA ', 177.282, 114.628, 104.365]]
[['C', ' CA ', 180.224, 111.804, 104.976]]
[['C', ' CA ', 179.57, 110.303, 108.63]]
[['C', ' CA ', 181.639, 108.218, 111.042]]
[['C', ' CA ', 180.025, 104.821, 112.232]]
[['C', ' CA ', 181.081, 102.454, 115.106]]
[['C', ' CA ', 178.708, 99.604, 114.811]]
[['C', ' CA ', 178.041, 96.1, 116.457]]
[['C', ' CA ', 177.795, 93.321, 113.745]]
[['C', ' CA ', 173.708, 93.36, 113.754]]
[['C', ' CA ', 173.822, 97.184, 113.066]]
[['C', ' CA ', 176.576, 96.966, 110.15]]
[['C', ' CA ', 173.95, 94.436, 108.44]]
[['C', ' CA ', 171.009, 97.016, 108.528]]
[['C', ' CA ', 173.338, 100.007, 107.349]]
[['C', ' CA ', 174.967, 97.941, 104.571]]
[['C', ' CA ', 171.347, 96.639, 103.615]]
[['C', ' CA ', 170.113, 100.23, 103.619]]
[['C', ' CA ', 172.983, 101.205, 101.414]]
[['C', ' CA ', 172.645, 98.346, 98.711]]
[['C', ' CA ', 168.58, 98.356, 98.784]]
[['C', ' CA ', 167.905, 102.068, 99.821]]
[['C', ' CA ', 163.863, 102.863, 99.86]]
[['C', ' CA ', 163.046, 104.825, 101.136]]
[['C', ' CA ', 166.003, 106.318, 103.109]]
[['C', ' CA ', 166.92, 109.224, 100.752]]
[['C', ' CA ', 170.78, 110.046, 99.942]]
[['C', ' CA ', 172.334, 108.952, 103.681]]
[['C', ' CA ', 173.701, 105.219, 101.844]]
[['C', ' CA ', 176.921, 107.111, 100.079]]
[['C', ' CA ', 177.775, 109.933, 102.989]]
[['C', ' CA ', 178.614, 106.519, 105.563]]
[['C', ' CA ', 182.592, 106.292, 104.31]]
[['C', ' CA ', 183.975, 104.24, 107.636]]
[['C', ' CA ', 181.708, 102.123, 109.824]]
[['C', ' CA ', 183.931, 100.596, 112.26]]
[['C', ' CA ', 181.851, 97.386, 113.412]]
[['C', ' CA ', 182.798, 96.127, 116.912]]
[['C', ' CA ', 182.802, 92.233, 117.838]]
[['C', ' CA ', 179.561, 91.105, 119.454]]
[['C', ' CA ', 178.974, 87.65, 120.898]]
[['C', ' CA ', 175.622, 88.704, 122.553]]
[['C', ' CA ', 174.533, 92.066, 124.074]]
[['C', ' CA ', 171.933, 91.359, 127.267]]
[['C', ' CA ', 169.089, 94.246, 127.418]]
[['C', ' CA ', 169.968, 96.599, 130.318]]
[['C', ' CA ', 167.502, 95.266, 133.704]]
[['C', ' CA ', 169.346, 91.237, 133.307]]
[['C', ' CA ', 173.284, 93.23, 133.162]]
[['C', ' CA ', 172.13, 95.665, 136.439]]
[['C', ' CA ', 170.353, 91.303, 138.076]]
[['C', ' CA ', 174.239, 89.929, 137.21]]
[['C', ' CA ', 176.265, 93.469, 138.679]]
[['C', ' CA ', 173.691, 94.715, 141.59]]
[['C', ' CA ', 171.967, 90.908, 142.863]]
[['C', ' CA ', 174.535, 87.9, 141.666]]
[['C', ' CA ', 178.083, 89.853, 141.852]]
[['C', ' CA ', 176.27, 92.391, 145.128]]
[['C', ' CA ', 177.585, 96.382, 144.312]]
[['C', ' CA ', 174.44, 98.58, 141.818]]
[['C', ' CA ', 175.996, 100.076, 138.049]]
[['C', ' CA ', 176.904, 104.021, 139.287]]
[['C', ' CA ', 179.955, 102.215, 141.782]]
[['C', ' CA ', 180.883, 100.062, 138.363]]
[['C', ' CA ', 183.864, 101.78, 136.835]]
[['C', ' CA ', 184.087, 99.592, 133.342]]
[['C', ' CA ', 182.708, 95.98, 132.776]]
[['C', ' CA ', 184.402, 93.432, 129.724]]
[['C', ' CA ', 182.936, 89.788, 129.407]]
[['C', ' CA ', 186.314, 88.172, 127.738]]
[['C', ' CA ', 188.014, 84.982, 128.654]]
[['C', ' CA ', 185.638, 82.664, 129.814]]
[['C', ' CA ', 183.972, 85.515, 132.914]]
[['C', ' CA ', 182.249, 89.299, 132.472]]
[['C', ' CA ', 184.591, 90.964, 135.278]]
[['C', ' CA ', 182.869, 94.613, 136.026]]
[['C', ' CA ', 185.823, 96.477, 138.106]]
[['C', ' CA ', 183.826, 99.196, 140.724]]
[['C', ' CA ', 186.874, 101.825, 142.25]]
[['C', ' CA ', 188.626, 99.174, 144.913]]
[['C', ' CA ', 187.907, 95.369, 143.751]]
[['C', ' CA ', 187.657, 93.372, 140.769]]
[['C', ' CA ', 184.368, 91.723, 140.736]]
[['C', ' CA ', 183.881, 89.033, 137.757]]
[['C', ' CA ', 180.759, 86.36, 137.85]]
[['C', ' CA ', 181.789, 83.419, 135.383]]
[['C', ' CA ', 179.685, 83.961, 132.059]]
[['C', ' CA ', 177.446, 80.004, 131.822]]
[['C', ' CA ', 174.932, 82.475, 134.963]]
[['C', ' CA ', 174.655, 85.342, 131.499]]
[['C', ' CA ', 173.446, 82.109, 128.844]]
[['C', ' CA ', 169.501, 82.795, 128.822]]
[['C', ' CA ', 169.168, 86.441, 129.973]]
[['C', ' CA ', 170.961, 88.173, 126.559]]
[['C', ' CA ', 168.577, 88.995, 123.784]]
[['C', ' CA ', 166.045, 86.858, 121.885]]
[['C', ' CA ', 167.467, 87.365, 117.949]]
[['C', ' CA ', 171.101, 87.145, 119.294]]
[['C', ' CA ', 170.772, 83.149, 119.007]]
[['C', ' CA ', 170.01, 83.334, 115.388]]
[['C', ' CA ', 173.035, 85.698, 114.599]]
[['C', ' CA ', 176.08, 84.052, 112.877]]
[['C', ' CA ', 178.802, 87.013, 112.795]]
[['C', ' CA ', 180.959, 87.854, 115.713]]
[['C', ' CA ', 183.673, 89.978, 113.872]]
[['C', ' CA ', 181.867, 92.63, 111.985]]
[['C', ' CA ', 182.593, 91.032, 108.481]]
[['C', ' CA ', 180.391, 93.416, 106.351]]
[['C', ' CA ', 181.707, 96.925, 107.87]]
[['C', ' CA ', 185.215, 98.213, 106.549]]
[['C', ' CA ', 187.861, 97.623, 109.779]]
[['C', ' CA ', 185.94, 95.503, 112.672]]
[['C', ' CA ', 188.4, 95.555, 115.784]]
[['C', ' CA ', 187.15, 94.122, 119.475]]
[['C', ' CA ', 190.042, 92.69, 122.306]]
[['C', ' CA ', 190.062, 88.695, 122.023]]
[['C', ' CA ', 193.753, 88.019, 120.055]]
[['C', ' CA ', 195.113, 91.066, 121.706]]
[['C', ' CA ', 196.928, 90.82, 125.024]]
[['C', ' CA ', 195.443, 93.821, 128.033]]
[['C', ' CA ', 195.025, 97.389, 126.607]]
[['C', ' CA ', 195.702, 96.346, 122.794]]
[['C', ' CA ', 192.401, 94.915, 120.983]]
[['C', ' CA ', 192.787, 93.185, 117.552]]
[['C', ' CA ', 191.009, 95.157, 114.484]]
[['C', ' CA ', 190.991, 92.778, 110.784]]
[['C', ' CA ', 190.012, 95.911, 108.411]]
[['C', ' CA ', 188.194, 94.108, 105.454]]
[['C', ' CA ', 187.221, 96.526, 102.23]]
[['C', ' CA ', 190.217, 98.722, 101.015]]
[['C', ' CA ', 188.68, 102.663, 102.401]]
[['C', ' CA ', 188.919, 100.898, 106.43]]
[['C', ' CA ', 192.912, 99.264, 105.385]]
[['C', ' CA ', 193.839, 103.139, 103.637]]
[['C', ' CA ', 192.197, 105.539, 106.73]]
[['C', ' CA ', 193.62, 102.965, 109.734]]
[['C', ' CA ', 197.185, 101.798, 107.929]]
[['C', ' CA ', 197.736, 106.078, 106.676]]
[['C', ' CA ', 196.694, 107.041, 111.104]]
[['C', ' CA ', 199.06, 103.412, 112.355]]
[['C', ' CA ', 202.089, 105.047, 109.406]]
[['C', ' CA ', 201.035, 109.221, 111.118]]
[['C', ' CA ', 202.391, 107.121, 114.293]]
[['C', ' CA ', 198.937, 107.83, 116.968]]
[['C', ' CA ', 198.247, 103.574, 117.238]]
[['C', ' CA ', 201.562, 101.055, 117.401]]
[['C', ' CA ', 199.708, 97.732, 115.843]]
[['C', ' CA ', 202.343, 94.583, 116.074]]
[['C', ' CA ', 200.196, 92.029, 113.201]]
[['C', ' CA ', 198.237, 89.263, 115.588]]
[['C', ' CA ', 200.556, 85.519, 114.683]]
[['C', ' CA ', 203.665, 87.048, 117.709]]
[['C', ' CA ', 200.697, 87.993, 120.636]]
[['C', ' CA ', 199.829, 84.841, 122.696]]
[['C', ' CA ', 196.025, 84.311, 122.895]]
[['C', ' CA ', 196.845, 83.515, 119.318]]
[['C', ' CA ', 193.856, 84.986, 116.124]]
[['C', ' CA ', 193.303, 80.712, 116.525]]
[['C', ' CA ', 190.75, 81.306, 119.904]]
[['C', ' CA ', 188.777, 84.53, 117.753]]
[['C', ' CA ', 188.151, 82.002, 114.494]]
[['C', ' CA ', 187.053, 78.412, 117.505]]
[['C', ' CA ', 184.629, 81.646, 119.358]]
[['C', ' CA ', 183.567, 83.12, 115.54]]
[['C', ' CA ', 182.861, 79.097, 114.186]]
[['C', ' CA ', 181.025, 78.043, 117.73]]
[['C', ' CA ', 178.743, 81.657, 117.207]]
[['C', ' CA ', 177.945, 80.286, 113.692]]
[['C', ' CA ', 177.186, 76.61, 114.069]]
[['C', ' CA ', 174.83, 77.258, 118.103]]
[['C', ' CA ', 172.985, 80.224, 115.677]]
[['C', ' CA ', 172.637, 77.717, 112.514]]
[['C', ' CA ', 171.244, 74.484, 114.747]]
[['C', ' CA ', 168.634, 77.278, 116.48]]
[['C', ' CA ', 167.78, 79.091, 112.696]]
[['C', ' CA ', 167.105, 75.23, 111.188]]
[['C', ' CA ', 165.012, 74.094, 114.879]]
[['C', ' CA ', 162.815, 77.856, 114.748]]
[['C', ' CA ', 162.17, 76.817, 110.558]]
[['C', ' CA ', 160.974, 72.738, 111.721]]
[['C', ' CA ', 158.421, 74.425, 114.752]]
[['C', ' CA ', 157.233, 76.515, 111.106]]
[['C', ' CA ', 157.656, 80.474, 112.486]]
[['C', ' CA ', 159.512, 82.548, 109.617]]
[['C', ' CA ', 163.141, 83.142, 110.27]]
[['C', ' CA ', 164.838, 86.035, 107.813]]
[['C', ' CA ', 167.824, 84.045, 105.805]]
[['C', ' CA ', 183.25, 93.267, 98.5]] AA_SCO= 1.415 CA_SCO= -0.0928
[['C', ' CA ', 186.92, 85.122, 109.817]] AA_SCO= 1.497272727272727 CA_SCO= -0.07872727272727272
[['C', ' CA ', 184.821, 87.092, 106.785]] AA_SCO= 1.6258333333333332 CA_SCO= -0.06716666666666665
[['C', ' CA ', 186.619, 89.677, 104.007]] AA_SCO= 1.5953846153846152 CA_SCO= -0.062076923076923064
[['C', ' CA ', 190.341, 89.986, 104.925]] AA_SCO= 1.5849999999999997 CA_SCO= -0.05542857142857142
[['C', ' CA ', 192.645, 93.127, 104.01]] AA_SCO= 1.5779999999999998 CA_SCO= -0.062133333333333325
[['C', ' CA ', 194.999, 92.651, 107.099]] AA_SCO= 1.59375 CA_SCO= -0.05524999999999999
[['C', ' CA ', 194.148, 91.695, 110.919]] AA_SCO= 1.5870588235294119 CA_SCO= -0.05552941176470587
[['C', ' CA ', 197.015, 93.145, 113.566]] AA_SCO= 1.623888888888889 CA_SCO= -0.05005555555555554
[['C', ' CA ', 196.225, 93.922, 117.149]] AA_SCO= 1.565263157894737 CA_SCO= -0.04415789473684209
[['C', ' CA ', 197.568, 97.963, 117.78]] AA_SCO= 1.7947368421052636 CA_SCO= -0.0034210526315789505
[['C', ' CA ', 195.917, 100.127, 120.922]] AA_SCO= 1.613684210526316 CA_SCO= 0.0007894736842105241
[['C', ' CA ', 196.117, 104.109, 119.873]] AA_SCO= 1.5357894736842106 CA_SCO= 0.014210526315789474
[['C', ' CA ', 198.9, 105.976, 121.557]] AA_SCO= 1.760526315789474 CA_SCO= 0.014947368421052633
[['C', ' CA ', 197.651, 109.198, 122.907]] AA_SCO= 1.5810526315789475 CA_SCO= 0.008473684210526316
[['C', ' CA ', 197.79, 107.383, 126.58]] AA_SCO= 1.59 CA_SCO= -0.0034736842105263146
[['C', ' CA ', 194.472, 109.923, 128.093]] AA_SCO= 1.623684210526316 CA_SCO= -0.0009473684210526306
[['C', ' CA ', 191.765, 107.825, 125.203]] AA_SCO= 1.6363157894736844 CA_SCO= -0.0009473684210526306
[['C', ' CA ', 193.913, 103.938, 126.196]] AA_SCO= 1.6494736842105264 CA_SCO= -0.0003157894736842108
[['C', ' CA ', 193.164, 104.847, 130.583]] AA_SCO= 1.7468421052631582 CA_SCO= -0.0007894736842105252
[['C', ' CA ', 188.744, 105.943, 129.697]] AA_SCO= 1.7657894736842108 CA_SCO= -0.0008947368421052639
[['C', ' CA ', 188.179, 103.37, 126.051]] AA_SCO= 1.732105263157895 CA_SCO= -0.0007894736842105285
[['C', ' CA ', 188.026, 99.145, 126.869]] AA_SCO= 1.8110526315789472 CA_SCO= 0.002526315789473682
[['C', ' CA ', 191.007, 97.412, 124.998]] AA_SCO= 1.8573684210526316 CA_SCO= -5.2631578947369013e-05
[['C', ' CA ', 193.47, 100.023, 123.356]] AA_SCO= 1.9694736842105265 CA_SCO= 0.011421052631578948
[['C', ' CA ', 190.734, 102.824, 122.187]] AA_SCO= 2.0 CA_SCO= 0.012052631578947367
[['C', ' CA ', 191.449, 102.189, 118.403]] AA_SCO= 2.066315789473684 CA_SCO= 0.018473684210526316
[['C', ' CA ', 187.477, 102.77, 117.133]] AA_SCO= 2.0142105263157895 CA_SCO= 0.019157894736842106
[['C', ' CA ', 187.313, 106.479, 119.299]] AA_SCO= 2.1031578947368423 CA_SCO= 0.017894736842105262
[['C', ' CA ', 191.737, 107.006, 118.048]] AA_SCO= 2.1242105263157893 CA_SCO= 0.01426315789473684
[['C', ' CA ', 190.694, 105.95, 113.952]] AA_SCO= 2.343157894736842 CA_SCO= 0.007526315789473684
[['C', ' CA ', 186.973, 107.871, 114.228]] AA_SCO= 2.2673684210526317 CA_SCO= 0.009894736842105263
[['C', ' CA ', 188.04, 111.24, 116.443]] AA_SCO= 2.0989473684210522 CA_SCO= 0.009473684210526318
[['C', ' CA ', 192.015, 111.3, 114.041]] AA_SCO= 2.2321052631578944 CA_SCO= 0.017
[['C', ' CA ', 189.42, 110.406, 110.349]] AA_SCO= 2.2073684210526316 CA_SCO= 0.02173684210526316
[['C', ' CA ', 186.95, 113.591, 111.966]] AA_SCO= 2.2047368421052638 CA_SCO= 0.02310526315789474
[['C', ' CA ', 190.281, 116.173, 113.095]] AA_SCO= 2.208947368421053 CA_SCO= 0.024842105263157898
[['C', ' CA ', 192.334, 115.362, 109.357]] AA_SCO= 2.2010526315789485 CA_SCO= 0.02478947368421052
[['C', ' CA ', 187.973, 115.978, 107.878]] AA_SCO= 2.225789473684211 CA_SCO= 0.020052631578947367
[['C', ' CA ', 187.2, 112.105, 105.52]] AA_SCO= 2.1668421052631586 CA_SCO= 0.004736842105263155
[['C', ' CA ', 183.743, 111.598, 108.35]] AA_SCO= 2.1715789473684217 CA_SCO= -0.007789473684210532
[['C', ' CA ', 183.24, 115.675, 109.679]] AA_SCO= 2.07421052631579 CA_SCO= -0.02131578947368422
[['C', ' CA ', 180.792, 113.871, 113.013]] AA_SCO= 2.0815789473684214 CA_SCO= -0.019000000000000006
[['C', ' CA ', 180.292, 109.643, 113.418]] AA_SCO= 1.9752631578947368 CA_SCO= -0.019
[['C', ' CA ', 177.187, 108.549, 115.914]] AA_SCO= 1.8942105263157896 CA_SCO= -0.020000000000000007
[['C', ' CA ', 178.831, 106.123, 118.673]] AA_SCO= 1.8847368421052628 CA_SCO= -0.02021052631578947
[['C', ' CA ', 176.476, 105.376, 121.685]] AA_SCO= 1.992631578947368 CA_SCO= -0.022421052631578942
[['C', ' CA ', 177.809, 107.682, 124.802]] AA_SCO= 2.0136842105263155 CA_SCO= -0.02163157894736842
[['C', ' CA ', 176.144, 109.844, 127.22]] AA_SCO= 2.0426315789473684 CA_SCO= -0.01805263157894737
[['C', ' CA ', 172.643, 107.774, 128.623]] AA_SCO= 2.082631578947368 CA_SCO= -0.011263157894736838
[['C', ' CA ', 170.013, 109.111, 131.083]] AA_SCO= 2.2236842105263155 CA_SCO= -0.010684210526315784
[['C', ' CA ', 170.003, 106.25, 133.96]] AA_SCO= 2.354736842105263 CA_SCO= -0.011263157894736838
[['C', ' CA ', 174.117, 105.23, 133.964]] AA_SCO= 2.2936842105263158 CA_SCO= -0.014842105263157887
[['C', ' CA ', 174.94, 102.135, 131.886]] AA_SCO= 2.2821052631578946 CA_SCO= -0.003210526315789472
[['C', ' CA ', 172.06, 102.399, 129.079]] AA_SCO= 2.274736842105263 CA_SCO= 0.0001578947368421076
[['C', ' CA ', 174.287, 104.393, 126.505]] AA_SCO= 2.168421052631578 CA_SCO= 0.0006842105263157853
[['C', ' CA ', 171.584, 106.456, 123.931]] AA_SCO= 2.1484210526315786 CA_SCO= 0.0007368421052631593
[['C', ' CA ', 173.763, 106.7, 120.685]] AA_SCO= 2.1405263157894736 CA_SCO= 0.007526315789473682
[['C', ' CA ', 174.195, 110.83, 120.042]] AA_SCO= 2.195263157894737 CA_SCO= 0.022789473684210526
[['C', ' CA ', 176.575, 111.714, 116.729]] AA_SCO= 2.1684210526315786 CA_SCO= 0.031947368421052634
[['C', ' CA ', 179.55, 113.743, 118.36]] AA_SCO= 2.208421052631579 CA_SCO= 0.029578947368421055
[['C', ' CA ', 181.12, 115.64, 115.494]] AA_SCO= 2.16421052631579 CA_SCO= 0.010947368421052633
[['C', ' CA ', 184.332, 117.169, 117.822]] AA_SCO= 2.222105263157894 CA_SCO= -0.0006315789473684231
[['C', ' CA ', 186.6, 114.031, 118.775]] AA_SCO= 2.1836842105263155 CA_SCO= -0.007421052631578957
[['C', ' CA ', 186.517, 115.372, 123.521]] AA_SCO= 2.171578947368421 CA_SCO= -0.013105263157894736
[['C', ' CA ', 181.924, 114.011, 122.87]] AA_SCO= 2.1452631578947368 CA_SCO= -0.012
[['C', ' CA ', 183.419, 110.505, 121.139]] AA_SCO= 2.1378947368421053 CA_SCO= -0.012263157894736844
[['C', ' CA ', 186.667, 110.09, 123.924]] AA_SCO= 2.093157894736842 CA_SCO= -0.013578947368421058
[['C', ' CA ', 183.462, 110.718, 127.027]] AA_SCO= 2.0373684210526313 CA_SCO= -0.01642105263157895
[['C', ' CA ', 180.725, 108.057, 124.615]] AA_SCO= 2.0368421052631582 CA_SCO= -0.022105263157894735
[['C', ' CA ', 184.924, 105.368, 124.632]] AA_SCO= 2.0668421052631576 CA_SCO= -0.022894736842105263
[['C', ' CA ', 184.194, 102.659, 127.452]] AA_SCO= 2.1073684210526316 CA_SCO= -0.01931578947368421
[['C', ' CA ', 181.752, 99.235, 125.776]] AA_SCO= 2.0921052631578947 CA_SCO= -0.019684210526315783
[['C', ' CA ', 178.363, 99.147, 127.899]] AA_SCO= 2.0205263157894735 CA_SCO= -0.02221052631578947
[['C', ' CA ', 176.992, 95.729, 126.108]] AA_SCO= 2.1378947368421053 CA_SCO= -0.022315789473684206
[['C', ' CA ', 172.704, 96.447, 126.965]] AA_SCO= 2.151578947368421 CA_SCO= -0.02342105263157894
[['C', ' CA ', 171.631, 97.746, 123.348]] AA_SCO= 1.9257894736842103 CA_SCO= -0.023421052631578936
[['C', ' CA ', 172.015, 101.134, 122.064]] AA_SCO= 1.9163157894736844 CA_SCO= -0.023526315789473673
[['C', ' CA ', 170.361, 100.954, 118.723]] AA_SCO= 1.9457894736842107 CA_SCO= -0.026052631578947355
[['C', ' CA ', 172.817, 103.939, 117.086]] AA_SCO= 2.004736842105263 CA_SCO= -0.014105263157894735
[['C', ' CA ', 171.856, 103.345, 113.351]] AA_SCO= 2.0747368421052634 CA_SCO= 0.00010526315789473511
[['C', ' CA ', 168.572, 105.41, 113.759]] AA_SCO= 2.1194736842105266 CA_SCO= 0.008578947368421054
[['C', ' CA ', 170.266, 109.156, 114.746]] AA_SCO= 2.2310526315789474 CA_SCO= -0.011999999999999997
[['C', ' CA ', 172.892, 108.549, 111.31]] AA_SCO= 2.1752631578947366 CA_SCO= -0.007684210526315789
[['C', ' CA ', 169.395, 110.032, 108.907]] AA_SCO= 2.0810526315789475 CA_SCO= -0.01626315789473684
[['C', ' CA ', 168.768, 113.306, 111.647]] AA_SCO= 2.1 CA_SCO= -0.01626315789473684
[['C', ' CA ', 173.131, 113.707, 112.087]] AA_SCO= 2.099473684210526 CA_SCO= -0.016999999999999994
[['C', ' CA ', 173.7, 113.637, 107.812]] AA_SCO= 2.121052631578947 CA_SCO= -0.017578947368421048
[['C', ' CA ', 170.463, 116.081, 107.149]] AA_SCO= 2.003157894736842 CA_SCO= -0.015789473684210527
[['C', ' CA ', 169.657, 118.821, 110.358]] AA_SCO= 1.9636842105263153 CA_SCO= -0.017947368421052632
[['C', ' CA ', 173.215, 118.585, 112.123]] AA_SCO= 1.9563157894736836 CA_SCO= -0.019473684210526313
[['C', ' CA ', 174.303, 118.795, 107.663]] AA_SCO= 1.8831578947368417 CA_SCO= -0.02152631578947368
[['C', ' CA ', 177.507, 116.248, 108.04]] AA_SCO= 1.931052631578947 CA_SCO= -0.023684210526315787
[['C', ' CA ', 177.282, 114.628, 104.365]] AA_SCO= 1.9815789473684209 CA_SCO= -0.026631578947368423
[['C', ' CA ', 180.224, 111.804, 104.976]] AA_SCO= 1.9305263157894736 CA_SCO= -0.02552631578947368
[['C', ' CA ', 179.57, 110.303, 108.63]] AA_SCO= 2.1589473684210523 CA_SCO= -0.025789473684210522
[['C', ' CA ', 181.639, 108.218, 111.042]] AA_SCO= 2.0294736842105268 CA_SCO= -0.028842105263157884
[['C', ' CA ', 180.025, 104.821, 112.232]] AA_SCO= 2.018421052631579 CA_SCO= -0.02305263157894736
[['C', ' CA ', 181.081, 102.454, 115.106]] AA_SCO= 2.007894736842106 CA_SCO= -0.01989473684210526
[['C', ' CA ', 178.708, 99.604, 114.811]] AA_SCO= 2.007894736842106 CA_SCO= -0.013631578947368418
[['C', ' CA ', 178.041, 96.1, 116.457]] AA_SCO= 1.956842105263158 CA_SCO= -0.02057894736842105
[['C', ' CA ', 177.795, 93.321, 113.745]] AA_SCO= 1.7957894736842104 CA_SCO= 0.00663157894736842
[['C', ' CA ', 173.708, 93.36, 113.754]] AA_SCO= 1.7578947368421052 CA_SCO= 0.005157894736842105
[['C', ' CA ', 173.822, 97.184, 113.066]] AA_SCO= 1.8168421052631576 CA_SCO= 0.014789473684210528
[['C', ' CA ', 176.576, 96.966, 110.15]] AA_SCO= 1.8599999999999999 CA_SCO= 0.01542105263157895
[['C', ' CA ', 173.95, 94.436, 108.44]] AA_SCO= 1.9015789473684208 CA_SCO= 0.014894736842105264
[['C', ' CA ', 171.009, 97.016, 108.528]] AA_SCO= 1.9257894736842107 CA_SCO= 0.009894736842105265
[['C', ' CA ', 173.338, 100.007, 107.349]] AA_SCO= 2.063684210526316 CA_SCO= -0.015578947368421048
[['C', ' CA ', 174.967, 97.941, 104.571]] AA_SCO= 2.082105263157895 CA_SCO= -0.01273684210526316
[['C', ' CA ', 171.347, 96.639, 103.615]] AA_SCO= 2.1078947368421055 CA_SCO= -0.012684210526315787
[['C', ' CA ', 170.113, 100.23, 103.619]] AA_SCO= 2.173684210526316 CA_SCO= -0.025789473684210522
[['C', ' CA ', 172.983, 101.205, 101.414]] AA_SCO= 2.155263157894737 CA_SCO= -0.022894736842105256
[['C', ' CA ', 172.645, 98.346, 98.711]] AA_SCO= 2.0684210526315794 CA_SCO= -0.025789473684210525
[['C', ' CA ', 168.58, 98.356, 98.784]] AA_SCO= 2.121578947368421 CA_SCO= -0.04331578947368422
[['C', ' CA ', 167.905, 102.068, 99.821]] AA_SCO= 2.14421052631579 CA_SCO= -0.0501578947368421
[['C', ' CA ', 163.863, 102.863, 99.86]] AA_SCO= 2.261578947368421 CA_SCO= -0.050736842105263164
[['C', ' CA ', 163.046, 104.825, 101.136]] AA_SCO= 2.2794736842105263 CA_SCO= -0.05136842105263158
[['C', ' CA ', 166.003, 106.318, 103.109]] AA_SCO= 2.238947368421053 CA_SCO= -0.05252631578947369
[['C', ' CA ', 166.92, 109.224, 100.752]] AA_SCO= 2.1931578947368413 CA_SCO= -0.05257894736842104
[['C', ' CA ', 170.78, 110.046, 99.942]] AA_SCO= 2.187368421052631 CA_SCO= -0.05289473684210526
[['C', ' CA ', 172.334, 108.952, 103.681]] AA_SCO= 2.3678947368421057 CA_SCO= -0.052000000000000005
[['C', ' CA ', 173.701, 105.219, 101.844]] AA_SCO= 2.4768421052631577 CA_SCO= -0.04926315789473684
[['C', ' CA ', 176.921, 107.111, 100.079]] AA_SCO= 2.451052631578947 CA_SCO= -0.049052631578947375
[['C', ' CA ', 177.775, 109.933, 102.989]] AA_SCO= 2.456315789473684 CA_SCO= -0.04963157894736841
[['C', ' CA ', 178.614, 106.519, 105.563]] AA_SCO= 2.2900000000000005 CA_SCO= -0.052894736842105244
[['C', ' CA ', 182.592, 106.292, 104.31]] AA_SCO= 2.066842105263158 CA_SCO= -0.0518421052631579
[['C', ' CA ', 183.975, 104.24, 107.636]] AA_SCO= 1.9073684210526316 CA_SCO= -0.02889473684210526
[['C', ' CA ', 181.708, 102.123, 109.824]] AA_SCO= 1.9563157894736842 CA_SCO= -0.028736842105263147
[['C', ' CA ', 183.931, 100.596, 112.26]] AA_SCO= 1.9615789473684213 CA_SCO= -0.02852631578947368
[['C', ' CA ', 181.851, 97.386, 113.412]] AA_SCO= 2.0663157894736837 CA_SCO= -0.01568421052631579
[['C', ' CA ', 182.798, 96.127, 116.912]] AA_SCO= 2.0784210526315787 CA_SCO= -0.013578947368421057
[['C', ' CA ', 182.802, 92.233, 117.838]] AA_SCO= 2.0926315789473677 CA_SCO= -0.009263157894736848
[['C', ' CA ', 179.561, 91.105, 119.454]] AA_SCO= 2.1052631578947367 CA_SCO= 0.008157894736842105
[['C', ' CA ', 178.974, 87.65, 120.898]] AA_SCO= 2.068421052631579 CA_SCO= 0.015105263157894736
[['C', ' CA ', 175.622, 88.704, 122.553]] AA_SCO= 1.9321052631578948 CA_SCO= 0.018578947368421053
[['C', ' CA ', 174.533, 92.066, 124.074]] AA_SCO= 1.971578947368421 CA_SCO= 0.01931578947368421
[['C', ' CA ', 171.933, 91.359, 127.267]] AA_SCO= 2.008947368421053 CA_SCO= 0.02121052631578947
[['C', ' CA ', 169.089, 94.246, 127.418]] AA_SCO= 1.8131578947368419 CA_SCO= 0.020631578947368417
[['C', ' CA ', 169.968, 96.599, 130.318]] AA_SCO= 1.7852631578947373 CA_SCO= 0.031
[['C', ' CA ', 167.502, 95.266, 133.704]] AA_SCO= 1.7847368421052634 CA_SCO= 0.031210526315789473
[['C', ' CA ', 169.346, 91.237, 133.307]] AA_SCO= 1.765263157894737 CA_SCO= 0.03152631578947368
[['C', ' CA ', 173.284, 93.23, 133.162]] AA_SCO= 1.7410526315789472 CA_SCO= 0.027052631578947363
[['C', ' CA ', 172.13, 95.665, 136.439]] AA_SCO= 1.6673684210526318 CA_SCO= 0.027421052631578947
[['C', ' CA ', 170.353, 91.303, 138.076]] AA_SCO= 1.7784210526315793 CA_SCO= 0.03331578947368421
[['C', ' CA ', 174.239, 89.929, 137.21]] AA_SCO= 2.032105263157895 CA_SCO= 0.04057894736842106
[['C', ' CA ', 176.265, 93.469, 138.679]] AA_SCO= 2.1436842105263163 CA_SCO= 0.04552631578947369
[['C', ' CA ', 173.691, 94.715, 141.59]] AA_SCO= 2.085263157894737 CA_SCO= 0.044368421052631585
[['C', ' CA ', 171.967, 90.908, 142.863]] AA_SCO= 2.059473684210527 CA_SCO= 0.03663157894736843
[['C', ' CA ', 174.535, 87.9, 141.666]] AA_SCO= 1.9878947368421054 CA_SCO= 0.035421052631578964
[['C', ' CA ', 178.083, 89.853, 141.852]] AA_SCO= 2.027368421052632 CA_SCO= 0.031210526315789484
[['C', ' CA ', 176.27, 92.391, 145.128]] AA_SCO= 2.067894736842105 CA_SCO= 0.033526315789473696
[['C', ' CA ', 177.585, 96.382, 144.312]] AA_SCO= 1.9900000000000002 CA_SCO= 0.032842105263157895
[['C', ' CA ', 174.44, 98.58, 141.818]] AA_SCO= 1.8826315789473687 CA_SCO= 0.03247368421052632
[['C', ' CA ', 175.996, 100.076, 138.049]] AA_SCO= 1.9489473684210528 CA_SCO= 0.03026315789473684
[['C', ' CA ', 176.904, 104.021, 139.287]] AA_SCO= 1.9126315789473682 CA_SCO= 0.024473684210526318
[['C', ' CA ', 179.955, 102.215, 141.782]] AA_SCO= 1.917894736842105 CA_SCO= 0.020157894736842107
[['C', ' CA ', 180.883, 100.062, 138.363]] AA_SCO= 2.1531578947368417 CA_SCO= 0.017684210526315792
[['C', ' CA ', 183.864, 101.78, 136.835]] AA_SCO= 2.2042105263157894 CA_SCO= 0.017684210526315792
[['C', ' CA ', 184.087, 99.592, 133.342]] AA_SCO= 2.3299999999999996 CA_SCO= 0.017842105263157895
[['C', ' CA ', 182.708, 95.98, 132.776]] AA_SCO= 2.342631578947368 CA_SCO= 0.01773684210526316
[['C', ' CA ', 184.402, 93.432, 129.724]] AA_SCO= 2.466842105263158 CA_SCO= 0.02205263157894737
[['C', ' CA ', 182.936, 89.788, 129.407]] AA_SCO= 2.473684210526316 CA_SCO= 0.02236842105263158
[['C', ' CA ', 186.314, 88.172, 127.738]] AA_SCO= 2.44 CA_SCO= 0.011789473684210525
[['C', ' CA ', 188.014, 84.982, 128.654]] AA_SCO= 2.3000000000000003 CA_SCO= 0.004105263157894736
[['C', ' CA ', 185.638, 82.664, 129.814]] AA_SCO= 2.248421052631579 CA_SCO= 0.001894736842105261
[['C', ' CA ', 183.972, 85.515, 132.914]] AA_SCO= 2.2036842105263155 CA_SCO= -0.0004736842105263161
[['C', ' CA ', 182.249, 89.299, 132.472]] AA_SCO= 2.219473684210526 CA_SCO= 0.0032631578947368415
[['C', ' CA ', 184.591, 90.964, 135.278]] AA_SCO= 2.088421052631579 CA_SCO= 0.00736842105263158
[['C', ' CA ', 182.869, 94.613, 136.026]] AA_SCO= 2.051578947368421 CA_SCO= 0.011000000000000001
[['C', ' CA ', 185.823, 96.477, 138.106]] AA_SCO= 1.9094736842105267 CA_SCO= 0.008894736842105263
[['C', ' CA ', 183.826, 99.196, 140.724]] AA_SCO= 1.9863157894736847 CA_SCO= 0.008894736842105263
[['C', ' CA ', 186.874, 101.825, 142.25]] AA_SCO= 2.1105263157894742 CA_SCO= -0.004631578947368421
[['C', ' CA ', 188.626, 99.174, 144.913]] AA_SCO= 2.1578947368421058 CA_SCO= -0.0023157894736842107
[['C', ' CA ', 187.907, 95.369, 143.751]] AA_SCO= 1.9694736842105265 CA_SCO= 0.0009999999999999992
[['C', ' CA ', 187.657, 93.372, 140.769]] AA_SCO= 1.9773684210526312 CA_SCO= 0.004526315789473684
[['C', ' CA ', 184.368, 91.723, 140.736]] AA_SCO= 1.741578947368421 CA_SCO= -0.006421052631578947
[['C', ' CA ', 183.881, 89.033, 137.757]] AA_SCO= 1.7536842105263157 CA_SCO= -0.014421052631578949
[['C', ' CA ', 180.759, 86.36, 137.85]] AA_SCO= 1.5894736842105264 CA_SCO= -0.015789473684210527
[['C', ' CA ', 181.789, 83.419, 135.383]] AA_SCO= 1.5510526315789475 CA_SCO= -0.016421052631578944
[['C', ' CA ', 179.685, 83.961, 132.059]] AA_SCO= 1.4905263157894737 CA_SCO= -0.01668421052631579
[['C', ' CA ', 177.446, 80.004, 131.822]] AA_SCO= 1.5047368421052634 CA_SCO= -0.018999999999999996
[['C', ' CA ', 174.932, 82.475, 134.963]] AA_SCO= 1.6331578947368421 CA_SCO= -0.028578947368421048
[['C', ' CA ', 174.655, 85.342, 131.499]] AA_SCO= 1.7105263157894732 CA_SCO= -0.026421052631578953
[['C', ' CA ', 173.446, 82.109, 128.844]] AA_SCO= 1.81 CA_SCO= -0.031842105263157894
[['C', ' CA ', 169.501, 82.795, 128.822]] AA_SCO= 1.9247368421052629 CA_SCO= -0.04231578947368421
[['C', ' CA ', 169.168, 86.441, 129.973]] AA_SCO= 1.9368421052631577 CA_SCO= -0.03678947368421053
[['C', ' CA ', 170.961, 88.173, 126.559]] AA_SCO= 2.0815789473684205 CA_SCO= -0.04578947368421052
[['C', ' CA ', 168.577, 88.995, 123.784]] AA_SCO= 2.146315789473684 CA_SCO= -0.04805263157894737
[['C', ' CA ', 166.045, 86.858, 121.885]] AA_SCO= 2.1173684210526313 CA_SCO= -0.045894736842105266
[['C', ' CA ', 167.467, 87.365, 117.949]] AA_SCO= 2.09578947368421 CA_SCO= -0.04905263157894737
[['C', ' CA ', 171.101, 87.145, 119.294]] AA_SCO= 2.086315789473684 CA_SCO= -0.047368421052631574
[['C', ' CA ', 170.772, 83.149, 119.007]] AA_SCO= 2.094210526315789 CA_SCO= -0.06494736842105263
[['C', ' CA ', 170.01, 83.334, 115.388]] AA_SCO= 2.251052631578947 CA_SCO= -0.06321052631578947
[['C', ' CA ', 173.035, 85.698, 114.599]] AA_SCO= 2.2268421052631577 CA_SCO= -0.06373684210526316
[['C', ' CA ', 176.08, 84.052, 112.877]] AA_SCO= 2.4489473684210523 CA_SCO= -0.049631578947368415
[['C', ' CA ', 178.802, 87.013, 112.795]] AA_SCO= 2.3994736842105255 CA_SCO= -0.04568421052631579
[['C', ' CA ', 180.959, 87.854, 115.713]] AA_SCO= 2.3573684210526316 CA_SCO= -0.046105263157894726
[['C', ' CA ', 183.673, 89.978, 113.872]] AA_SCO= 2.4073684210526314 CA_SCO= -0.047789473684210514
[['C', ' CA ', 181.867, 92.63, 111.985]] AA_SCO= 2.4115789473684206 CA_SCO= -0.05036842105263156
[['C', ' CA ', 182.593, 91.032, 108.481]] AA_SCO= 2.3889473684210527 CA_SCO= -0.04826315789473682
[['C', ' CA ', 180.391, 93.416, 106.351]] AA_SCO= 2.236315789473684 CA_SCO= -0.03868421052631578
[['C', ' CA ', 181.707, 96.925, 107.87]] AA_SCO= 2.2178947368421054 CA_SCO= -0.05115789473684209
[['C', ' CA ', 185.215, 98.213, 106.549]] AA_SCO= 2.212105263157895 CA_SCO= -0.0558421052631579
[['C', ' CA ', 187.861, 97.623, 109.779]] AA_SCO= 2.117894736842105 CA_SCO= -0.06694736842105263
[['C', ' CA ', 185.94, 95.503, 112.672]] AA_SCO= 2.101578947368421 CA_SCO= -0.09426315789473685
[['C', ' CA ', 188.4, 95.555, 115.784]] AA_SCO= 2.2257894736842103 CA_SCO= -0.08610526315789474
[['C', ' CA ', 187.15, 94.122, 119.475]] AA_SCO= 2.1473684210526316 CA_SCO= -0.08394736842105265
[['C', ' CA ', 190.042, 92.69, 122.306]] AA_SCO= 2.2599999999999993 CA_SCO= -0.08800000000000001
[['C', ' CA ', 190.062, 88.695, 122.023]] AA_SCO= 2.282631578947368 CA_SCO= -0.08415789473684211
[['C', ' CA ', 193.753, 88.019, 120.055]] AA_SCO= 2.2189473684210523 CA_SCO= -0.07194736842105265
[['C', ' CA ', 195.113, 91.066, 121.706]] AA_SCO= 2.2021052631578946 CA_SCO= -0.05510526315789475
[['C', ' CA ', 196.928, 90.82, 125.024]] AA_SCO= 2.231578947368421 CA_SCO= -0.06110526315789474
[['C', ' CA ', 195.443, 93.821, 128.033]] AA_SCO= 2.1989473684210528 CA_SCO= -0.060736842105263165
[['C', ' CA ', 195.025, 97.389, 126.607]] AA_SCO= 2.1805263157894736 CA_SCO= -0.061315789473684226
[['C', ' CA ', 195.702, 96.346, 122.794]] AA_SCO= 2.1894736842105265 CA_SCO= -0.06100000000000001
[['C', ' CA ', 192.401, 94.915, 120.983]] AA_SCO= 2.2647368421052634 CA_SCO= -0.06578947368421054
[['C', ' CA ', 192.787, 93.185, 117.552]] AA_SCO= 2.2442105263157894 CA_SCO= -0.06863157894736843
[['C', ' CA ', 191.009, 95.157, 114.484]] AA_SCO= 2.1789473684210527 CA_SCO= -0.0672105263157895
[['C', ' CA ', 190.991, 92.778, 110.784]] AA_SCO= 2.2000000000000006 CA_SCO= -0.06800000000000002
[['C', ' CA ', 190.012, 95.911, 108.411]] AA_SCO= 2.312631578947369 CA_SCO= -0.06010526315789475
[['C', ' CA ', 188.194, 94.108, 105.454]] AA_SCO= 2.332631578947369 CA_SCO= -0.04247368421052631
[['C', ' CA ', 187.221, 96.526, 102.23]] AA_SCO= 2.352105263157895 CA_SCO= -0.02863157894736841
[['C', ' CA ', 190.217, 98.722, 101.015]] AA_SCO= 2.3768421052631576 CA_SCO= -0.002842105263157897
[['C', ' CA ', 188.68, 102.663, 102.401]] AA_SCO= 2.3015789473684207 CA_SCO= 0.023421052631578943
[['C', ' CA ', 188.919, 100.898, 106.43]] AA_SCO= 2.1647368421052637 CA_SCO= 0.021578947368421048
[['C', ' CA ', 192.912, 99.264, 105.385]] AA_SCO= 2.15 CA_SCO= 0.009052631578947368
[['C', ' CA ', 193.839, 103.139, 103.637]] AA_SCO= 2.1626315789473685 CA_SCO= 0.008999999999999998
[['C', ' CA ', 192.197, 105.539, 106.73]] AA_SCO= 2.1557894736842105 CA_SCO= 0.0016842105263157896
[['C', ' CA ', 193.62, 102.965, 109.734]] AA_SCO= 2.2726315789473683 CA_SCO= 0.0012631578947368393
[['C', ' CA ', 197.185, 101.798, 107.929]] AA_SCO= 2.310526315789474 CA_SCO= 0.001157894736842105
[['C', ' CA ', 197.736, 106.078, 106.676]] AA_SCO= 2.2931578947368423 CA_SCO= 0.0075789473684210506
[['C', ' CA ', 196.694, 107.041, 111.104]] AA_SCO= 2.342105263157895 CA_SCO= 0.005684210526315789
[['C', ' CA ', 199.06, 103.412, 112.355]] AA_SCO= 2.3468421052631583 CA_SCO= 0.006263157894736843
[['C', ' CA ', 202.089, 105.047, 109.406]] AA_SCO= 2.3384210526315794 CA_SCO= 0.009157894736842104
[['C', ' CA ', 201.035, 109.221, 111.118]] AA_SCO= 2.295263157894737 CA_SCO= 0.015157894736842105
[['C', ' CA ', 202.391, 107.121, 114.293]] AA_SCO= 2.2605263157894737 CA_SCO= 0.016684210526315787
[['C', ' CA ', 198.937, 107.83, 116.968]] AA_SCO= 2.314736842105263 CA_SCO= 0.018315789473684205
[['C', ' CA ', 198.247, 103.574, 117.238]] AA_SCO= 2.251578947368421 CA_SCO= 0.015736842105263157
[['C', ' CA ', 201.562, 101.055, 117.401]] AA_SCO= 2.238947368421053 CA_SCO= 0.0030526315789473667
[['C', ' CA ', 199.708, 97.732, 115.843]] AA_SCO= 2.2457894736842103 CA_SCO= -0.0062105263157894745
[['C', ' CA ', 202.343, 94.583, 116.074]] AA_SCO= 2.1005263157894736 CA_SCO= -0.01694736842105263
[['C', ' CA ', 200.196, 92.029, 113.201]] AA_SCO= 2.1110526315789477 CA_SCO= -0.019578947368421053
[['C', ' CA ', 198.237, 89.263, 115.588]] AA_SCO= 2.1926315789473687 CA_SCO= -0.018842105263157896
[['C', ' CA ', 200.556, 85.519, 114.683]] AA_SCO= 2.2126315789473683 CA_SCO= -0.01610526315789474
[['C', ' CA ', 203.665, 87.048, 117.709]] AA_SCO= 2.2773684210526315 CA_SCO= -0.004210526315789476
[['C', ' CA ', 200.697, 87.993, 120.636]] AA_SCO= 2.3068421052631582 CA_SCO= -0.0006315789473684224
[['C', ' CA ', 199.829, 84.841, 122.696]] AA_SCO= 2.321578947368421 CA_SCO= 0.005999999999999999
[['C', ' CA ', 196.025, 84.311, 122.895]] AA_SCO= 2.263157894736842 CA_SCO= 0.0022105263157894735
[['C', ' CA ', 196.845, 83.515, 119.318]] AA_SCO= 2.2684210526315787 CA_SCO= -0.000894736842105265
[['C', ' CA ', 193.856, 84.986, 116.124]] AA_SCO= 2.2484210526315787 CA_SCO= -0.000894736842105265
[['C', ' CA ', 193.303, 80.712, 116.525]] AA_SCO= 2.2505263157894735 CA_SCO= -0.0003684210526315811
[['C', ' CA ', 190.75, 81.306, 119.904]] AA_SCO= 2.2673684210526317 CA_SCO= -0.0015263157894736823
[['C', ' CA ', 188.777, 84.53, 117.753]] AA_SCO= 2.2752631578947367 CA_SCO= -0.0014736842105263163
[['C', ' CA ', 188.151, 82.002, 114.494]] AA_SCO= 2.252105263157895 CA_SCO= -0.0032631578947368376
[['C', ' CA ', 187.053, 78.412, 117.505]] AA_SCO= 2.292105263157895 CA_SCO= -0.001631578947368422
[['C', ' CA ', 184.629, 81.646, 119.358]] AA_SCO= 2.2868421052631582 CA_SCO= -0.0064736842105263155
[['C', ' CA ', 183.567, 83.12, 115.54]] AA_SCO= 2.343684210526316 CA_SCO= -0.00436842105263158
[['C', ' CA ', 182.861, 79.097, 114.186]] AA_SCO= 2.341578947368421 CA_SCO= 0.008578947368421052
[['C', ' CA ', 181.025, 78.043, 117.73]] AA_SCO= 2.3142105263157897 CA_SCO= 0.018315789473684216
[['C', ' CA ', 178.743, 81.657, 117.207]] AA_SCO= 2.4278947368421058 CA_SCO= 0.02636842105263158
[['C', ' CA ', 177.945, 80.286, 113.692]] AA_SCO= 2.4084210526315797 CA_SCO= 0.027473684210526317
[['C', ' CA ', 177.186, 76.61, 114.069]] AA_SCO= 2.423684210526316 CA_SCO= 0.017421052631578955
[['C', ' CA ', 174.83, 77.258, 118.103]] AA_SCO= 2.4200000000000004 CA_SCO= 0.01578947368421053
[['C', ' CA ', 172.985, 80.224, 115.677]] AA_SCO= 2.3810526315789473 CA_SCO= 0.016578947368421058
[['C', ' CA ', 172.637, 77.717, 112.514]] AA_SCO= 2.275789473684211 CA_SCO= 0.015631578947368423
[['C', ' CA ', 171.244, 74.484, 114.747]] AA_SCO= 2.2189473684210523 CA_SCO= 0.015210526315789475
[['C', ' CA ', 168.634, 77.278, 116.48]] AA_SCO= 2.2478947368421047 CA_SCO= 0.019578947368421057
[['C', ' CA ', 167.78, 79.091, 112.696]] AA_SCO= 2.291052631578947 CA_SCO= 0.023526315789473687
[['C', ' CA ', 167.105, 75.23, 111.188]] AA_SCO= 2.3057894736842104 CA_SCO= 0.01378947368421053
[['C', ' CA ', 165.012, 74.094, 114.879]] AA_SCO= 2.31578947368421 CA_SCO= -0.012894736842105263
[['C', ' CA ', 162.815, 77.856, 114.748]] AA_SCO= 2.21578947368421 CA_SCO= -0.04626315789473684
[['C', ' CA ', 162.17, 76.817, 110.558]] AA_SCO= 2.208333333333333 CA_SCO= -0.05144444444444444
[['C', ' CA ', 160.974, 72.738, 111.721]] AA_SCO= 2.264117647058823 CA_SCO= -0.05547058823529411
[['C', ' CA ', 158.421, 74.425, 114.752]] AA_SCO= 2.254375 CA_SCO= -0.0603125
[['C', ' CA ', 157.233, 76.515, 111.106]] AA_SCO= 2.26 CA_SCO= -0.062200000000000005
[['C', ' CA ', 157.656, 80.474, 112.486]] AA_SCO= 2.236428571428571 CA_SCO= -0.06907142857142858
[['C', ' CA ', 159.512, 82.548, 109.617]] AA_SCO= 2.183076923076923 CA_SCO= -0.07561538461538461
[['C', ' CA ', 163.141, 83.142, 110.27]] AA_SCO= 2.1799999999999993 CA_SCO= -0.08708333333333333
[['C', ' CA ', 164.838, 86.035, 107.813]] AA_SCO= 2.1599999999999997 CA_SCO= -0.096
[['C', ' CA ', 167.824, 84.045, 105.805]] AA_SCO= 2.152 CA_SCO= -0.10840000000000001
INFO : Start RosettaCM
VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
<generator object Model.get_residues at 0x7fd3ba3d09e0>
1 S
Detected: S
2 E
Detected: E
3 R
Detected: R
4 I
Detected: I
5 V
Detected: V
6 I
Detected: I
7 S
Detected: S
8 P
Detected: P
9 T
Detected: T
10 S
Detected: S
11 R
Detected: R
12 Q
Detected: Q
13 E
Detected: E
14 G
Detected: G
15 H
Detected: H
16 A
Detected: A
17 E
Detected: E
18 L
Detected: L
19 V
Detected: V
20 M
Detected: M
21 E
Detected: E
22 V
Detected: V
23 D
Detected: D
24 D
Detected: D
25 E
Detected: E
26 G
Detected: G
27 I
Detected: I
28 V
Detected: V
29 T
Detected: T
30 K
Detected: K
31 G
Detected: G
32 R
Detected: R
33 Y
Detected: Y
34 F
Detected: F
35 S
Detected: S
36 I
Detected: I
37 T
Detected: T
38 P
Detected: P
39 V
Detected: V
40 R
Detected: R
41 G
Detected: G
42 L
Detected: L
43 E
Detected: E
44 K
Detected: K
45 M
Detected: M
46 V
Detected: V
47 T
Detected: T
48 G
Detected: G
49 K
Detected: K
50 A
Detected: A
51 P
Detected: P
52 E
Detected: E
53 T
Detected: T
54 A
Detected: A
55 P
Detected: P
56 V
Detected: V
57 M
Detected: M
58 V
Detected: V
59 Q
Detected: Q
60 R
Detected: R
61 I
Detected: I
62 C
Detected: C
63 G
Detected: G
64 V
Detected: V
65 C
Detected: C
66 P
Detected: P
67 I
Detected: I
68 P
Detected: P
69 H
Detected: H
70 T
Detected: T
71 L
Detected: L
72 A
Detected: A
73 S
Detected: S
74 V
Detected: V
75 E
Detected: E
76 A
Detected: A
77 I
Detected: I
78 D
Detected: D
79 D
Detected: D
80 S
Detected: S
81 L
Detected: L
82 D
Detected: D
83 I
Detected: I
84 E
Detected: E
85 V
Detected: V
86 P
Detected: P
87 K
Detected: K
88 A
Detected: A
89 G
Detected: G
90 R
Detected: R
91 L
Detected: L
92 L
Detected: L
93 R
Detected: R
94 E
Detected: E
95 L
Detected: L
96 T
Detected: T
97 L
Detected: L
98 A
Detected: A
99 A
Detected: A
100 H
Detected: H
101 H
Detected: H
102 V
Detected: V
103 N
Detected: N
104 S
Detected: S
105 H
Detected: H
106 A
Detected: A
107 I
Detected: I
108 H
Detected: H
109 H
Detected: H
110 F
Detected: F
111 L
Detected: L
112 I
Detected: I
113 A
Detected: A
114 P
Detected: P
115 D
Detected: D
116 F
Detected: F
117 V
Detected: V
118 P
Detected: P
119 E
Detected: E
120 N
Detected: N
121 L
Detected: L
122 M
Detected: M
123 A
Detected: A
124 D
Detected: D
125 A
Detected: A
126 I
Detected: I
127 N
Detected: N
128 S
Detected: S
129 V
Detected: V
130 S
Detected: S
131 E
Detected: E
132 I
Detected: I
133 R
Detected: R
134 K
Detected: K
135 N
Detected: N
136 A
Detected: A
137 Q
Detected: Q
138 Y
Detected: Y
139 V
Detected: V
140 V
Detected: V
141 D
Detected: D
142 M
Detected: M
143 V
Detected: V
144 A
Detected: A
145 G
Detected: G
146 E
Detected: E
147 G
Detected: G
148 I
Detected: I
149 H
Detected: H
150 P
Detected: P
151 S
Detected: S
152 D
Detected: D
153 V
Detected: V
154 R
Detected: R
155 I
Detected: I
156 G
Detected: G
157 G
Detected: G
158 M
Detected: M
159 A
Detected: A
160 D
Detected: D
161 N
Detected: N
162 I
Detected: I
163 T
Detected: T
164 E
Detected: E
165 L
Detected: L
166 A
Detected: A
167 R
Detected: R
168 K
Detected: K
169 R
Detected: R
170 L
Detected: L
171 Y
Detected: Y
172 A
Detected: A
173 R
Detected: R
174 L
Detected: L
175 K
Detected: K
176 Q
Detected: Q
177 L
Detected: L
178 K
Detected: K
179 P
Detected: P
180 K
Detected: K
181 V
Detected: V
182 N
Detected: N
183 E
Detected: E
184 H
Detected: H
185 V
Detected: V
186 E
Detected: E
187 L
Detected: L
188 M
Detected: M
189 I
Detected: I
190 G
Detected: G
191 L
Detected: L
192 I
Detected: I
193 E
Detected: E
194 D
Detected: D
195 K
Detected: K
196 G
Detected: G
197 L
Detected: L
198 P
Detected: P
199 E
Detected: E
200 G
Detected: G
201 L
Detected: L
202 G
Detected: G
203 V
Detected: V
204 H
Detected: H
205 N
Detected: N
206 Q
Detected: Q
207 P
Detected: P
208 T
Detected: T
209 L
Detected: L
210 A
Detected: A
211 S
Detected: S
212 H
Detected: H
213 Q
Detected: Q
214 I
Detected: I
215 Y
Detected: Y
216 G
Detected: G
217 D
Detected: D
218 R
Detected: R
219 T
Detected: T
220 K
Detected: K
221 F
Detected: F
222 D
Detected: D
223 L
Detected: L
224 D
Detected: D
225 R
Detected: R
226 F
Detected: F
227 T
Detected: T
228 E
Detected: E
229 I
Detected: I
230 M
Detected: M
231 P
Detected: P
232 E
Detected: E
233 S
Detected: S
234 W
Detected: W
235 Y
Detected: Y
236 D
Detected: D
237 D
Detected: D
238 P
Detected: P
239 E
Detected: E
240 I
Detected: I
241 A
Detected: A
242 K
Detected: K
243 R
Detected: R
244 A
Detected: A
245 C
Detected: C
246 S
Detected: S
247 T
Detected: T
248 I
Detected: I
249 P
Detected: P
250 L
Detected: L
251 Y
Detected: Y
252 D
Detected: D
253 G
Detected: G
254 R
Detected: R
255 N
Detected: N
256 V
Detected: V
257 E
Detected: E
258 V
Detected: V
259 G
Detected: G
260 P
Detected: P
261 R
Detected: R
262 A
Detected: A
263 R
Detected: R
264 M
Detected: M
265 V
Detected: V
266 E
Detected: E
267 F
Detected: F
268 Q
Detected: Q
269 G
Detected: G
270 F
Detected: F
271 K
Detected: K
272 E
Detected: E
273 R
Detected: R
274 G
Detected: G
275 V
Detected: V
276 V
Detected: V
277 A
Detected: A
278 Q
Detected: Q
279 H
Detected: H
280 V
Detected: V
281 A
Detected: A
282 R
Detected: R
283 A
Detected: A
284 L
Detected: L
285 E
Detected: E
286 M
Detected: M
287 K
Detected: K
288 T
Detected: T
289 A
Detected: A
290 L
Detected: L
291 S
Detected: S
292 R
Detected: R
293 A
Detected: A
294 I
Detected: I
295 E
Detected: E
296 I
Detected: I
297 L
Detected: L
298 D
Detected: D
299 E
Detected: E
300 L
Detected: L
301 D
Detected: D
302 T
Detected: T
303 S
Detected: S
304 A
Detected: A
305 P
Detected: P
306 V
Detected: V
307 R
Detected: R
308 A
Detected: A
309 D
Detected: D
310 F
Detected: F
311 D
Detected: D
312 E
Detected: E
313 R
Detected: R
314 G
Detected: G
315 T
Detected: T
316 G
Detected: G
317 K
Detected: K
318 L
Detected: L
319 G
Detected: G
320 I
Detected: I
321 G
Detected: G
322 A
Detected: A
323 I
Detected: I
324 E
Detected: E
325 A
Detected: A
326 P
Detected: P
327 R
Detected: R
328 G
Detected: G
329 L
Detected: L
330 D
Detected: D
331 V
Detected: V
332 H
Detected: H
333 M
Detected: M
334 A
Detected: A
335 K
Detected: K
336 V
Detected: V
337 E
Detected: E
338 N
Detected: N
339 G
Detected: G
340 K
Detected: K
341 I
Detected: I
342 Q
Detected: Q
343 F
Detected: F
344 Y
Detected: Y
345 S
Detected: S
346 A
Detected: A
347 L
Detected: L
348 V
Detected: V
349 P
Detected: P
350 T
Detected: T
351 T
Detected: T
352 W
Detected: W
353 N
Detected: N
354 I
Detected: I
355 P
Detected: P
356 T
Detected: T
357 M
Detected: M
358 G
Detected: G
359 P
Detected: P
360 A
Detected: A
361 T
Detected: T
362 E
Detected: E
363 G
Detected: G
364 F
Detected: F
365 H
Detected: H
366 H
Detected: H
367 E
Detected: E
368 Y
Detected: Y
369 G
Detected: G
370 P
Detected: P
371 H
Detected: H
372 V
Detected: V
373 I
Detected: I
374 R
Detected: R
375 A
Detected: A
376 Y
Detected: Y
377 D
Detected: D
378 P
Detected: P
379 C
Detected: C
380 L
Detected: L
381 S
Detected: S
382 C
Detected: C
383 A
Detected: A
384 T
Detected: T
385 H
Detected: H
386 K
Detected: K
387 P
388 R
Detected: R
389 I
Detected: I
390 G
Detected: G
391 Y
Detected: Y
392 I
Detected: I
393 H
Detected: H
394 L
Detected: L
395 S
Detected: S
396 G
Detected: G
397 C
Detected: C
398 T
Detected: T
399 G
Detected: G
400 D
Detected: D
401 A
Detected: A
402 M
Detected: M
403 S
Detected: S
404 L
Detected: L
405 T
Detected: T
406 E
Detected: E
407 N
Detected: N
408 Y
Detected: Y
409 D
Detected: D
410 I
Detected: I
411 L
Detected: L
412 A
Detected: A
413 E
Detected: E
414 L
Detected: L
415 L
Detected: L
416 T
Detected: T
417 N
Detected: N
418 M
Detected: M
419 V
Detected: V
420 D
Detected: D
421 I
Detected: I
422 V
Detected: V
423 Y
Detected: Y
424 G
Detected: G
425 Q
Detected: Q
426 T
Detected: T
427 L
Detected: L
428 V
Detected: V
429 D
Detected: D
430 L
Detected: L
431 W
Detected: W
432 E
Detected: E
433 M
Detected: M
434 P
Detected: P
435 E
Detected: E
436 M
Detected: M
437 D
Detected: D
438 L
Detected: L
439 A
Detected: A
440 L
Detected: L
441 V
Detected: V
442 E
Detected: E
443 G
Detected: G
444 S
Detected: S
445 V
Detected: V
446 C
Detected: C
447 L
Detected: L
448 Q
Detected: Q
449 D
Detected: D
450 E
Detected: E
451 H
Detected: H
452 S
Detected: S
453 L
Detected: L
454 H
Detected: H
455 E
Detected: E
456 L
Detected: L
457 K
Detected: K
458 E
Detected: E
459 L
Detected: L
460 R
Detected: R
461 E
Detected: E
462 K
Detected: K
463 A
Detected: A
464 K
Detected: K
465 L
Detected: L
466 V
Detected: V
467 C
Detected: C
468 A
Detected: A
469 F
Detected: F
470 G
Detected: G
471 S
Detected: S
472 C
Detected: C
473 A
Detected: A
474 A
Detected: A
475 T
Detected: T
476 G
Detected: G
477 C
Detected: C
478 F
Detected: F
479 T
Detected: T
480 R
Detected: R
481 Y
Detected: Y
482 S
Detected: S
483 R
Detected: R
484 G
Detected: G
485 G
Detected: G
486 Q
Detected: Q
487 Q
Detected: Q
488 A
Detected: A
489 Q
Detected: Q
490 P
Detected: P
491 S
Detected: S
492 H
Detected: H
493 E
Detected: E
494 S
Detected: S
495 F
Detected: F
496 V
Detected: V
497 P
Detected: P
498 I
Detected: I
499 A
Detected: A
500 D
Detected: D
501 L
Detected: L
502 I
Detected: I
503 D
Detected: D
504 V
Detected: V
505 D
Detected: D
506 L
Detected: L
507 A
Detected: A
508 L
Detected: L
509 P
Detected: P
510 G
Detected: G
511 C
Detected: C
512 P
Detected: P
513 P
Detected: P
514 S
Detected: S
515 P
Detected: P
516 E
Detected: E
517 I
Detected: I
518 I
Detected: I
519 A
Detected: A
520 K
Detected: K
521 T
Detected: T
522 V
Detected: V
523 V
Detected: V
524 A
Detected: A
525 L
Detected: L
526 L
Detected: L
527 N
Detected: N
528 N
Detected: N
529 D
Detected: D
530 M
Detected: M
531 D
Detected: D
532 Y
Detected: Y
533 L
Detected: L
534 Q
Detected: Q
535 P
Detected: P
536 M
Detected: M
537 L
Detected: L
538 D
Detected: D
539 L
Detected: L
540 A
Detected: A
541 G
Detected: G
542 Y
Detected: Y
543 T
Detected: T
544 E
Detected: E
545 A
Detected: A
546 C
Detected: C
547 G
Detected: G
548 C
Detected: C
549 D
Detected: D
550 L
Detected: L
551 Q
Detected: Q
552 T
Detected: T
553 K
Detected: K
554 V
Detected: V
555 V
Detected: V
556 N
Detected: N
557 Q
Detected: Q
558 G
Detected: G
559 L
Detected: L
560 C
Detected: C
561 I
Detected: I
562 G
Detected: G
563 C
Detected: C
564 G
Detected: G
565 T
Detected: T
566 C
Detected: C
567 A
Detected: A
568 M
Detected: M
569 A
Detected: A
570 C
Detected: C
571 Q
Detected: Q
572 T
Detected: T
573 R
Detected: R
574 A
Detected: A
575 L
Detected: L
576 D
Detected: D
577 M
Detected: M
578 T
Detected: T
579 N
Detected: N
580 G
Detected: G
581 R
Detected: R
582 P
Detected: P
583 E
Detected: E
584 L
Detected: L
585 N
Detected: N
586 S
Detected: S
587 D
Detected: D
588 R
Detected: R
589 C
Detected: C
590 I
Detected: I
591 K
Detected: K
592 C
Detected: C
593 G
Detected: G
594 I
Detected: I
595 C
Detected: C
596 Y
Detected: Y
597 V
Detected: V
598 Q
Detected: Q
599 C
Detected: C
600 P
Detected: P
601 R
Detected: R
602 S
Detected: S
603 W
Detected: W
604 W
Detected: W
605 P
Detected: P
606 E
Detected: E
607 E
Detected: E
608 Q
Detected: Q
609 I
Detected: I
610 K
Detected: K
611 K
Detected: K
612 E
Detected: E
613 L
Detected: L
614 V
Detected: V
615 L
Detected: L
616 G
Detected: G
617 T
Detected: T
618 Y
Detected: Y
619 K
Detected: K
620 E
Detected: E
621 I
Detected: I
622 V
Detected: V
623 S
Detected: S
624 A
Detected: A
625 R
Detected: R
626 S
Detected: S
627 T
Detected: T
628 D
Detected: D
629 R
Detected: R
630 E
Detected: E
631 I
Detected: I
632 Q
Detected: Q
633 K
Detected: K
634 L
Detected: L
635 A
Detected: A
636 Q
Detected: Q
637 D
Detected: D
638 G
Detected: G
639 G
Detected: G
640 I
Detected: I
641 V
Detected: V
642 T
Detected: T
643 G
Detected: G
644 L
Detected: L
645 L
Detected: L
646 A
Detected: A
647 Y
Detected: Y
648 A
Detected: A
649 L
Detected: L
650 D
Detected: D
651 E
Detected: E
652 G
Detected: G
653 I
Detected: I
654 I
Detected: I
655 E
Detected: E
656 G
Detected: G
657 A
Detected: A
658 V
Detected: V
659 V
Detected: V
660 A
Detected: A
661 G
Detected: G
662 P
Detected: P
663 G
Detected: G
664 E
Detected: E
665 E
Detected: E
666 F
Detected: F
667 W
Detected: W
668 K
Detected: K
669 P
Detected: P
670 Q
Detected: Q
671 P
Detected: P
672 M
Detected: M
673 V
Detected: V
674 A
Detected: A
675 M
Detected: M
676 S
Detected: S
677 S
Detected: S
678 D
Detected: D
679 E
Detected: E
680 L
Detected: L
681 K
Detected: K
682 A
Detected: A
683 A
Detected: A
684 A
Detected: A
685 G
Detected: G
686 T
Detected: T
687 K
Detected: K
688 Y
Detected: Y
689 T
Detected: T
690 F
Detected: F
691 S
Detected: S
692 P
Detected: P
693 N
Detected: N
694 V
Detected: V
695 M
Detected: M
696 M
Detected: M
697 L
Detected: L
698 K
Detected: K
699 K
Detected: K
700 A
Detected: A
701 V
Detected: V
702 R
Detected: R
703 Q
Detected: Q
704 Y
Detected: Y
705 G
Detected: G
706 I
Detected: I
707 E
Detected: E
708 K
Detected: K
709 L
Detected: L
710 G
Detected: G
711 T
Detected: T
712 V
Detected: V
713 A
Detected: A
714 I
Detected: I
715 P
Detected: P
716 C
Detected: C
717 Q
Detected: Q
718 T
Detected: T
719 M
Detected: M
720 G
Detected: G
721 I
Detected: I
722 R
Detected: R
723 K
Detected: K
724 M
Detected: M
725 Q
Detected: Q
726 T
Detected: T
727 Y
Detected: Y
728 P
Detected: P
729 F
Detected: F
730 G
Detected: G
731 V
Detected: V
732 R
Detected: R
733 F
Detected: F
734 L
Detected: L
735 A
Detected: A
736 D
Detected: D
737 K
Detected: K
738 I
Detected: I
739 K
Detected: K
740 L
Detected: L
741 L
Detected: L
742 V
Detected: V
743 G
Detected: G
744 I
Detected: I
745 Y
Detected: Y
746 C
Detected: C
747 M
Detected: M
748 E
Detected: E
749 N
Detected: N
750 F
Detected: F
751 P
Detected: P
752 Y
Detected: Y
753 T
Detected: T
754 S
Detected: S
755 L
Detected: L
756 Q
Detected: Q
757 T
Detected: T
758 F
Detected: F
759 I
Detected: I
760 C
Detected: C
761 E
Detected: E
762 K
Detected: K
763 L
Detected: L
764 G
Detected: G
765 V
Detected: V
766 S
Detected: S
767 M
Detected: M
768 E
Detected: E
769 L
Detected: L
770 V
Detected: V
771 E
Detected: E
772 K
Detected: K
773 M
Detected: M
774 D
Detected: D
775 I
Detected: I
776 G
Detected: G
777 K
Detected: K
778 G
Detected: G
779 K
Detected: K
780 F
Detected: F
781 W
Detected: W
782 V
Detected: V
783 Y
Detected: Y
784 T
Detected: T
785 Q
Detected: Q
786 D
Detected: D
787 D
Detected: D
788 V
Detected: V
789 L
Detected: L
790 T
Detected: T
791 L
Detected: L
792 P
Detected: P
793 L
Detected: L
794 K
Detected: K
795 E
Detected: E
796 T
Detected: T
797 H
Detected: H
798 G
Detected: G
799 Y
Detected: Y
800 E
Detected: E
801 Q
Detected: Q
802 A
Detected: A
803 G
Detected: G
804 C
Detected: C
805 K
Detected: K
806 I
Detected: I
807 C
Detected: C
808 K
Detected: K
809 D
Detected: D
810 Y
Detected: Y
811 V
Detected: V
812 A
Detected: A
813 E
Detected: E
814 L
Detected: L
815 A
Detected: A
816 D
Detected: D
817 V
Detected: V
818 S
Detected: S
819 T
Detected: T
820 G
Detected: G
821 S
Detected: S
822 V
Detected: V
823 G
Detected: G
824 S
Detected: S
825 P
Detected: P
826 D
Detected: D
827 G
Detected: G
828 W
Detected: W
829 S
Detected: S
830 T
Detected: T
831 V
Detected: V
832 I
Detected: I
833 T
Detected: T
834 R
Detected: R
835 T
Detected: T
836 D
Detected: D
837 A
Detected: A
838 G
Detected: G
839 D
Detected: D
840 S
Detected: S
841 I
Detected: I
842 F
Detected: F
843 K
Detected: K
844 Q
Detected: Q
845 A
Detected: A
846 V
Detected: V
847 E
Detected: E
848 A
Detected: A
849 G
Detected: G
850 L
Detected: L
851 F
Detected: F
852 E
Detected: E
853 T
Detected: T
854 K
Detected: K
855 P
Detected: P
856 I
Detected: I
857 E
Detected: E
858 E
Detected: E
859 V
Detected: V
860 K
Detected: K
861 P
Detected: P
862 G
Detected: G
863 L
Detected: L
864 G
Detected: G
865 L
Detected: L
866 L
Detected: L
867 E
Detected: E
868 K
Detected: K
869 L
Detected: L
870 A
Detected: A
871 A
Detected: A
872 Q
Detected: Q
873 K
Detected: K
874 K
Detected: K
875 E
Detected: E
876 K
Detected: K
877 A
Detected: A
878 E
Detected: E
879 K
Detected: K
880 N
Detected: N
881 I
Detected: I
882 A
Detected: A
883 A
Detected: A
884 R
Detected: R
885 K
Detected: K
886 E
Detected: E
887 M
Detected: M
888 G
Detected: G
889 L
Detected: L
890 P
Detected: P
891 T
Detected: T
892 P
Detected: P
893 F
Detected: F
VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
max_jobs: 8

flags
www.rosettacommons.org 2021-04-20T20:52:25.363712
-in::file::fasta seq.fasta -in::file::alignment alignment.txt -in::file::template_pdb 1tmpA.pdb
urandom', seed=429659882 seed_offset=0 real_seed=429659882
basic.random.init_random_generator: RandomGenerator:init: Normal mode, seed=429659882 RG_type=mt19937
core.chemical.GlobalResidueTypeSet: Finished initializing fa_standard residue type set. Created 984 residue types
core.chemical.GlobalResidueTypeSet: Total time to initialize 1.21 seconds.
core.import_pose.import_pose: File '1tmpA.pdb' automatically determined to be of type PDB
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER:NtermProteinFull 1
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER:NtermProteinFull 1
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 2
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 2
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 2
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 2
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 2
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 3
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 4
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 4
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 4
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 4
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 5
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 5
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 5
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 6
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 6
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 6
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 6
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 7
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 7
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 8
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 8
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 8
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 9
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 9
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 9
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 10
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 10
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 11
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 15
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 16
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 18
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 18
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 18
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 18
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 19
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 19
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 19
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 20
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 20
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 20
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 20
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 22
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 22
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 22
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 23
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 23
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 23
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 23
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 24
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 24
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 24
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 24
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 25
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 25
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 25
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 25
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 25
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 27
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 27
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 27
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 27
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 28
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 28
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 28
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 29
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 29
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 29
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 30
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 30
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 30
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 30
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 30
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 32
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 33
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 34
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 35
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 35
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 36
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 36
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 36
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 36
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 37
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 37
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 37
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 38
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 38
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 38
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 39
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 39
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 39
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 40
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 42
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 42
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 42
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 42
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 43
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 43
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 43
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 43
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 43
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 44
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 44
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 44
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 44
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 44
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 45
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 45
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 45
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 45
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 46
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 46
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 46
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 47
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 47
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 47
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 49
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 49
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 49
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 49
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 49
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 50
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 51
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 51
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 51
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 52
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 52
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 52
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 52
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 52
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 53
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 53
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 53
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 54
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 55
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 55
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 55
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 56
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 56
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 56
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 57
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 57
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 57
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 57
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 58
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 58
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 58
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 59
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 59
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 59
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 59
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 59
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 60
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 61
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 61
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 61
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 61
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 62
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 62
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 64
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 64
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 64
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 65
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 65
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 66
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 66
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 66
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 67
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 67
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 67
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 67
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 68
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 68
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 68
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 69
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 70
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 70
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 70
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 71
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 71
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 71
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 71
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 72
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 73
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 73
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 74
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 74
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 74
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 75
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 75
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 75
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 75
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 75
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 76
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 77
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 77
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 77
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 77
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 78
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 78
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 78
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 78
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 79
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 79
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 79
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 79
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 80
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 80
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 81
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 81
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 81
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 81
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 82
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 82
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 82
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 82
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 83
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 83
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 83
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 83
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 84
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 84
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 84
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 84
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 84
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 85
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 85
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 85
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 86
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 86
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 86
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 87
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 87
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 87
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 87
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 87
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 88
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 90
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 91
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 91
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 91
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 91
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 92
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 92
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 92
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 92
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 93
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 94
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 94
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 94
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 94
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 94
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 95
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 95
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 95
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 95
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 96
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 96
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 96
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 97
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 97
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 97
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 97
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 98
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 99
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 100
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 101
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 102
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 102
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 102
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 103
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 103
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 103
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 103
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 104
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 104
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 105
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 106
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 107
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 107
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 107
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 107
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 108
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 109
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 110
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 111
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 111
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 111
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 111
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 112
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 112
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 112
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 112
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 113
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 114
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 114
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 114
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 115
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 115
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 115
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 115
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 116
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 117
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 117
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 117
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 118
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 118
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 118
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 119
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 119
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 119
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 119
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 119
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 120
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 120
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 120
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 120
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 121
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 121
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 121
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 121
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 122
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 122
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 122
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 122
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 123
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 124
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 124
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 124
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 124
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 125
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 126
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 126
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 126
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 126
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 127
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 127
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 127
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 127
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 128
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 128
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 129
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 129
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 129
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 130
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 130
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 131
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 131
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 131
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 131
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 131
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 132
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 132
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 132
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 132
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 133
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 134
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 134
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 134
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 134
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 134
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 135
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 135
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 135
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 135
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 136
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 137
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 137
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 137
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 137
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 137
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 138
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 139
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 139
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 139
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 140
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 140
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 140
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 141
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 141
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 141
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 141
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 142
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 142
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 142
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 142
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 143
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 143
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 143
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 144
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 146
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 146
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 146
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 146
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 146
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 148
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 148
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 148
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 148
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 149
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 150
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 150
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 150
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 151
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 151
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 152
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 152
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 152
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 152
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 153
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 153
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 153
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 154
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 155
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 155
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 155
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 155
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 158
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 158
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 158
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 158
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 159
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 160
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 160
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 160
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 160
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 161
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 161
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 161
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 161
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 162
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 162
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 162
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 162
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 163
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 163
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 163
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 164
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 164
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 164
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 164
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 164
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 165
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 165
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 165
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 165
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 166
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 167
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 168
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 168
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 168
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 168
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 168
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 169
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 170
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 170
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 170
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 170
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 171
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 172
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 173
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 174
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 174
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 174
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 174
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 175
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 175
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 175
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 175
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 175
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 176
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 176
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 176
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 176
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 176
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 177
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 177
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 177
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 177
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 178
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 178
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 178
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 178
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 178
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 179
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 179
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 179
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 180
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 180
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 180
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 180
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 180
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 181
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 181
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 181
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 182
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 182
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 182
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 182
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 183
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 183
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 183
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 183
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 183
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 184
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 185
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 185
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 185
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 186
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 186
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 186
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 186
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 186
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 187
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 187
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 187
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 187
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 188
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 188
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 188
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 188
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 189
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 189
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 189
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 189
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 191
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 191
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 191
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 191
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 192
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 192
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 192
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 192
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 193
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 193
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 193
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 193
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 193
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 194
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 194
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 194
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 194
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 195
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 195
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 195
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 195
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 195
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 197
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 197
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 197
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 197
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 198
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 198
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 198
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 199
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 199
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 199
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 199
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 199
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 201
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 201
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 201
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 201
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 203
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 203
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 203
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 204
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 205
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 205
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 205
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 205
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 206
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 206
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 206
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 206
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 206
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 207
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 207
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 207
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 208
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 208
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 208
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 209
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 209
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 209
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 209
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 210
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 211
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 211
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 212
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 213
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 213
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 213
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 213
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 213
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 214
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 214
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 214
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 214
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 215
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 217
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 217
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 217
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 217
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 218
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 219
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 219
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 219
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 220
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 220
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 220
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 220
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 220
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 221
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 222
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 222
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 222
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 222
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 223
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 223
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 223
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 223
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 224
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 224
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 224
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 224
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 225
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 226
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 227
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 227
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 227
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 228
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 228
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 228
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 228
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 228
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 229
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 229
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 229
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 229
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 230
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 230
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 230
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 230
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 231
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 231
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 231
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 232
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 232
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 232
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 232
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 232
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 233
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 233
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 234
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 235
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 236
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 236
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 236
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 236
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 237
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 237
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 237
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 237
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 238
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 238
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 238
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 239
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 239
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 239
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 239
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 239
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 240
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 240
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 240
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 240
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 241
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 242
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 242
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 242
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 242
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 242
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 243
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 244
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 245
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 245
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 246
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 246
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 247
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 247
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 247
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 248
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 248
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 248
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 248
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 249
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 249
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 249
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 250
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 250
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 250
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 250
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 251
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 252
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 252
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 252
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 252
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 254
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 255
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 255
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 255
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 255
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 256
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 256
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 256
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 257
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 257
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 257
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 257
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 257
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 258
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 258
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 258
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 260
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 260
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 260
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 261
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 262
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 263
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 264
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 264
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 264
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 264
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 265
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 265
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 265
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 266
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 266
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 266
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 266
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 266
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 267
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 268
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 268
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 268
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 268
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 268
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 270
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 271
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 271
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 271
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 271
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 271
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 272
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 272
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 272
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 272
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 272
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 273
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 275
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 275
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 275
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 276
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 276
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 276
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 277
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 278
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 278
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 278
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 278
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 278
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 279
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 280
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 280
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 280
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 281
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 282
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 283
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 284
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 284
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 284
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 284
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 285
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 285
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 285
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 285
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 285
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 286
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 286
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 286
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 286
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 287
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 287
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 287
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 287
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 287
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 288
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 288
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 288
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 289
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 290
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 290
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 290
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 290
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 291
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 291
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 292
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 293
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 294
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 294
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 294
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 294
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 295
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 295
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 295
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 295
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 295
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 296
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 296
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 296
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 296
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 297
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 297
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 297
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 297
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 298
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 298
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 298
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 298
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 299
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 299
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 299
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 299
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 299
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 300
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 300
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 300
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 300
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 301
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 301
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 301
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 301
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 302
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 302
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 302
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 303
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 303
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 304
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 305
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 305
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 305
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 306
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 306
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 306
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 307
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 308
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 309
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 309
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 309
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 309
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 310
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 311
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 311
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 311
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 311
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 312
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 312
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 312
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 312
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 312
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 313
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 315
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 315
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 315
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 317
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 317
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 317
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 317
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 317
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 318
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 318
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 318
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 318
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 320
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 320
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 320
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 320
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 322
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 323
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 323
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 323
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 323
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 324
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 324
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 324
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 324
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 324
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 325
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 326
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 326
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 326
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 327
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 329
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 329
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 329
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 329
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 330
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 330
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 330
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 330
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 331
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 331
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 331
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 332
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 333
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 333
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 333
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 333
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 334
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 335
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 335
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 335
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 335
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 335
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 336
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 336
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 336
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 337
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 337
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 337
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 337
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 337
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 338
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 338
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 338
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 338
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 340
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 340
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 340
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 340
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 340
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 341
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 341
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 341
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 341
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 342
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 342
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 342
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 342
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 342
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 343
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 344
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 345
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 345
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 346
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 347
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 347
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 347
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 347
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 348
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 348
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 348
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 349
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 349
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 349
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 350
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 350
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 350
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 351
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 351
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 351
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 352
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 353
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 353
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 353
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 353
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 354
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 354
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 354
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 354
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 355
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 355
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 355
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 356
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 356
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 356
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 357
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 357
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 357
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 357
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 359
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 359
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 359
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 360
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 361
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 361
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 361
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 362
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 362
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 362
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 362
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 362
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 364
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 365
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 366
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 367
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 367
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 367
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 367
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 367
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 368
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 370
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 370
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 370
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 371
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 372
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 372
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 372
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 373
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 373
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 373
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 373
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 374
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 375
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 376
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 377
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 377
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 377
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 377
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 378
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 378
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 378
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 379
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 379
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 380
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 380
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 380
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 380
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 381
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 381
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 382
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 382
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 383
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 384
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 384
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 384
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS:CtermProteinFull 385
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS:NtermProteinFull 386
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS:NtermProteinFull 386
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS:NtermProteinFull 386
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS:NtermProteinFull 386
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS:NtermProteinFull 386
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 387
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 388
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 388
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 388
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 388
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 390
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 391
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 391
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 391
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 391
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 392
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 393
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 393
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 393
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 393
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 394
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 394
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 396
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 396
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 397
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 397
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 397
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 399
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 399
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 399
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 399
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 400
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 401
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 401
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 401
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 401
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 402
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 402
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 403
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 403
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 403
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 403
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 404
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 404
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 404
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 405
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 405
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 405
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 405
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 405
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 406
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 406
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 406
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 406
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 407
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 408
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 408
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 408
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 408
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 409
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 409
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 409
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 409
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 410
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 410
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 410
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 410
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 411
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 412
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 412
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 412
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 412
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 412
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 413
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 413
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 413
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 413
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 414
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 414
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 414
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 414
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 415
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 415
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 415
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 416
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 416
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 416
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 416
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 417
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 417
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 417
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 417
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 418
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 418
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 418
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 419
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 419
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 419
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 419
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 420
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 420
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 420
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 420
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 421
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 421
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 421
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 422
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 424
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 424
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 424
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 424
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 424
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 425
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 425
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 425
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 426
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 426
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 426
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 426
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 427
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 427
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 427
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 428
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 428
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 428
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 428
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 429
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 429
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 429
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 429
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 430
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 431
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 431
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 431
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 431
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 431
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 432
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 432
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 432
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 432
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 433
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 433
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 433
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 434
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 434
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 434
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 434
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 434
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 435
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 435
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 435
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 435
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 436
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 436
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 436
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 436
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 437
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 437
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 437
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 437
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 438
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 439
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 439
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 439
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 439
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 440
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 440
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 440
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 441
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 441
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 441
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 441
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 441
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 443
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 443
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 444
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 444
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 444
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 445
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 445
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 446
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 446
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 446
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 446
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 447
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 447
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 447
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 447
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 447
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 448
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 448
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 448
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 448
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 449
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 449
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 449
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 449
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 449
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 450
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 451
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 451
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 452
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 452
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 452
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 452
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 453
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 454
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 454
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 454
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 454
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 454
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 455
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 455
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 455
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 455
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 456
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 456
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 456
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 456
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 456
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 457
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 457
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 457
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 457
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 457
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 458
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 458
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 458
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 458
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 459
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 460
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 460
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 460
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 460
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 460
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 461
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 461
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 461
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 461
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 461
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 462
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 463
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 463
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 463
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 463
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 463
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 464
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 464
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 464
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 464
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 465
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 465
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 465
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 466
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 466
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 467
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 468
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 470
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 470
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 471
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 471
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 472
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 473
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 474
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 474
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 474
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 476
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 476
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 477
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 478
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 478
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 478
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 479
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 480
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 481
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 481
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 482
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 485
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 485
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 485
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 485
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 485
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 486
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 486
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 486
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 486
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 486
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 487
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 488
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 488
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 488
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 488
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 488
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 489
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 489
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 489
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 490
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 490
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 491
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 492
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 492
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 492
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 492
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 492
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 493
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 493
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 494
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 495
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 495
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 495
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 496
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 496
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 496
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 497
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 497
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 497
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 497
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 498
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 499
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 499
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 499
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 499
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 500
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 500
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 500
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 500
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 501
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 501
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 501
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 501
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 502
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 502
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 502
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 502
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 503
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 503
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 503
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 504
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 504
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 504
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 504
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 505
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 505
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 505
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 505
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 506
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 507
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 507
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 507
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 507
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 508
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 508
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 508
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 510
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 510
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 511
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 511
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 511
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 512
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 512
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 512
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 513
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 513
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 514
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 514
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 514
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 515
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 515
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 515
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 515
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 515
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 516
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 516
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 516
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 516
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 517
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 517
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 517
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 517
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 518
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 519
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 519
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 519
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 519
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 519
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 520
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 520
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 520
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 521
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 521
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 521
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 522
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 522
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 522
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 523
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 524
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 524
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 524
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 524
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 525
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 525
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 525
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 525
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 526
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 526
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 526
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 526
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 527
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 527
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 527
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 527
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 528
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 528
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 528
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 528
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 529
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 529
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 529
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 529
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 530
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 530
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 530
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 530
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 531
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 532
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 532
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 532
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 532
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 533
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 533
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 533
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 533
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 533
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 534
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 534
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 534
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 535
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 535
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 535
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 535
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 536
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 536
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 536
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 536
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 537
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 537
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 537
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 537
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 538
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 538
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 538
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 538
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 539
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 541
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 542
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 542
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 542
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 543
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 543
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 543
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 543
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 543
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 544
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 545
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 545
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 547
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 547
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 548
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 548
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 548
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 548
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 549
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 549
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 549
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 549
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 550
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 550
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 550
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 550
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 550
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 551
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 551
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 551
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 552
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 552
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 552
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 552
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 552
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 553
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 553
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 553
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 554
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 554
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 554
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 555
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 555
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 555
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 555
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 556
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 556
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 556
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 556
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 556
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 558
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 558
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 558
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 558
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 559
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 559
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 560
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 560
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 560
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 560
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 562
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 562
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 564
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 564
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 564
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 565
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 565
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 566
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 567
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 567
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 567
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 567
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 568
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 569
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 569
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 570
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 570
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 570
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 570
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 570
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 571
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 571
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 571
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 572
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 573
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 574
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 574
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 574
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 574
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 575
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 575
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 575
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 575
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 576
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 576
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 576
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 576
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 577
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 577
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 577
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 578
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 578
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 578
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 578
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 580
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 581
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 581
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 581
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 582
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 582
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 582
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 582
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 582
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 583
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 583
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 583
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 583
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 584
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 584
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 584
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 584
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 585
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 585
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 586
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 586
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 586
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 586
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 587
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 588
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 588
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 589
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 589
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 589
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 589
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 590
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 590
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 590
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 590
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 590
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 591
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 591
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 593
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 593
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 593
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 593
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 594
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 594
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 595
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 596
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 596
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 596
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 597
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 597
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 597
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 597
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 597
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 598
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 598
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 599
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 599
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 599
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 600
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 601
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 601
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 602
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 603
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 604
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 604
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 604
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 605
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 605
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 605
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 605
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 605
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 606
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 606
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 606
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 606
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 606
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 607
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 607
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 607
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 607
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 607
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 608
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 608
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 608
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 608
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 609
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 609
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 609
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 609
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 609
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 610
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 610
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 610
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 610
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 610
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 611
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 611
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 611
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 611
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 611
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU:CtermProteinFull 612
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU:CtermProteinFull 612
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU:CtermProteinFull 612
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU:CtermProteinFull 612
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL:NtermProteinFull 613
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL:NtermProteinFull 613
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL:NtermProteinFull 613
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 614
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 614
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 614
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 614
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 616
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 616
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 616
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 617
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 618
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 618
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 618
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 618
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 618
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 619
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 619
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 619
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 619
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 619
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 620
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 620
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 620
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 620
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 621
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 621
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 621
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 622
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 622
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 623
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 624
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 625
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 625
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 626
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 626
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 626
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 627
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 627
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 627
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 627
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 628
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 629
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 629
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 629
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 629
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 629
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 630
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 630
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 630
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 630
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 631
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 631
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 631
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 631
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 631
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 632
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 632
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 632
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 632
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 632
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 633
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 633
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 633
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 633
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 634
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 635
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 635
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 635
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 635
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 635
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 636
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 636
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 636
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 636
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 639
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 639
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 639
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 639
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 640
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 640
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 640
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 641
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 641
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 641
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 643
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 643
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 643
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 643
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 644
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 644
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 644
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 644
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 645
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 646
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 647
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 648
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 648
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 648
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 648
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 649
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 649
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 649
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 649
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 650
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 650
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 650
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 650
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 650
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 652
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 652
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 652
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 652
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 653
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 653
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 653
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 653
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 654
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 654
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 654
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 654
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 654
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 656
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 657
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 657
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 657
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 658
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 658
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 658
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 659
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 661
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 661
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 661
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 663
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 663
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 663
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 663
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 663
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 664
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 664
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 664
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 664
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 664
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 665
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 666
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 667
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 667
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 667
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 667
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 667
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 668
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 668
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 668
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 669
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 669
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 669
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 669
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 669
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 670
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 670
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 670
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 671
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 671
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 671
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 671
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 672
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 672
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 672
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 673
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 674
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 674
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 674
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 674
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 675
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 675
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 676
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 676
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 677
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 677
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 677
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 677
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 678
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 678
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 678
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 678
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 678
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 679
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 679
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 679
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 679
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 680
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 680
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 680
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 680
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 680
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 681
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 682
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 683
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 685
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 685
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 685
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 686
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 686
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 686
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 686
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 686
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 687
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 688
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 688
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 688
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 689
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 690
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 690
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 691
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 691
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 691
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 692
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 692
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 692
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 692
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 693
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 693
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 693
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 694
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 694
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 694
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 694
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 695
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 695
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 695
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 695
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 696
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 696
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 696
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 696
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 697
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 697
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 697
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 697
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 697
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 698
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 698
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 698
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 698
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 698
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 699
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 700
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 700
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 700
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 701
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 702
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 702
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 702
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 702
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 702
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 703
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 705
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 705
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 705
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 705
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 706
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 706
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 706
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 706
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 706
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 707
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 707
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 707
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 707
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 707
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 708
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 708
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 708
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 708
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 710
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 710
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 710
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 711
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 711
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 711
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 712
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 713
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 713
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 713
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 713
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 714
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 714
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 714
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 715
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 715
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 716
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 716
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 716
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 716
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 716
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 717
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 717
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 717
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 718
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 718
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 718
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 718
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 720
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 720
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 720
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 720
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 721
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 722
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 722
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 722
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 722
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 722
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 723
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 723
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 723
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 723
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 724
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 724
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 724
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 724
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 724
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 725
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 725
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 725
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 726
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 727
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 727
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 727
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 728
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 730
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 730
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 730
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 731
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 732
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 733
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 733
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 733
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 733
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 734
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 735
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 735
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 735
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 735
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 736
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 736
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 736
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 736
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 736
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 737
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 737
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 737
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 737
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 738
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 738
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 738
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 738
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 738
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 739
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 739
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 739
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 739
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 740
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 740
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 740
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 740
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 741
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 741
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 741
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 743
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 743
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 743
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 743
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 744
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 745
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 745
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 746
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 746
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 746
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 746
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 747
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 747
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 747
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 747
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 747
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 748
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 748
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 748
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 748
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 749
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 750
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 750
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 750
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 751
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 752
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 752
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 752
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 753
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 753
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 754
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 754
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 754
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 754
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 755
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 755
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 755
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 755
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 755
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 756
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 756
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 756
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 757
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 758
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 758
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 758
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 758
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 759
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 759
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 760
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 760
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 760
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 760
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 760
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 761
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 761
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 761
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 761
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 761
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 762
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 762
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 762
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 762
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 764
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 764
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 764
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 765
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 765
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 766
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 766
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 766
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 766
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 767
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 767
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 767
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 767
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 767
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 768
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 768
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 768
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 768
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 769
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 769
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 769
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 770
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 770
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 770
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 770
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 770
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 771
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 771
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 771
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 771
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 771
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 772
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 772
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 772
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 772
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 773
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 773
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 773
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 773
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 774
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 774
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 774
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 774
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 776
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 776
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 776
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 776
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 776
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 778
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 778
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 778
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 778
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 778
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 779
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 780
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 781
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 781
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 781
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 782
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 783
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 783
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 783
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 784
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 784
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 784
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 784
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 784
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 785
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 785
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 785
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 785
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 786
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 786
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 786
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 786
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 787
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 787
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 787
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 788
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 788
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 788
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 788
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 789
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 789
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 789
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 790
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 790
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 790
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 790
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 791
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 791
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 791
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 792
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 792
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 792
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 792
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 793
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 793
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 793
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 793
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 793
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 794
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 794
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 794
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 794
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 794
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 795
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 795
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 795
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND1 on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue HIS 796
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 798
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 799
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 799
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 799
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 799
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 799
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 800
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 800
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 800
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 800
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 800
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 801
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 803
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 803
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 804
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 804
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 804
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 804
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 804
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 805
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 805
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 805
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 805
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue CYS 806
core.conformation.Conformation: [ WARNING ] missing heavyatom: SG on residue CYS 806
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 807
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 807
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 807
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 807
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 807
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 808
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 808
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 808
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 808
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: OH on residue TYR 809
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 810
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 810
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 810
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 811
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 812
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 812
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 812
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 812
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 812
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 813
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 813
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 813
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 813
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 814
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 815
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 815
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 815
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 815
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 816
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 816
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 816
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 817
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 817
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 818
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 818
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 818
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 820
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 820
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 821
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 821
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 821
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 823
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 823
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 824
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 824
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 824
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 825
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 825
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 825
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 825
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE1 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE3 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ2 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ3 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CH2 on residue TRP 827
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 828
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 828
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 829
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 829
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 829
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 830
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 830
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 830
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 831
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 831
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 831
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 831
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 832
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 832
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 832
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 833
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 834
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 834
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 834
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 835
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 835
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 835
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 835
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 836
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASP 838
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASP 838
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASP 838
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD2 on residue ASP 838
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue SER 839
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG on residue SER 839
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 840
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 840
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 840
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 840
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 841
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 842
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 842
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 842
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 842
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 842
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 843
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 843
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 843
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 843
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 843
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 844
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 845
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 845
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 845
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 846
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 846
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 846
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 846
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 846
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 847
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 849
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 849
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 849
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 849
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE 850
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 851
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 851
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 851
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 851
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 851
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 852
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 852
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 852
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 853
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 853
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 853
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 853
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 853
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 854
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 854
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 854
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 855
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 855
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 855
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 855
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 856
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 856
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 856
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 856
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 856
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 857
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 857
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 857
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 857
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 857
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue VAL 858
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue VAL 858
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue VAL 858
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 859
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 859
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 859
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 859
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 859
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 860
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 860
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 860
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 862
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 862
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 862
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 862
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 864
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 864
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 864
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 864
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 865
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 865
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 865
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 865
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 866
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 866
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 866
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 866
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 866
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 867
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 867
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 867
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 867
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 867
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 868
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 868
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 868
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 868
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 869
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 870
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLN 871
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLN 871
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLN 871
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLN 871
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE2 on residue GLN 871
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 872
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 872
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 872
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 872
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 872
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 873
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 873
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 873
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 873
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 873
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 874
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 874
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 874
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 874
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 874
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 875
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 875
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 875
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 875
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 875
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 876
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 877
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 877
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 877
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 877
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 877
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 878
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 878
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 878
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 878
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 878
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ASN 879
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ASN 879
core.conformation.Conformation: [ WARNING ] missing heavyatom: OD1 on residue ASN 879
core.conformation.Conformation: [ WARNING ] missing heavyatom: ND2 on residue ASN 879
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ILE 880
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG1 on residue ILE 880
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue ILE 880
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue ILE 880
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 881
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ALA 882
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: NE on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH1 on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: NH2 on residue ARG 883
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LYS 884
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LYS 884
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue LYS 884
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue LYS 884
core.conformation.Conformation: [ WARNING ] missing heavyatom: NZ on residue LYS 884
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue GLU 885
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue GLU 885
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue GLU 885
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE1 on residue GLU 885
core.conformation.Conformation: [ WARNING ] missing heavyatom: OE2 on residue GLU 885
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue MET 886
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue MET 886
core.conformation.Conformation: [ WARNING ] missing heavyatom: SD on residue MET 886
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE on residue MET 886
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue LEU 888
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue LEU 888
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue LEU 888
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue LEU 888
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 889
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 889
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 889
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue THR 890
core.conformation.Conformation: [ WARNING ] missing heavyatom: OG1 on residue THR 890
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG2 on residue THR 890
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PRO 891
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PRO 891
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD on residue PRO 891
core.conformation.Conformation: [ WARNING ] missing heavyatom: CB on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CG on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD1 on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CD2 on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE1 on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CE2 on residue PHE:CtermProteinFull 892
core.conformation.Conformation: [ WARNING ] missing heavyatom: CZ on residue PHE:CtermProteinFull 892
core.pack.pack_missing_sidechains: packing residue number 1 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 2 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 3 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 4 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 5 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 6 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 7 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 8 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 9 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 10 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 11 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 12 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 13 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 15 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 16 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 17 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 18 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 19 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 20 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 21 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 22 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 23 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 24 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 25 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 27 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 28 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 29 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 30 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 32 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 33 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 34 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 35 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 36 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 37 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 38 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 39 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 40 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 42 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 43 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 44 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 45 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 46 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 47 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 49 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 50 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 51 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 52 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 53 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 54 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 55 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 56 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 57 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 58 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 59 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 60 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 61 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 62 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 64 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 65 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 66 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 67 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 68 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 69 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 70 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 71 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 72 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 73 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 74 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 75 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 76 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 77 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 78 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 79 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 80 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 81 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 82 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 83 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 84 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 85 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 86 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 87 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 88 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 90 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 91 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 92 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 93 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 94 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 95 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 96 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 97 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 98 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 99 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 100 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 101 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 102 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 103 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 104 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 105 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 106 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 107 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 108 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 109 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 110 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 111 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 112 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 113 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 114 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 115 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 116 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 117 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 118 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 119 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 120 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 121 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 122 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 123 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 124 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 125 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 126 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 127 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 128 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 129 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 130 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 131 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 132 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 133 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 134 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 135 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 136 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 137 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 138 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 139 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 140 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 141 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 142 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 143 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 144 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 146 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 148 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 149 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 150 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 151 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 152 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 153 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 154 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 155 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 158 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 159 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 160 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 161 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 162 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 163 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 164 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 165 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 166 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 167 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 168 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 169 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 170 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 171 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 172 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 173 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 174 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 175 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 176 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 177 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 178 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 179 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 180 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 181 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 182 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 183 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 184 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 185 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 186 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 187 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 188 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 189 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 191 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 192 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 193 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 194 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 195 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 197 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 198 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 199 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 201 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 203 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 204 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 205 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 206 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 207 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 208 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 209 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 210 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 211 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 212 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 213 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 214 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 215 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 217 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 218 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 219 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 220 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 221 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 222 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 223 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 224 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 225 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 226 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 227 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 228 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 229 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 230 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 231 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 232 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 233 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 234 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 235 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 236 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 237 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 238 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 239 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 240 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 241 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 242 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 243 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 244 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 245 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 246 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 247 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 248 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 249 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 250 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 251 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 252 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 254 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 255 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 256 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 257 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 258 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 260 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 261 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 262 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 263 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 264 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 265 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 266 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 267 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 268 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 270 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 271 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 272 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 273 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 275 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 276 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 277 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 278 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 279 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 280 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 281 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 282 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 283 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 284 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 285 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 286 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 287 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 288 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 289 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 290 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 291 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 292 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 293 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 294 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 295 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 296 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 297 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 298 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 299 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 300 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 301 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 302 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 303 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 304 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 305 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 306 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 307 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 308 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 309 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 310 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 311 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 312 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 313 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 315 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 317 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 318 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 320 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 322 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 323 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 324 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 325 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 326 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 327 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 329 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 330 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 331 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 332 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 333 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 334 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 335 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 336 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 337 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 338 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 340 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 341 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 342 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 343 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 344 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 345 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 346 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 347 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 348 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 349 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 350 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 351 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 352 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 353 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 354 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 355 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 356 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 357 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 359 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 360 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 361 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 362 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 364 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 365 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 366 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 367 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 368 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 370 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 371 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 372 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 373 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 374 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 375 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 376 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 377 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 378 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 379 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 380 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 381 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 382 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 383 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 384 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 385 because of missing atom number 6 atom name CB
core.pack.pack_missing_sidechains: packing residue number 386 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 387 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 388 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 390 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 391 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 392 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 393 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 394 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 396 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 397 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 399 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 400 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 401 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 402 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 403 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 404 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 405 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 406 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 407 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 408 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 409 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 410 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 411 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 412 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 413 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 414 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 415 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 416 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 417 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 418 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 419 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 420 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 421 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 422 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 424 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 425 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 426 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 427 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 428 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 429 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 430 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 431 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 432 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 433 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 434 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 435 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 436 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 437 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 438 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 439 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 440 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 441 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 443 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 444 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 445 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 446 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 447 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 448 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 449 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 450 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 451 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 452 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 453 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 454 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 455 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 456 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 457 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 458 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 459 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 460 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 461 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 462 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 463 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 464 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 465 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 466 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 467 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 468 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 470 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 471 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 472 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 473 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 474 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 476 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 477 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 478 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 479 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 480 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 481 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 482 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 485 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 486 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 487 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 488 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 489 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 490 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 491 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 492 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 493 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 494 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 495 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 496 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 497 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 498 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 499 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 500 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 501 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 502 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 503 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 504 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 505 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 506 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 507 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 508 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 510 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 511 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 512 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 513 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 514 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 515 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 516 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 517 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 518 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 519 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 520 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 521 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 522 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 523 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 524 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 525 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 526 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 527 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 528 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 529 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 530 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 531 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 532 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 533 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 534 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 535 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 536 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 537 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 538 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 539 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 541 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 542 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 543 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 544 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 545 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 547 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 548 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 549 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 550 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 551 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 552 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 553 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 554 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 555 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 556 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 558 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 559 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 560 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 562 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 564 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 565 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 566 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 567 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 568 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 569 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 570 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 571 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 572 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 573 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 574 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 575 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 576 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 577 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 578 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 580 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 581 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 582 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 583 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 584 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 585 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 586 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 587 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 588 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 589 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 590 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 591 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 593 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 594 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 595 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 596 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 597 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 598 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 599 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 600 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 601 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 602 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 603 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 604 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 605 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 606 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 607 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 608 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 609 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 610 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 611 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 612 because of missing atom number 6 atom name CB
core.pack.pack_missing_sidechains: packing residue number 613 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 614 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 616 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 617 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 618 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 619 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 620 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 621 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 622 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 623 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 624 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 625 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 626 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 627 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 628 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 629 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 630 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 631 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 632 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 633 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 634 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 635 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 636 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 639 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 640 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 641 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 643 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 644 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 645 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 646 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 647 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 648 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 649 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 650 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 652 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 653 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 654 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 656 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 657 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 658 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 659 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 661 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 663 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 664 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 665 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 666 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 667 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 668 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 669 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 670 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 671 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 672 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 673 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 674 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 675 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 676 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 677 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 678 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 679 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 680 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 681 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 682 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 683 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 685 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 686 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 687 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 688 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 689 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 690 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 691 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 692 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 693 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 694 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 695 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 696 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 697 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 698 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 699 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 700 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 701 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 702 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 703 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 705 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 706 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 707 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 708 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 710 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 711 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 712 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 713 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 714 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 715 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 716 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 717 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 718 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 720 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 721 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 722 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 723 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 724 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 725 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 726 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 727 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 728 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 730 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 731 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 732 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 733 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 734 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 735 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 736 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 737 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 738 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 739 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 740 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 741 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 743 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 744 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 745 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 746 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 747 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 748 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 749 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 750 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 751 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 752 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 753 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 754 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 755 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 756 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 757 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 758 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 759 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 760 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 761 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 762 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 764 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 765 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 766 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 767 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 768 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 769 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 770 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 771 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 772 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 773 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 774 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 776 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 778 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 779 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 780 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 781 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 782 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 783 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 784 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 785 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 786 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 787 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 788 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 789 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 790 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 791 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 792 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 793 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 794 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 795 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 796 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 798 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 799 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 800 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 801 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 803 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 804 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 805 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 806 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 807 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 808 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 809 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 810 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 811 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 812 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 813 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 814 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 815 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 816 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 817 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 818 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 820 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 821 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 823 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 824 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 825 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 827 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 828 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 829 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 830 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 831 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 832 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 833 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 834 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 835 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 836 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 838 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 839 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 840 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 841 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 842 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 843 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 844 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 845 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 846 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 847 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 849 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 850 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 851 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 852 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 853 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 854 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 855 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 856 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 857 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 858 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 859 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 860 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 862 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 864 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 865 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 866 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 867 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 868 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 869 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 870 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 871 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 872 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 873 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 874 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 875 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 876 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 877 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 878 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 879 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 880 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 881 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 882 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 883 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 884 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 885 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 886 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 888 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 889 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 890 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 891 because of missing atom number 5 atom name CB
core.pack.pack_missing_sidechains: packing residue number 892 because of missing atom number 6 atom name CB
core.pack.task: Packer task: initialize from command line()
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.scoring.etable: Starting energy table calculation
rep split to bottom of energy well
core.scoring.etable: smooth_etable: spline smoothing lj etables (maxdis = 6)
core.scoring.etable: smooth_etable: spline smoothing solvation etables (max_dis = 6)
core.scoring.etable: Finished calculating energy tables.
HBPoly1D.csv
HBFadeIntervals.csv
HBEval.csv
DonStrength.csv
AccStrength.csv
all.ramaProb
prepro.ramaProb
omega_ppdep.all.txt
omega_ppdep.gly.txt
omega_ppdep.pro.txt
omega_ppdep.valile.txt
P_AA
P_AA_n
core.scoring.P_AA: shapovalov_lib::shap_p_aa_pp_smooth_level of 1( aka low_smooth ) got activated.
a20.prop
elec_cp_reps.dat
core.scoring.elec.util: Read 40 countpair representative atoms
core.pack.dunbrack.RotamerLibrary: shapovalov_lib_fixes_enable option is true.
core.pack.dunbrack.RotamerLibrary: shapovalov_lib::shap_dun10_smooth_level of 1( aka lowest_smooth ) got activated.
Dunbrack10.lib.bin
Dunbrack10.lib.bin'.
core.pack.dunbrack.RotamerLibrary: Dunbrack 2010 library took 0.15 seconds to load from binary
core.pack.pack_rotamers: built 7225 rotamers at 819 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
893
partial_thread: 1XXX_ 1 SERIVISPTSRQEGHAELVMEVDDEGIVTKGRYFSITPVRGLEKMVTGKAPETAPVMVQRICGVCPIPHTLASVEAIDDSLDIEVPKAGRLLRELTLAAHHVNSHAIHHFLIAPDFVPENLMADAINSVSEIRKNAQYVVDMVAGEGIHPSDVRIGGMADNITELARKRLYARLKQLKPKVNEHVELMIGLIEDKGLPEGLGVHNQPTLASHQIYGDRTKFDLDRFTEIMPESWYDDPEIAKRACSTIPLYDGRNVEVGPRARMVEFQGFKERGVVAQHVARALEMKTALSRAIEILDELDTSAPVRADFDERGTGKLGIGAIEAPRGLDVHMAKVENGKIQFYSALVPTTWNIPTMGPATEGFHHEYGPHVIRAYDPCLSCATHKPRIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKELVLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
partial_thread: 1tmpA_thread 1 SERIVISPTSRQEGHAELVMEVDDEGIVTKGRYFSITPVRGLEKMVTGKAPETAPVMVQRICGVCPIPHTLASVEAIDDSLDIEVPKAGRLLRELTLAAHHVNSHAIHHFLIAPDFVPENLMADAINSVSEIRKNAQYVVDMVAGEGIHPSDVRIGGMADNITELARKRLYARLKQLKPKVNEHVELMIGLIEDKGLPEGLGVHNQPTLASHQIYGDRTKFDLDRFTEIMPESWYDDPEIAKRACSTIPLYDGRNVEVGPRARMVEFQGFKERGVVAQHVARALEMKTALSRAIEILDELDTSAPVRADFDERGTGKLGIGAIEAPRGLDVHMAKVENGKIQFYSALVPTTWNIPTMGPATEGFHHEYGPHVIRAYDPCLSCATHK-RIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKELVLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
partial_thread:
partial_thread: id 1tmpA_thread => 1tmpA
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.scoring.ScoreFunctionFactory: SCOREFUNCTION: ref2015
core.pack.task: Packer task: initialize from command line()
core.pack.pack_rotamers: built 2539 rotamers at 892 positions.
core.pack.interaction_graph.interaction_graph_factory: Instantiating DensePDInteractionGraph
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 1 SER:NtermProteinFull SER:NtermProteinFull
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 7 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 9 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 10 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 29 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 35 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 37 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 47 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 53 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 62 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 65 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 70 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 73 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 80 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 96 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 104 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 128 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 130 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 151 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 163 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 171 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 208 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 215 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 219 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 2 position: 227 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 245 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 246 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 247 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 251 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 288 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 291 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 302 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 303 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 315 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 345 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 350 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 351 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 356 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 361 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 379 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 381 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 382 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 384 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 390 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 394 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 396 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 397 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 402 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 404 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 407 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 415 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 422 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 425 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 443 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 445 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 451 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 466 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 470 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 474 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 476 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 478 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 480 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 481 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 490 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 493 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 513 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 520 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 2 position: 542 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 545 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 547 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 551 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 564 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 565 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 571 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 577 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 585 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 594 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 598 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 601 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 616 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 622 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 626 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 641 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 646 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 675 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 676 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 685 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 688 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 690 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 703 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 710 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 717 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 725 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 744 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 745 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 752 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 753 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 756 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 759 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 765 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 40.000 chino= 2 position: 783 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 789 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 140.000 chino= 2 position: 795 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 3 position: 798 TYR TYR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 803 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 806 CYS CYS
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 60.000 chino= 2 position: 817 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 20.000 chino= 2 position: 818 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 820 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 100.000 chino= 2 position: 828 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 829 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 832 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 160.000 chino= 2 position: 834 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 120.000 chino= 2 position: 839 SER SER
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 180.000 chino= 2 position: 852 THR THR
core.io.pdb.file_data: [ WARNING ] OPT-H: proton chi angle change: chidev= 80.000 chino= 2 position: 890 THR THR
max_jobs: 8
CM_DMonly.log
CM_DMonly.log
INFO : DAQ scoring for Full-atom models
S_singletgt_0001.daq
S_singletgt_0002.daq
S_singletgt_0003.daq
S_singletgt_0004.daq
S_singletgt_0005.daq
S_singletgt_0001.daq
S_singletgt_0002.daq
S_singletgt_0003.daq
S_singletgt_0004.daq
S_singletgt_0005.daq
S_singletgt_0001.daq
S_singletgt_0002.daq
S_singletgt_0003.daq
S_singletgt_0004.daq
S_singletgt_0005.daq
S_singletgt_0001.daq
S_singletgt_0002.daq
S_singletgt_0003.daq
S_singletgt_0004.daq
S_singletgt_0005.daq
max_jobs: 8
S_singletgt_0001.daq
S_singletgt_0001.daq
WARNING: Use StructureBlurrer.gaussian_blur_real_space_box()to blured a map with a user defined defined cubic box
S_singletgt_0001.pdb 2.102520372526193
%s total different chains : {'C', 'B', 'A'}
[['C', ' N ', 188.805, 82.886, 106.132], ['C', ' CA ', 187.697, 83.853, 106.255], ['C', ' C ', 187.024, 83.727, 107.649], ['C', ' O ', 186.525, 82.648, 107.989], ['C', ' CB ', 186.627, 83.616, 105.076], ['C', ' CG1', 185.336, 84.586, 105.185], ['C', ' CG2', 187.304, 83.874, 103.626], ['C', ' H ', 189.212, 82.966, 105.211], ['C', ' H ', 189.52, 83.045, 106.827], ['C', ' H ', 188.432, 81.952, 106.25], ['C', ' HA ', 188.121, 84.857, 106.126], ['C', ' HB ', 186.256, 82.574, 105.14], ['C', ' HG1', 184.635, 84.37, 104.374], ['C', ' HG1', 184.81, 84.446, 106.132], ['C', ' HG1', 185.631, 85.601, 105.1], ['C', ' HG2', 186.568, 83.689, 102.835], ['C', ' HG2', 187.65, 84.912, 103.545], ['C', ' HG2', 188.151, 83.209, 103.46]]
[['C', ' N ', 187.033, 84.828, 108.434], ['C', ' CA ', 186.382, 84.957, 109.731], ['C', ' C ', 184.891, 85.245, 109.466], ['C', ' O ', 184.063, 84.432, 109.882], ['C', ' CB ', 187.089, 86.018, 110.583], ['C', ' CG ', 188.247, 85.51, 111.477], ['C', ' CD1', 189.333, 84.853, 110.651], ['C', ' CD2', 188.841, 86.657, 112.193], ['C', ' H ', 187.479, 85.651, 108.065], ['C', ' HA ', 186.446, 84.012, 110.276], ['C', ' HB ', 187.531, 86.751, 109.919], ['C', ' HB ', 186.354, 86.507, 111.215], ['C', ' HG ', 187.86, 84.784, 112.196], ['C', ' HD1', 190.138, 84.518, 111.312], ['C', ' HD1', 188.937, 83.993, 110.121], ['C', ' HD1', 189.732, 85.568, 109.938], ['C', ' HD2', 189.637, 86.288, 112.822], ['C', ' HD2', 189.241, 87.368, 111.474], ['C', ' HD2', 188.107, 87.142, 112.8]]
[['C', ' N ', 184.497, 86.314, 108.718], ['C', ' CA ', 185.232, 87.51, 108.259], ['C', ' C ', 186.08, 87.469, 106.989], ['C', ' O ', 187.196, 86.961, 106.992], ['C', ' H ', 183.509, 86.321, 108.477], ['C', ' HA ', 184.488, 88.282, 108.1], ['C', ' HA ', 185.828, 87.895, 109.073]]
[['C', ' N ', 185.643, 88.147, 105.95], ['C', ' CA ', 186.5, 88.338, 104.791], ['C', ' C ', 187.461, 89.41, 105.212], ['C', ' O ', 187.041, 90.354, 105.877], ['C', ' CB ', 185.717, 88.793, 103.545], ['C', ' OG1', 184.731, 87.811, 103.202], ['C', ' CG2', 186.671, 88.946, 102.371], ['C', ' H ', 184.709, 88.53, 105.936], ['C', ' HA ', 187.059, 87.428, 104.572], ['C', ' HB ', 185.223, 89.743, 103.748], ['C', ' HG1', 184.139, 88.174, 102.536], ['C', ' HG2', 186.106, 89.257, 101.494], ['C', ' HG2', 187.428, 89.696, 102.586], ['C', ' HG2', 187.154, 87.991, 102.171]]
[['C', ' N ', 188.74, 89.28, 104.912], ['C', ' CA ', 189.633, 90.341, 105.335], ['C', ' C ', 190.808, 90.552, 104.439], ['C', ' O ', 191.173, 89.682, 103.648], ['C', ' CB ', 190.137, 90.099, 106.745], ['C', ' CG ', 190.996, 88.904, 106.909], ['C', ' CD1', 192.354, 89.011, 106.742], ['C', ' CD2', 190.438, 87.701, 107.253], ['C', ' CE1', 193.153, 87.923, 106.909], ['C', ' CE2', 191.235, 86.601, 107.425], ['C', ' CZ ', 192.591, 86.71, 107.253], ['C', ' OH ', 193.405, 85.619, 107.434], ['C', ' H ', 189.08, 88.486, 104.386], ['C', ' HA ', 189.079, 91.27, 105.326], ['C', ' HB ', 190.712, 90.969, 107.061], ['C', ' HB ', 189.288, 89.998, 107.412], ['C', ' HD1', 192.795, 89.954, 106.484], ['C', ' HD2', 189.376, 87.626, 107.394], ['C', ' HE1', 194.23, 88.015, 106.776], ['C', ' HE2', 190.79, 85.646, 107.703], ['C', ' HH ', 192.892, 84.886, 107.786]]
[['C', ' N ', 191.412, 91.727, 104.584], ['C', ' CA ', 192.612, 92.066, 103.866], ['C', ' C ', 193.823, 91.944, 104.791], ['C', ' O ', 194.859, 91.415, 104.386], ['C', ' CB ', 192.474, 93.475, 103.3], ['C', ' CG ', 193.592, 93.93, 102.41], ['C', ' CD ', 193.237, 95.277, 101.77], ['C', ' CE ', 194.296, 95.741, 100.785], ['C', ' NZ ', 193.934, 97.052, 100.171], ['C', ' H ', 191.04, 92.416, 105.235], ['C', ' HA ', 192.743, 91.363, 103.044], ['C', ' HB ', 191.547, 93.546, 102.738], ['C', ' HB ', 192.408, 94.185, 104.129], ['C', ' HG ', 194.505, 94.042, 103.003], ['C', ' HG ', 193.77, 93.185, 101.633], ['C', ' HD ', 192.284, 95.204, 101.239], ['C', ' HD ', 193.133, 96.036, 102.546], ['C', ' HE ', 195.25, 95.842, 101.299], ['C', ' HE ', 194.394, 94.998, 99.996], ['C', ' HZ ', 194.633, 97.349, 99.522], ['C', ' HZ ', 193.025, 97.002, 99.683], ['C', ' HZ ', 193.838, 97.758, 100.903]]
[['C', ' N ', 193.693, 92.424, 106.034], ['C', ' CA ', 194.82, 92.351, 106.972], ['C', ' C ', 194.417, 92.315, 108.448], ['C', ' O ', 193.541, 93.067, 108.884], ['C', ' CB ', 195.771, 93.517, 106.737], ['C', ' CG ', 197.03, 93.462, 107.571], ['C', ' CD ', 197.999, 94.533, 107.233], ['C', ' OE1', 197.659, 95.42, 106.483], ['C', ' OE2', 199.094, 94.482, 107.722], ['C', ' H ', 192.804, 92.851, 106.305], ['C', ' HA ', 195.366, 91.43, 106.763], ['C', ' HB ', 196.06, 93.551, 105.686], ['C', ' HB ', 195.26, 94.449, 106.966], ['C', ' HG ', 196.763, 93.575, 108.615], ['C', ' HG ', 197.502, 92.49, 107.445]]
[['C', ' N ', 195.078, 91.465, 109.253], ['C', ' CA ', 194.74, 91.46, 110.673], ['C', ' C ', 195.948, 91.729, 111.554], ['C', ' O ', 196.975, 91.037, 111.461], ['C', ' CB ', 194.142, 90.131, 111.126], ['C', ' CG1', 192.973, 89.816, 110.261], ['C', ' CG2', 193.676, 90.301, 112.606], ['C', ' CD1', 192.293, 88.499, 110.517], ['C', ' H ', 195.799, 90.859, 108.881], ['C', ' HA ', 194.016, 92.249, 110.868], ['C', ' HB ', 194.868, 89.333, 111.031], ['C', ' HG1', 192.316, 90.6, 110.332], ['C', ' HG1', 193.32, 89.784, 109.249], ['C', ' HG2', 193.227, 89.406, 112.974], ['C', ' HG2', 194.482, 90.546, 113.24], ['C', ' HG2', 192.962, 91.107, 112.668], ['C', ' HD1', 191.482, 88.381, 109.817], ['C', ' HD1', 193.007, 87.692, 110.386], ['C', ' HD1', 191.886, 88.464, 111.512]]
[['C', ' N ', 195.806, 92.738, 112.4], ['C', ' CA ', 196.841, 93.133, 113.346], ['C', ' C ', 196.256, 93.35, 114.717], ['C', ' O ', 195.047, 93.503, 114.844], ['C', ' CB ', 197.518, 94.426, 112.902], ['C', ' CG1', 198.153, 94.242, 111.545], ['C', ' CG2', 196.504, 95.574, 112.9], ['C', ' H ', 194.9, 93.229, 112.386], ['C', ' HA ', 197.589, 92.348, 113.41], ['C', ' HB ', 198.316, 94.646, 113.595], ['C', ' HG1', 198.662, 95.159, 111.253], ['C', ' HG1', 198.87, 93.43, 111.591], ['C', ' HG1', 197.395, 94.011, 110.813], ['C', ' HG2', 197.008, 96.479, 112.601], ['C', ' HG2', 195.696, 95.355, 112.199], ['C', ' HG2', 196.091, 95.714, 113.896]]
[['C', ' N ', 197.089, 93.4, 115.738], ['C', ' CA ', 196.605, 93.861, 117.023], ['C', ' C ', 197.104, 95.284, 117.113], ['C', ' O ', 198.147, 95.627, 116.548], ['C', ' CB ', 197.103, 93.008, 118.171], ['C', ' OG ', 198.487, 93.043, 118.271], ['C', ' H ', 198.079, 93.194, 115.595], ['C', ' HA ', 195.522, 93.875, 117.034], ['C', ' HB ', 196.664, 93.369, 119.098], ['C', ' HB ', 196.771, 91.985, 118.033], ['C', ' HG ', 198.718, 92.362, 118.916]]
[['C', ' N ', 196.401, 96.137, 117.814], ['C', ' CA ', 196.851, 97.505, 117.903], ['C', ' C ', 196.262, 98.221, 119.08], ['C', ' O ', 195.266, 97.802, 119.671], ['C', ' CB ', 196.499, 98.247, 116.631], ['C', ' H ', 195.536, 95.835, 118.256], ['C', ' HA ', 197.923, 97.504, 118.023], ['C', ' HB ', 196.866, 99.271, 116.696], ['C', ' HB ', 196.947, 97.76, 115.781], ['C', ' HB ', 195.435, 98.255, 116.51]]
[['C', ' N ', 196.893, 99.307, 119.448], ['C', ' CA ', 196.292, 100.159, 120.442], ['C', ' C ', 196.59, 101.604, 120.178], ['C', ' O ', 197.603, 101.948, 119.565], ['C', ' CB ', 196.73, 99.823, 121.845], ['C', ' CG ', 198.148, 100.03, 122.166], ['C', ' CD ', 198.379, 99.719, 123.566], ['C', ' NE ', 199.744, 99.896, 123.901], ['C', ' CZ ', 200.294, 99.692, 125.096], ['C', ' NH1', 199.571, 99.299, 126.127], ['C', ' NH2', 201.589, 99.895, 125.205], ['C', ' H ', 197.755, 99.558, 118.953], ['C', ' HA ', 195.211, 100.031, 120.389], ['C', ' HB ', 196.148, 100.397, 122.563], ['C', ' HB ', 196.541, 98.796, 122.029], ['C', ' HG ', 198.767, 99.371, 121.561], ['C', ' HG ', 198.441, 101.067, 121.993], ['C', ' HD ', 197.784, 100.396, 124.178], ['C', ' HD ', 198.092, 98.696, 123.769], ['C', ' HE ', 200.38, 100.193, 123.152], ['C', ' HH1', 198.579, 99.143, 126.019], ['C', ' HH1', 200.006, 99.149, 127.026], ['C', ' HH2', 202.099, 100.198, 124.355], ['C', ' HH2', 202.066, 99.756, 126.081]]
[['C', ' N ', 195.715, 102.46, 120.676], ['C', ' CA ', 195.936, 103.889, 120.617], ['C', ' C ', 197.124, 104.216, 121.475], ['C', ' O ', 197.274, 103.637, 122.553], ['C', ' CB ', 194.727, 104.657, 121.089], ['C', ' OG ', 195.005, 106.033, 121.138], ['C', ' H ', 194.887, 102.11, 121.131], ['C', ' HA ', 196.149, 104.173, 119.598], ['C', ' HB ', 193.892, 104.477, 120.409], ['C', ' HB ', 194.427, 104.309, 122.078], ['C', ' HG ', 194.141, 106.451, 121.274]]
[['C', ' N ', 197.931, 105.165, 121.028], ['C', ' CA ', 199.112, 105.628, 121.737], ['C', ' C ', 198.808, 106.843, 122.592], ['C', ' O ', 199.673, 107.333, 123.323], ['C', ' CB ', 200.218, 105.982, 120.74], ['C', ' OG1', 199.752, 107.051, 119.9], ['C', ' CG2', 200.521, 104.76, 119.903], ['C', ' H ', 197.716, 105.572, 120.117], ['C', ' HA ', 199.466, 104.828, 122.382], ['C', ' HB ', 201.115, 106.304, 121.265], ['C', ' HG1', 200.437, 107.305, 119.226], ['C', ' HG2', 201.292, 104.992, 119.168], ['C', ' HG2', 200.865, 103.954, 120.547], ['C', ' HG2', 199.636, 104.456, 119.408]]
[['C', ' N ', 197.582, 107.342, 122.496], ['C', ' CA ', 197.169, 108.503, 123.256], ['C', ' C ', 196.66, 108.077, 124.615], ['C', ' O ', 195.625, 107.411, 124.717], ['C', ' CB ', 196.092, 109.313, 122.554], ['C', ' CG ', 195.759, 110.595, 123.346], ['C', ' OD1', 196.282, 110.718, 124.462], ['C', ' OD2', 195.043, 111.44, 122.842], ['C', ' H ', 196.909, 106.895, 121.875], ['C', ' HA ', 198.036, 109.148, 123.402], ['C', ' HB ', 196.417, 109.575, 121.545], ['C', ' HB ', 195.205, 108.709, 122.469]]
[['C', ' N ', 197.371, 108.441, 125.661], ['C', ' CA ', 197.034, 107.997, 127.001], ['C', ' C ', 195.628, 108.413, 127.416], ['C', ' O ', 194.995, 107.716, 128.221], ['C', ' CB ', 198.037, 108.507, 128.007], ['C', ' CG ', 199.382, 107.831, 127.908], ['C', ' CD ', 200.247, 108.121, 129.073], ['C', ' NE ', 200.58, 109.54, 129.171], ['C', ' CZ ', 201.606, 110.151, 128.532], ['C', ' NH1', 202.398, 109.473, 127.722], ['C', ' NH2', 201.811, 111.444, 128.718], ['C', ' H ', 198.182, 109.025, 125.5], ['C', ' HA ', 197.089, 106.913, 127.015], ['C', ' HB ', 198.183, 109.576, 127.864], ['C', ' HB ', 197.656, 108.356, 129.016], ['C', ' HG ', 199.233, 106.752, 127.858], ['C', ' HG ', 199.883, 108.163, 127.0], ['C', ' HD ', 199.716, 107.837, 129.982], ['C', ' HD ', 201.166, 107.544, 129.007], ['C', ' HE ', 200.009, 110.109, 129.784], ['C', ' HH1', 202.249, 108.487, 127.567], ['C', ' HH1', 203.16, 109.942, 127.25], ['C', ' HH2', 201.207, 111.969, 129.336], ['C', ' HH2', 202.572, 111.911, 128.246]]
[['C', ' N ', 195.133, 109.544, 126.894], ['C', ' CA ', 193.803, 110.0, 127.262], ['C', ' C ', 192.723, 109.088, 126.708], ['C', ' O ', 191.583, 109.141, 127.15], ['C', ' CB ', 193.527, 111.423, 126.797], ['C', ' CG ', 194.339, 112.477, 127.507], ['C', ' CD ', 193.961, 113.887, 127.116], ['C', ' OE1', 193.054, 114.067, 126.312], ['C', ' OE2', 194.578, 114.793, 127.62], ['C', ' H ', 195.681, 110.105, 126.216], ['C', ' HA ', 193.736, 109.981, 128.345], ['C', ' HB ', 193.748, 111.497, 125.728], ['C', ' HB ', 192.471, 111.653, 126.931], ['C', ' HG ', 194.204, 112.358, 128.58], ['C', ' HG ', 195.393, 112.312, 127.28]]
[['C', ' N ', 193.058, 108.311, 125.694], ['C', ' CA ', 192.126, 107.398, 125.088], ['C', ' C ', 192.331, 106.036, 125.715], ['C', ' O ', 191.377, 105.339, 126.068], ['C', ' CB ', 192.286, 107.345, 123.567], ['C', ' CG1', 191.947, 108.732, 122.998], ['C', ' CG2', 191.387, 106.268, 122.992], ['C', ' CD1', 192.243, 108.935, 121.528], ['C', ' H ', 194.026, 108.301, 125.372], ['C', ' HA ', 191.112, 107.728, 125.312], ['C', ' HB ', 193.325, 107.129, 123.319], ['C', ' HG1', 190.891, 108.924, 123.167], ['C', ' HG1', 192.53, 109.468, 123.548], ['C', ' HG2', 191.493, 106.22, 121.915], ['C', ' HG2', 191.658, 105.312, 123.408], ['C', ' HG2', 190.35, 106.492, 123.246], ['C', ' HD1', 191.975, 109.953, 121.248], ['C', ' HD1', 193.291, 108.781, 121.329], ['C', ' HD1', 191.665, 108.249, 120.93]]
[['C', ' N ', 193.59, 105.659, 125.916], ['C', ' CA ', 193.912, 104.344, 126.451], ['C', ' C ', 193.25, 104.127, 127.798], ['C', ' O ', 192.786, 103.03, 128.098], ['C', ' CB ', 195.412, 104.217, 126.688], ['C', ' CG ', 196.285, 104.17, 125.473], ['C', ' CD ', 197.746, 104.228, 125.863], ['C', ' OE1', 198.059, 104.481, 127.036], ['C', ' NE2', 198.624, 104.015, 124.913], ['C', ' H ', 194.346, 106.28, 125.623], ['C', ' HA ', 193.562, 103.581, 125.758], ['C', ' HB ', 195.733, 105.048, 127.306], ['C', ' HB ', 195.602, 103.31, 127.257], ['C', ' HG ', 196.114, 103.232, 124.945], ['C', ' HG ', 196.068, 105.001, 124.816], ['C', ' HE2', 199.603, 104.046, 125.107], ['C', ' HE2', 198.288, 103.829, 123.972]]
[['C', ' N ', 193.173, 105.18, 128.605], ['C', ' CA ', 192.568, 105.071, 129.918], ['C', ' C ', 191.034, 104.959, 129.882], ['C', ' O ', 190.423, 104.642, 130.911], ['C', ' CB ', 192.945, 106.267, 130.793], ['C', ' CG ', 192.26, 107.565, 130.421], ['C', ' CD ', 192.731, 108.709, 131.289], ['C', ' CE ', 191.943, 109.986, 131.004], ['C', ' NZ ', 192.426, 111.131, 131.833], ['C', ' H ', 193.61, 106.061, 128.317], ['C', ' HA ', 192.956, 104.168, 130.388], ['C', ' HB ', 192.711, 106.046, 131.832], ['C', ' HB ', 194.021, 106.435, 130.723], ['C', ' HG ', 192.445, 107.795, 129.374], ['C', ' HG ', 191.194, 107.462, 130.571], ['C', ' HD ', 192.618, 108.44, 132.338], ['C', ' HD ', 193.788, 108.895, 131.087], ['C', ' HE ', 192.039, 110.242, 129.952], ['C', ' HE ', 190.891, 109.81, 131.225], ['C', ' HZ ', 191.881, 111.955, 131.62], ['C', ' HZ ', 192.327, 110.908, 132.816], ['C', ' HZ ', 193.399, 111.307, 131.625]]
[['C', ' N ', 190.395, 105.304, 128.757], ['C', ' CA ', 188.936, 105.317, 128.685], ['C', ' C ', 188.328, 104.139, 127.934], ['C', ' O ', 187.305, 103.586, 128.346], ['C', ' CB ', 188.487, 106.574, 127.956], ['C', ' CG ', 188.878, 107.911, 128.553], ['C', ' CD1', 188.408, 109.014, 127.609], ['C', ' CD2', 188.274, 108.078, 129.935], ['C', ' H ', 190.934, 105.503, 127.919], ['C', ' HA ', 188.539, 105.295, 129.694], ['C', ' HB ', 188.878, 106.539, 126.937], ['C', ' HB ', 187.413, 106.551, 127.916], ['C', ' HG ', 189.955, 107.973, 128.62], ['C', ' HD1', 188.703, 109.982, 128.01], ['C', ' HD1', 188.871, 108.877, 126.63], ['C', ' HD1', 187.321, 108.978, 127.505], ['C', ' HD2', 188.564, 109.047, 130.333], ['C', ' HD2', 187.186, 108.024, 129.865], ['C', ' HD2', 188.633, 107.303, 130.603]]
[['C', ' N ', 188.938, 103.761, 126.824], ['C', ' CA ', 188.406, 102.677, 126.014], ['C', ' C ', 188.61, 101.394, 126.77], ['C', ' O ', 189.548, 101.297, 127.553], ['C', ' CB ', 189.074, 102.62, 124.674], ['C', ' H ', 189.79, 104.251, 126.538], ['C', ' HA ', 187.337, 102.834, 125.879], ['C', ' HB ', 188.657, 101.795, 124.1], ['C', ' HB ', 188.906, 103.563, 124.148], ['C', ' HB ', 190.142, 102.463, 124.823]]
[['C', ' N ', 187.781, 100.381, 126.548], ['C', ' CA ', 188.026, 99.179, 127.325], ['C', ' C ', 189.342, 98.496, 126.965], ['C', ' O ', 190.062, 98.051, 127.855], ['C', ' CB ', 186.849, 98.211, 127.172], ['C', ' CG ', 186.947, 96.942, 128.011], ['C', ' CD ', 187.026, 97.223, 129.493], ['C', ' OE1', 186.362, 98.126, 130.012], ['C', ' NE2', 187.847, 96.444, 130.185], ['C', ' H ', 187.013, 100.449, 125.897], ['C', ' HA ', 188.084, 99.469, 128.375], ['C', ' HB ', 185.918, 98.716, 127.432], ['C', ' HB ', 186.773, 97.903, 126.133], ['C', ' HG ', 186.057, 96.335, 127.843], ['C', ' HG ', 187.84, 96.375, 127.721], ['C', ' HE2', 187.954, 96.569, 131.169], ['C', ' HE2', 188.363, 95.71, 129.711]]
[['C', ' N ', 189.662, 98.436, 125.679], ['C', ' CA ', 190.907, 97.866, 125.175], ['C', ' C ', 191.171, 98.502, 123.847], ['C', ' O ', 190.22, 98.643, 123.083], ['C', ' CB ', 190.827, 96.348, 124.977], ['C', ' CG ', 190.786, 95.529, 126.259], ['C', ' OD1', 191.824, 95.389, 126.928], ['C', ' OD2', 189.735, 94.995, 126.547], ['C', ' H ', 189.017, 98.828, 125.013], ['C', ' HA ', 191.724, 98.111, 125.854], ['C', ' HB ', 189.945, 96.123, 124.396], ['C', ' HB ', 191.685, 96.02, 124.393]]
[['C', ' N ', 192.418, 98.861, 123.543], ['C', ' CA ', 192.765, 99.371, 122.235], ['C', ' C ', 191.722, 100.337, 121.746], ['C', ' O ', 190.901, 99.988, 120.896], ['C', ' H ', 193.182, 98.752, 124.198], ['C', ' HA ', 193.731, 99.862, 122.295], ['C', ' HA ', 192.872, 98.546, 121.536]]
[['C', ' N ', 191.754, 101.575, 122.238], ['C', ' CA ', 190.746, 102.575, 121.881], ['C', ' C ', 190.86, 103.109, 120.47], ['C', ' O ', 191.044, 104.305, 120.249], ['C', ' H ', 192.46, 101.805, 122.921], ['C', ' HA ', 189.759, 102.131, 121.999], ['C', ' HA ', 190.802, 103.398, 122.582]]
[['C', ' N ', 190.673, 102.206, 119.531], ['C', ' CA ', 190.746, 102.386, 118.107], ['C', ' C ', 189.402, 102.899, 117.66], ['C', ' O ', 189.302, 103.865, 116.909], ['C', ' CB ', 191.159, 101.076, 117.442], ['C', ' CG1', 192.57, 100.781, 117.946], ['C', ' CG2', 191.103, 101.184, 115.899], ['C', ' CD1', 193.07, 99.511, 117.645], ['C', ' H ', 190.491, 101.272, 119.871], ['C', ' HA ', 191.496, 103.137, 117.881], ['C', ' HB ', 190.503, 100.272, 117.783], ['C', ' HG1', 193.242, 101.471, 117.529], ['C', ' HG1', 192.588, 100.881, 119.021], ['C', ' HG2', 191.409, 100.251, 115.436], ['C', ' HG2', 190.088, 101.412, 115.573], ['C', ' HG2', 191.772, 101.973, 115.576], ['C', ' HD1', 194.049, 99.434, 118.055], ['C', ' HD1', 192.442, 98.743, 118.066], ['C', ' HD1', 193.118, 99.408, 116.6]]
[['C', ' N ', 188.347, 102.362, 118.225], ['C', ' CA ', 187.022, 102.826, 117.863], ['C', ' C ', 186.888, 104.316, 118.251], ['C', ' O ', 186.218, 105.08, 117.574], ['C', ' CB ', 185.965, 101.934, 118.552], ['C', ' CG1', 186.111, 100.505, 118.061], ['C', ' CG2', 186.121, 101.965, 120.07], ['C', ' H ', 188.477, 101.594, 118.861], ['C', ' HA ', 186.901, 102.738, 116.783], ['C', ' HB ', 184.984, 102.277, 118.291], ['C', ' HG1', 185.361, 99.887, 118.536], ['C', ' HG1', 185.976, 100.467, 117.001], ['C', ' HG1', 187.094, 100.114, 118.306], ['C', ' HG2', 185.359, 101.325, 120.515], ['C', ' HG2', 187.105, 101.61, 120.369], ['C', ' HG2', 185.977, 102.952, 120.413]]
[['C', ' N ', 187.634, 104.724, 119.28], ['C', ' CA ', 187.781, 106.08, 119.802], ['C', ' C ', 189.077, 106.763, 119.378], ['C', ' O ', 189.414, 107.838, 119.87], ['C', ' CB ', 187.848, 106.017, 121.317], ['C', ' OG1', 188.884, 105.065, 121.671], ['C', ' CG2', 186.57, 105.632, 121.939], ['C', ' H ', 188.118, 104.01, 119.814], ['C', ' HA ', 186.935, 106.681, 119.468], ['C', ' HB ', 188.133, 106.998, 121.698], ['C', ' HG1', 189.744, 105.225, 121.165], ['C', ' HG2', 186.708, 105.604, 122.998], ['C', ' HG2', 185.8, 106.363, 121.685], ['C', ' HG2', 186.269, 104.678, 121.605]]
[['C', ' N ', 189.839, 106.097, 118.542], ['C', ' CA ', 191.154, 106.514, 118.089], ['C', ' C ', 191.111, 106.833, 116.623], ['C', ' O ', 191.465, 107.927, 116.195], ['C', ' H ', 189.467, 105.241, 118.156], ['C', ' HA ', 191.483, 107.385, 118.651], ['C', ' HA ', 191.872, 105.716, 118.276]]
[['C', ' N ', 190.783, 105.813, 115.852], ['C', ' CA ', 190.729, 105.82, 114.421], ['C', ' C ', 189.594, 106.668, 114.008], ['C', ' O ', 189.695, 107.434, 113.06], ['C', ' CB ', 190.487, 104.405, 113.911], ['C', ' CG ', 190.497, 104.173, 112.425], ['C', ' CD1', 191.869, 104.562, 111.861], ['C', ' CD2', 190.168, 102.702, 112.18], ['C', ' H ', 190.511, 104.959, 116.306], ['C', ' HA ', 191.658, 106.231, 114.045], ['C', ' HB ', 191.242, 103.772, 114.33], ['C', ' HB ', 189.52, 104.068, 114.288], ['C', ' HG ', 189.744, 104.793, 111.93], ['C', ' HD1', 191.88, 104.375, 110.818], ['C', ' HD1', 192.079, 105.612, 112.018], ['C', ' HD1', 192.638, 103.972, 112.335], ['C', ' HD2', 190.166, 102.495, 111.113], ['C', ' HD2', 190.902, 102.07, 112.665], ['C', ' HD2', 189.181, 102.482, 112.592]]
[['C', ' N ', 188.505, 106.551, 114.739], ['C', ' CA ', 187.356, 107.34, 114.376], ['C', ' C ', 187.667, 108.8, 114.663], ['C', ' O ', 187.318, 109.676, 113.874], ['C', ' CB ', 186.134, 106.855, 115.13], ['C', ' CG ', 184.779, 107.461, 114.8], ['C', ' CD1', 184.446, 107.272, 113.311], ['C', ' CD2', 183.757, 106.728, 115.651], ['C', ' H ', 188.507, 105.868, 115.503], ['C', ' HA ', 187.194, 107.219, 113.309], ['C', ' HB ', 186.061, 105.772, 115.018], ['C', ' HB ', 186.307, 107.07, 116.183], ['C', ' HG ', 184.768, 108.527, 115.033], ['C', ' HD1', 183.48, 107.673, 113.125], ['C', ' HD1', 185.165, 107.789, 112.682], ['C', ' HD1', 184.446, 106.208, 113.065], ['C', ' HD2', 182.762, 107.101, 115.476], ['C', ' HD2', 183.794, 105.673, 115.398], ['C', ' HD2', 184.006, 106.852, 116.704]]
[['C', ' N ', 188.332, 109.066, 115.788], ['C', ' CA ', 188.703, 110.429, 116.132], ['C', ' C ', 189.726, 110.953, 115.134], ['C', ' O ', 189.683, 112.12, 114.752], ['C', ' CB ', 189.237, 110.489, 117.538], ['C', ' H ', 188.586, 108.298, 116.393], ['C', ' HA ', 187.821, 111.056, 116.053], ['C', ' HB ', 189.495, 111.516, 117.783], ['C', ' HB ', 188.486, 110.125, 118.237], ['C', ' HB ', 190.128, 109.863, 117.615]]
[['C', ' N ', 190.628, 110.081, 114.689], ['C', ' CA ', 191.615, 110.432, 113.693], ['C', ' C ', 190.963, 110.819, 112.409], ['C', ' O ', 191.348, 111.798, 111.796], ['C', ' CB ', 192.586, 109.301, 113.436], ['C', ' CG ', 193.503, 109.567, 112.286], ['C', ' CD1', 194.419, 110.575, 112.373], ['C', ' CD2', 193.459, 108.768, 111.158], ['C', ' CE1', 195.284, 110.809, 111.361], ['C', ' CE2', 194.351, 108.997, 110.127], ['C', ' CZ ', 195.259, 110.029, 110.239], ['C', ' OH ', 196.185, 110.286, 109.263], ['C', ' H ', 190.663, 109.145, 115.085], ['C', ' HA ', 192.171, 111.296, 114.057], ['C', ' HB ', 193.176, 109.11, 114.325], ['C', ' HB ', 192.036, 108.403, 113.219], ['C', ' HD1', 194.454, 111.2, 113.258], ['C', ' HD2', 192.736, 107.953, 111.087], ['C', ' HE1', 196.011, 111.615, 111.444], ['C', ' HE2', 194.337, 108.364, 109.238], ['C', ' HH ', 196.496, 109.449, 108.862]]
[['C', ' N ', 190.019, 110.01, 111.96], ['C', ' CA ', 189.301, 110.271, 110.741], ['C', ' C ', 188.511, 111.573, 110.844], ['C', ' O ', 188.4, 112.337, 109.877], ['C', ' CB ', 188.39, 109.104, 110.459], ['C', ' H ', 189.799, 109.167, 112.488], ['C', ' HA ', 190.028, 110.375, 109.939], ['C', ' HB ', 187.894, 109.25, 109.55], ['C', ' HB ', 188.982, 108.203, 110.4], ['C', ' HB ', 187.669, 109.004, 111.267]]
[['C', ' N ', 187.988, 111.86, 112.038], ['C', ' CA ', 187.25, 113.09, 112.247], ['C', ' C ', 188.223, 114.258, 112.047], ['C', ' O ', 187.936, 115.252, 111.358], ['C', ' CB ', 186.643, 113.071, 113.66], ['C', ' CG ', 185.772, 114.238, 114.119], ['C', ' CD1', 184.57, 114.371, 113.232], ['C', ' CD2', 185.329, 113.969, 115.544], ['C', ' H ', 188.044, 111.169, 112.79], ['C', ' HA ', 186.47, 113.139, 111.522], ['C', ' HB ', 186.065, 112.154, 113.766], ['C', ' HB ', 187.46, 113.022, 114.36], ['C', ' HG ', 186.341, 115.17, 114.077], ['C', ' HD1', 183.942, 115.197, 113.576], ['C', ' HD1', 184.879, 114.575, 112.22], ['C', ' HD1', 184.005, 113.447, 113.261], ['C', ' HD2', 184.716, 114.786, 115.873], ['C', ' HD2', 184.754, 113.048, 115.586], ['C', ' HD2', 186.206, 113.879, 116.184]]
[['C', ' N ', 189.411, 114.127, 112.615], ['C', ' CA ', 190.423, 115.12, 112.381], ['C', ' C ', 190.8, 115.031, 110.915], ['C', ' O ', 190.71, 113.984, 110.291], ['C', ' CB ', 191.642, 114.918, 113.268], ['C', ' CG ', 191.412, 115.309, 114.723], ['C', ' OD1', 190.44, 115.972, 115.026], ['C', ' OD2', 192.236, 114.952, 115.528], ['C', ' H ', 189.601, 113.333, 113.234], ['C', ' HA ', 190.008, 116.107, 112.577], ['C', ' HB ', 191.931, 113.867, 113.232], ['C', ' HB ', 192.477, 115.496, 112.873]]
[['C', ' N ', 191.166, 116.14, 110.33], ['C', ' CA ', 191.566, 116.189, 108.927], ['C', ' C ', 190.422, 115.917, 107.927], ['C', ' O ', 190.668, 115.912, 106.72], ['C', ' CB ', 192.725, 115.219, 108.638], ['C', ' CG ', 193.918, 115.349, 109.586], ['C', ' CD ', 194.551, 116.704, 109.554], ['C', ' OE1', 194.453, 117.366, 108.551], ['C', ' OE2', 195.123, 117.088, 110.545], ['C', ' H ', 191.202, 116.989, 110.876], ['C', ' HA ', 191.933, 117.198, 108.728], ['C', ' HB ', 192.387, 114.187, 108.636], ['C', ' HB ', 193.101, 115.419, 107.636], ['C', ' HG ', 193.612, 115.123, 110.601], ['C', ' HG ', 194.66, 114.606, 109.298]]
[['C', ' N ', 189.172, 115.784, 108.395], ['C', ' CA ', 188.029, 115.729, 107.491], ['C', ' C ', 187.682, 114.438, 106.747], ['C', ' O ', 187.07, 114.515, 105.676], ['C', ' H ', 188.981, 115.737, 109.404], ['C', ' HA ', 187.151, 116.006, 108.078], ['C', ' HA ', 188.145, 116.524, 106.758]]
[['C', ' N ', 188.071, 113.267, 107.234], ['C', ' CA ', 187.67, 112.059, 106.518], ['C', ' C ', 186.216, 111.855, 106.899], ['C', ' O ', 185.366, 111.497, 106.085], ['C', ' CB ', 188.5, 110.838, 106.916], ['C', ' CG1', 190.012, 111.083, 106.612], ['C', ' CG2', 187.947, 109.569, 106.24], ['C', ' CD1', 190.373, 111.389, 105.177], ['C', ' H ', 188.584, 113.205, 108.12], ['C', ' HA ', 187.721, 112.218, 105.446], ['C', ' HB ', 188.431, 110.721, 107.964], ['C', ' HG1', 190.348, 111.919, 107.229], ['C', ' HG1', 190.566, 110.208, 106.905], ['C', ' HG2', 188.513, 108.707, 106.551], ['C', ' HG2', 186.907, 109.417, 106.514], ['C', ' HG2', 188.007, 109.667, 105.16], ['C', ' HD1', 191.451, 111.537, 105.108], ['C', ' HD1', 190.087, 110.563, 104.532], ['C', ' HD1', 189.873, 112.298, 104.848]]
[['C', ' N ', 185.991, 112.043, 108.182], ['C', ' CA ', 184.724, 111.955, 108.859], ['C', ' C ', 184.383, 113.342, 109.37], ['C', ' O ', 185.232, 114.057, 109.869], ['C', ' CB ', 184.825, 110.86, 109.942], ['C', ' CG1', 185.13, 109.509, 109.254], ['C', ' CG2', 183.665, 110.795, 110.835], ['C', ' CD1', 184.098, 108.985, 108.306], ['C', ' H ', 186.807, 112.301, 108.742], ['C', ' HA ', 183.95, 111.695, 108.147], ['C', ' HB ', 185.683, 111.074, 110.552], ['C', ' HG1', 186.007, 109.625, 108.679], ['C', ' HG1', 185.299, 108.754, 110.019], ['C', ' HG2', 183.819, 110.02, 111.579], ['C', ' HG2', 183.552, 111.741, 111.337], ['C', ' HG2', 182.776, 110.577, 110.261], ['C', ' HD1', 184.449, 108.066, 107.881], ['C', ' HD1', 183.185, 108.807, 108.817], ['C', ' HD1', 183.924, 109.675, 107.499]]
[['C', ' N ', 183.168, 113.775, 109.149], ['C', ' CA ', 182.722, 115.088, 109.604], ['C', ' C ', 181.976, 115.018, 110.934], ['C', ' O ', 181.636, 116.04, 111.525], ['C', ' CB ', 181.898, 115.736, 108.51], ['C', ' CG ', 182.679, 116.112, 107.299], ['C', ' CD ', 181.8, 116.567, 106.183], ['C', ' OE1', 180.589, 116.585, 106.363], ['C', ' OE2', 182.332, 116.936, 105.159], ['C', ' H ', 182.519, 113.138, 108.687], ['C', ' HA ', 183.603, 115.71, 109.758], ['C', ' HB ', 181.174, 115.017, 108.148], ['C', ' HB ', 181.366, 116.61, 108.89], ['C', ' HG ', 183.351, 116.924, 107.566], ['C', ' HG ', 183.291, 115.28, 106.986]]
[['C', ' N ', 181.751, 113.802, 111.393], ['C', ' CA ', 181.066, 113.491, 112.638], ['C', ' C ', 180.801, 111.998, 112.659], ['C', ' O ', 180.844, 111.343, 111.616], ['C', ' H ', 182.084, 113.034, 110.831], ['C', ' HA ', 181.689, 113.771, 113.484], ['C', ' HA ', 180.14, 114.048, 112.719]]
[['C', ' N ', 180.427, 111.465, 113.8], ['C', ' CA ', 180.177, 110.034, 113.86], ['C', ' C ', 179.119, 109.674, 114.86], ['C', ' O ', 178.953, 110.341, 115.874], ['C', ' CB ', 181.45, 109.322, 114.201], ['C', ' H ', 180.372, 112.077, 114.619], ['C', ' HA ', 179.825, 109.716, 112.885], ['C', ' HB ', 181.26, 108.256, 114.211], ['C', ' HB ', 182.203, 109.558, 113.458], ['C', ' HB ', 181.793, 109.637, 115.174]]
[['C', ' N ', 178.421, 108.587, 114.599], ['C', ' CA ', 177.4, 108.131, 115.514], ['C', ' C ', 177.88, 107.022, 116.398], ['C', ' O ', 178.205, 105.909, 115.961], ['C', ' CB ', 176.147, 107.729, 114.752], ['C', ' CG1', 175.136, 107.18, 115.681], ['C', ' CG2', 175.558, 108.985, 114.087], ['C', ' H ', 178.637, 108.062, 113.748], ['C', ' HA ', 177.127, 108.961, 116.157], ['C', ' HB ', 176.389, 106.968, 114.01], ['C', ' HG1', 174.284, 106.923, 115.085], ['C', ' HG1', 175.501, 106.284, 116.183], ['C', ' HG1', 174.873, 107.929, 116.431], ['C', ' HG2', 174.65, 108.726, 113.557], ['C', ' HG2', 175.326, 109.711, 114.857], ['C', ' HG2', 176.279, 109.41, 113.394]]
[['C', ' N ', 177.873, 107.356, 117.673], ['C', ' CA ', 178.376, 106.523, 118.732], ['C', ' C ', 177.369, 106.387, 119.848], ['C', ' O ', 176.417, 107.162, 119.932], ['C', ' CB ', 179.688, 107.117, 119.272], ['C', ' CG1', 180.718, 107.189, 118.162], ['C', ' CG2', 179.44, 108.519, 119.831], ['C', ' H ', 177.48, 108.277, 117.897], ['C', ' HA ', 178.559, 105.541, 118.329], ['C', ' HB ', 180.079, 106.465, 120.053], ['C', ' HG1', 181.63, 107.574, 118.567], ['C', ' HG1', 180.901, 106.205, 117.762], ['C', ' HG1', 180.373, 107.842, 117.363], ['C', ' HG2', 180.368, 108.937, 120.214], ['C', ' HG2', 179.057, 109.17, 119.041], ['C', ' HG2', 178.711, 108.473, 120.642]]
[['C', ' N ', 177.574, 105.404, 120.709], ['C', ' CA ', 176.706, 105.242, 121.862], ['C', ' C ', 177.26, 106.033, 123.024], ['C', ' O ', 178.273, 105.641, 123.611], ['C', ' CB ', 176.605, 103.781, 122.244], ['C', ' H ', 178.359, 104.783, 120.578], ['C', ' HA ', 175.717, 105.628, 121.618], ['C', ' HB ', 175.965, 103.688, 123.092], ['C', ' HB ', 176.207, 103.211, 121.422], ['C', ' HB ', 177.592, 103.406, 122.494]]
[['C', ' N ', 176.671, 107.176, 123.311], ['C', ' CA ', 177.206, 108.052, 124.325], ['C', ' C ', 176.522, 107.798, 125.645], ['C', ' O ', 175.783, 106.822, 125.785], ['C', ' H ', 175.812, 107.461, 122.827], ['C', ' HA ', 178.273, 107.879, 124.41], ['C', ' HA ', 177.058, 109.084, 124.015]]
[['C', ' N ', 176.784, 108.627, 126.656], ['C', ' CA ', 176.197, 108.556, 127.976], ['C', ' C ', 174.694, 108.724, 127.87], ['C', ' O ', 174.235, 109.527, 127.061], ['C', ' CB ', 176.835, 109.749, 128.69], ['C', ' CG ', 178.114, 110.024, 127.916], ['C', ' CD ', 177.767, 109.709, 126.488], ['C', ' HA ', 176.457, 107.599, 128.453], ['C', ' HB ', 176.137, 110.602, 128.69], ['C', ' HB ', 177.023, 109.495, 129.742], ['C', ' HG ', 178.423, 111.073, 128.054], ['C', ' HG ', 178.944, 109.402, 128.294], ['C', ' HD ', 177.301, 110.579, 126.0], ['C', ' HD ', 178.68, 109.384, 125.98]]
[['C', ' N ', 173.94, 108.006, 128.694], ['C', ' CA ', 172.485, 108.122, 128.692], ['C', ' C ', 171.957, 108.879, 129.909], ['C', ' O ', 172.701, 109.564, 130.614], ['C', ' H ', 174.366, 107.349, 129.338], ['C', ' HA ', 172.162, 108.635, 127.791], ['C', ' HA ', 172.047, 107.122, 128.661]]
[['C', ' N ', 170.651, 108.73, 130.163], ['C', ' CA ', 169.944, 109.382, 131.274], ['C', ' C ', 170.092, 108.602, 132.577], ['C', ' O ', 169.679, 109.052, 133.647], ['C', ' CB ', 168.455, 109.527, 130.942], ['C', ' CG ', 167.624, 108.221, 131.032], ['C', ' CD ', 167.72, 107.353, 129.819], ['C', ' OE1', 168.604, 107.567, 129.026], ['C', ' OE2', 166.923, 106.451, 129.684], ['C', ' H ', 170.095, 108.152, 129.525], ['C', ' HA ', 170.374, 110.373, 131.42], ['C', ' HB ', 168.006, 110.247, 131.626], ['C', ' HB ', 168.346, 109.926, 129.934], ['C', ' HG ', 167.9, 107.64, 131.904], ['C', ' HG ', 166.582, 108.508, 131.162]]
[['C', ' N ', 170.639, 107.415, 132.445], ['C', ' CA ', 170.825, 106.43, 133.49], ['C', ' C ', 172.232, 105.892, 133.362], ['C', ' O ', 172.826, 105.981, 132.291], ['C', ' CB ', 169.765, 105.328, 133.364], ['C', ' CG ', 169.844, 104.196, 134.385], ['C', ' CD ', 169.739, 104.649, 135.814], ['C', ' OE1', 168.684, 104.54, 136.384], ['C', ' OE2', 170.735, 105.122, 136.334], ['C', ' H ', 170.944, 107.182, 131.512], ['C', ' HA ', 170.728, 106.912, 134.464], ['C', ' HB ', 168.775, 105.774, 133.443], ['C', ' HB ', 169.834, 104.879, 132.378], ['C', ' HG ', 169.019, 103.512, 134.186], ['C', ' HG ', 170.757, 103.633, 134.237]]
[['C', ' N ', 172.771, 105.362, 134.439], ['C', ' CA ', 174.112, 104.823, 134.403], ['C', ' C ', 174.173, 103.613, 133.513], ['C', ' O ', 173.265, 102.781, 133.523], ['C', ' CB ', 174.545, 104.433, 135.805], ['C', ' CG ', 174.822, 105.582, 136.633], ['C', ' CD1', 173.855, 106.09, 137.465], ['C', ' CD2', 176.06, 106.178, 136.597], ['C', ' CE1', 174.119, 107.184, 138.246], ['C', ' CE2', 176.329, 107.269, 137.377], ['C', ' CZ ', 175.355, 107.775, 138.202], ['C', ' H ', 172.205, 105.325, 135.293], ['C', ' HA ', 174.784, 105.585, 134.011], ['C', ' HB ', 173.762, 103.842, 136.284], ['C', ' HB ', 175.435, 103.828, 135.76], ['C', ' HD1', 172.866, 105.619, 137.503], ['C', ' HD2', 176.834, 105.773, 135.942], ['C', ' HE1', 173.344, 107.581, 138.901], ['C', ' HE2', 177.315, 107.737, 137.344], ['C', ' HZ ', 175.567, 108.643, 138.825]]
[['C', ' N ', 175.25, 103.518, 132.731], ['C', ' CA ', 175.542, 102.406, 131.818], ['C', ' C ', 174.626, 102.265, 130.611], ['C', ' O ', 175.101, 101.962, 129.521], ['C', ' CB ', 175.695, 101.142, 132.633], ['C', ' CG ', 176.967, 101.261, 133.303], ['C', ' CD1', 177.227, 101.652, 134.565], ['C', ' CD2', 178.22, 100.996, 132.705], ['C', ' NE1', 178.565, 101.683, 134.764], ['C', ' CE2', 179.183, 101.28, 133.642], ['C', ' CE3', 178.599, 100.548, 131.459], ['C', ' CZ2', 180.504, 101.14, 133.378], ['C', ' CZ3', 179.931, 100.398, 131.189], ['C', ' CH2', 180.862, 100.691, 132.128], ['C', ' H ', 175.923, 104.271, 132.774], ['C', ' HA ', 176.531, 102.605, 131.411], ['C', ' HB ', 174.91, 101.036, 133.362], ['C', ' HB ', 175.694, 100.264, 131.993], ['C', ' HD1', 176.486, 101.927, 135.301], ['C', ' HE1', 179.081, 101.967, 135.628], ['C', ' HE3', 177.85, 100.313, 130.713], ['C', ' HZ2', 181.252, 101.371, 134.119], ['C', ' HZ3', 180.221, 100.04, 130.204], ['C', ' HH2', 181.905, 100.57, 131.885]]
[['C', ' N ', 173.347, 102.48, 130.783], ['C', ' CA ', 172.434, 102.467, 129.669], ['C', ' C ', 172.94, 103.532, 128.669], ['C', ' O ', 173.082, 104.687, 129.048], ['C', ' CB ', 171.042, 102.804, 130.18], ['C', ' CG ', 169.942, 102.746, 129.182], ['C', ' CD ', 168.603, 102.982, 129.891], ['C', ' CE ', 167.415, 102.921, 128.938], ['C', ' NZ ', 167.337, 104.128, 128.046], ['C', ' H ', 173.048, 102.669, 131.733], ['C', ' HA ', 172.424, 101.467, 129.259], ['C', ' HB ', 170.785, 102.148, 131.001], ['C', ' HB ', 171.061, 103.816, 130.585], ['C', ' HG ', 170.105, 103.51, 128.417], ['C', ' HG ', 169.934, 101.764, 128.704], ['C', ' HD ', 168.469, 102.23, 130.672], ['C', ' HD ', 168.612, 103.97, 130.362], ['C', ' HE ', 167.504, 102.03, 128.318], ['C', ' HE ', 166.495, 102.856, 129.519], ['C', ' HZ ', 166.545, 104.056, 127.44], ['C', ' HZ ', 167.231, 104.982, 128.626], ['C', ' HZ ', 168.171, 104.213, 127.489]]
[['C', ' N ', 173.268, 103.172, 127.427], ['C', ' CA ', 173.781, 104.016, 126.367], ['C', ' C ', 172.728, 104.865, 125.71], ['C', ' O ', 171.555, 104.487, 125.689], ['C', ' CB ', 174.305, 102.998, 125.389], ['C', ' CG ', 173.417, 101.825, 125.595], ['C', ' CD ', 173.104, 101.811, 127.028], ['C', ' HA ', 174.595, 104.646, 126.762], ['C', ' HB ', 174.207, 103.41, 124.385], ['C', ' HB ', 175.366, 102.797, 125.572], ['C', ' HG ', 172.497, 101.924, 124.993], ['C', ' HG ', 173.91, 100.895, 125.271], ['C', ' HD ', 172.056, 101.49, 127.132], ['C', ' HD ', 173.826, 101.172, 127.547]]
[['C', ' N ', 173.164, 105.934, 125.078], ['C', ' CA ', 172.308, 106.742, 124.235], ['C', ' C ', 172.989, 107.174, 122.942], ['C', ' O ', 173.927, 107.973, 122.98], ['C', ' CB ', 171.863, 107.978, 124.986], ['C', ' CG ', 171.121, 109.011, 124.16], ['C', ' CD ', 169.823, 108.543, 123.576], ['C', ' OE1', 168.946, 108.036, 124.275], ['C', ' NE2', 169.687, 108.704, 122.262], ['C', ' H ', 174.145, 106.203, 125.206], ['C', ' HA ', 171.418, 106.165, 124.027], ['C', ' HB ', 171.22, 107.68, 125.812], ['C', ' HB ', 172.737, 108.464, 125.403], ['C', ' HG ', 170.898, 109.851, 124.812], ['C', ' HG ', 171.754, 109.36, 123.341], ['C', ' HE2', 168.847, 108.421, 121.803], ['C', ' HE2', 170.467, 109.09, 121.707]]
[['C', ' N ', 172.508, 106.753, 121.772], ['C', ' CA ', 173.051, 107.152, 120.498], ['C', ' C ', 173.1, 108.662, 120.379], ['C', ' O ', 172.117, 109.356, 120.657], ['C', ' CB ', 172.019, 106.595, 119.533], ['C', ' CG ', 171.467, 105.383, 120.238], ['C', ' CD ', 171.423, 105.755, 121.689], ['C', ' HA ', 174.033, 106.697, 120.337], ['C', ' HB ', 171.246, 107.352, 119.343], ['C', ' HB ', 172.492, 106.409, 118.577], ['C', ' HG ', 170.475, 105.139, 119.829], ['C', ' HG ', 172.1, 104.51, 120.049], ['C', ' HD ', 170.449, 106.172, 121.943], ['C', ' HD ', 171.667, 104.851, 122.284]]
[['C', ' N ', 174.224, 109.156, 119.909], ['C', ' CA ', 174.426, 110.576, 119.712], ['C', ' C ', 175.401, 110.777, 118.585], ['C', ' O ', 176.124, 109.841, 118.23], ['C', ' CB ', 174.896, 111.232, 121.004], ['C', ' CG ', 176.232, 110.725, 121.571], ['C', ' SD ', 177.714, 111.415, 120.77], ['C', ' CE ', 177.69, 113.163, 121.14], ['C', ' H ', 174.994, 108.507, 119.721], ['C', ' HA ', 173.48, 111.029, 119.416], ['C', ' HB ', 174.95, 112.3, 120.863], ['C', ' HB ', 174.143, 111.048, 121.776], ['C', ' HG ', 176.272, 110.961, 122.629], ['C', ' HG ', 176.266, 109.635, 121.467], ['C', ' HE ', 178.547, 113.642, 120.691], ['C', ' HE ', 176.795, 113.619, 120.731], ['C', ' HE ', 177.721, 113.314, 122.217]]
[['C', ' N ', 175.442, 111.968, 118.004], ['C', ' CA ', 176.445, 112.146, 116.981], ['C', ' C ', 177.495, 113.078, 117.507], ['C', ' O ', 177.193, 114.162, 118.001], ['C', ' CB ', 175.857, 112.687, 115.658], ['C', ' CG1', 175.258, 114.091, 115.798], ['C', ' CG2', 176.929, 112.671, 114.601], ['C', ' H ', 174.832, 112.72, 118.296], ['C', ' HA ', 176.913, 111.194, 116.769], ['C', ' HB ', 175.046, 112.033, 115.359], ['C', ' HG1', 174.843, 114.383, 114.841], ['C', ' HG1', 174.479, 114.101, 116.544], ['C', ' HG1', 176.016, 114.817, 116.072], ['C', ' HG2', 176.51, 112.996, 113.689], ['C', ' HG2', 177.755, 113.327, 114.87], ['C', ' HG2', 177.294, 111.672, 114.478]]
[['C', ' N ', 178.722, 112.638, 117.403], ['C', ' CA ', 179.848, 113.402, 117.83], ['C', ' C ', 180.326, 114.23, 116.676], ['C', ' O ', 180.443, 113.73, 115.558], ['C', ' CB ', 180.946, 112.479, 118.308], ['C', ' H ', 178.857, 111.722, 116.991], ['C', ' HA ', 179.539, 114.068, 118.628], ['C', ' HB ', 181.808, 113.056, 118.615], ['C', ' HB ', 180.588, 111.883, 119.148], ['C', ' HB ', 181.223, 111.828, 117.492]]
[['C', ' N ', 180.653, 115.481, 116.934], ['C', ' CA ', 181.225, 116.348, 115.909], ['C', ' C ', 182.542, 116.903, 116.408], ['C', ' O ', 183.062, 117.898, 115.904], ['C', ' CB ', 180.252, 117.447, 115.531], ['C', ' CG ', 178.997, 116.927, 114.849], ['C', ' SD ', 177.914, 118.233, 114.233], ['C', ' CE ', 177.231, 118.874, 115.74], ['C', ' H ', 180.486, 115.839, 117.891], ['C', ' HA ', 181.438, 115.758, 115.02], ['C', ' HB ', 179.972, 117.989, 116.428], ['C', ' HB ', 180.741, 118.15, 114.853], ['C', ' HG ', 179.295, 116.297, 114.009], ['C', ' HG ', 178.43, 116.309, 115.549], ['C', ' HE ', 176.541, 119.683, 115.51], ['C', ' HE ', 176.702, 118.077, 116.268], ['C', ' HE ', 178.025, 119.258, 116.374]]
[['C', ' N ', 183.043, 116.259, 117.437], ['C', ' CA ', 184.278, 116.597, 118.115], ['C', ' C ', 184.906, 115.372, 118.702], ['C', ' O ', 184.222, 114.476, 119.194], ['C', ' CB ', 184.072, 117.593, 119.222], ['C', ' OG ', 185.292, 117.785, 119.919], ['C', ' H ', 182.527, 115.448, 117.748], ['C', ' HA ', 184.97, 117.022, 117.386], ['C', ' HB ', 183.73, 118.539, 118.803], ['C', ' HB ', 183.302, 117.235, 119.907], ['C', ' HG ', 185.136, 118.518, 120.535]]
[['C', ' N ', 186.225, 115.326, 118.708], ['C', ' CA ', 186.889, 114.179, 119.289], ['C', ' C ', 186.597, 114.076, 120.783], ['C', ' O ', 186.509, 112.972, 121.324], ['C', ' CB ', 188.372, 114.278, 119.041], ['C', ' OG ', 188.91, 115.37, 119.722], ['C', ' H ', 186.772, 116.083, 118.315], ['C', ' HA ', 186.513, 113.281, 118.801], ['C', ' HB ', 188.859, 113.363, 119.37], ['C', ' HB ', 188.557, 114.384, 117.969], ['C', ' HG ', 189.846, 115.39, 119.493]]
[['C', ' N ', 186.269, 115.196, 121.43], ['C', ' CA ', 185.98, 115.196, 122.86], ['C', ' C ', 184.755, 114.356, 123.179], ['C', ' O ', 184.598, 113.839, 124.289], ['C', ' CB ', 185.69, 116.613, 123.342], ['C', ' CG ', 186.898, 117.536, 123.373], ['C', ' OD1', 188.009, 117.078, 123.291], ['C', ' OD2', 186.681, 118.717, 123.463], ['C', ' H ', 186.308, 116.092, 120.941], ['C', ' HA ', 186.839, 114.788, 123.392], ['C', ' HB ', 184.935, 117.057, 122.694], ['C', ' HB ', 185.265, 116.57, 124.344]]
[['C', ' N ', 183.854, 114.258, 122.216], ['C', ' CA ', 182.61, 113.553, 122.375], ['C', ' C ', 182.809, 112.07, 122.128], ['C', ' O ', 182.013, 111.246, 122.583], ['C', ' CB ', 181.582, 114.186, 121.464], ['C', ' CG ', 181.201, 115.611, 121.893], ['C', ' CD ', 180.37, 116.358, 120.884], ['C', ' OE1', 180.337, 115.928, 119.752], ['C', ' OE2', 179.778, 117.345, 121.237], ['C', ' H ', 184.051, 114.647, 121.291], ['C', ' HA ', 182.269, 113.689, 123.398], ['C', ' HB ', 181.988, 114.259, 120.472], ['C', ' HB ', 180.698, 113.566, 121.425], ['C', ' HG ', 180.647, 115.553, 122.83], ['C', ' HG ', 182.114, 116.174, 122.083]]
[['C', ' N ', 183.863, 111.714, 121.39], ['C', ' CA ', 184.115, 110.324, 121.116], ['C', ' C ', 184.794, 109.795, 122.358], ['C', ' O ', 184.65, 108.625, 122.71], ['C', ' CB ', 185.001, 110.161, 119.878], ['C', ' CG ', 184.395, 110.64, 118.523], ['C', ' CD1', 185.443, 110.534, 117.459], ['C', ' CD2', 183.22, 109.797, 118.139], ['C', ' H ', 184.53, 112.399, 121.044], ['C', ' HA ', 183.176, 109.796, 120.986], ['C', ' HB ', 185.921, 110.723, 120.043], ['C', ' HB ', 185.262, 109.106, 119.773], ['C', ' HG ', 184.088, 111.688, 118.607], ['C', ' HD1', 185.041, 110.873, 116.507], ['C', ' HD1', 186.278, 111.156, 117.741], ['C', ' HD1', 185.77, 109.499, 117.363], ['C', ' HD2', 182.831, 110.136, 117.189], ['C', ' HD2', 183.543, 108.766, 118.047], ['C', ' HD2', 182.439, 109.87, 118.886]]
[['C', ' N ', 185.549, 110.677, 123.023], ['C', ' CA ', 186.172, 110.305, 124.273], ['C', ' C ', 185.082, 110.171, 125.327], ['C', ' O ', 185.007, 109.171, 126.027], ['C', ' CB ', 187.221, 111.326, 124.707], ['C', ' CG ', 188.495, 111.322, 123.872], ['C', ' CD ', 189.488, 112.401, 124.346], ['C', ' CE ', 190.79, 112.362, 123.532], ['C', ' NZ ', 191.748, 113.482, 123.88], ['C', ' H ', 185.697, 111.604, 122.617], ['C', ' HA ', 186.657, 109.337, 124.154], ['C', ' HB ', 186.792, 112.327, 124.645], ['C', ' HB ', 187.491, 111.153, 125.744], ['C', ' HG ', 188.968, 110.341, 123.945], ['C', ' HG ', 188.236, 111.503, 122.826], ['C', ' HD ', 189.033, 113.389, 124.241], ['C', ' HD ', 189.733, 112.237, 125.398], ['C', ' HE ', 191.286, 111.425, 123.726], ['C', ' HE ', 190.546, 112.423, 122.471], ['C', ' HZ ', 192.588, 113.393, 123.316], ['C', ' HZ ', 191.319, 114.374, 123.694], ['C', ' HZ ', 192.043, 113.467, 124.872]]
[['C', ' N ', 184.124, 111.097, 125.353], ['C', ' CA ', 183.033, 111.001, 126.316], ['C', ' C ', 182.234, 109.711, 126.135], ['C', ' O ', 181.776, 109.107, 127.104], ['C', ' CB ', 182.109, 112.185, 126.167], ['C', ' H ', 184.208, 111.941, 124.781], ['C', ' HA ', 183.467, 111.002, 127.315], ['C', ' HB ', 181.314, 112.119, 126.907], ['C', ' HB ', 182.673, 113.107, 126.311], ['C', ' HB ', 181.677, 112.176, 125.171]]
[['C', ' N ', 182.094, 109.276, 124.889], ['C', ' CA ', 181.369, 108.069, 124.528], ['C', ' C ', 182.226, 106.795, 124.65], ['C', ' O ', 181.745, 105.704, 124.33], ['C', ' CB ', 180.85, 108.205, 123.106], ['C', ' H ', 182.449, 109.865, 124.132], ['C', ' HA ', 180.532, 107.969, 125.212], ['C', ' HB ', 180.272, 107.32, 122.836], ['C', ' HB ', 180.22, 109.091, 123.029], ['C', ' HB ', 181.699, 108.306, 122.432]]
[['C', ' N ', 183.493, 106.933, 125.043], ['C', ' CA ', 184.439, 105.828, 125.153], ['C', ' C ', 184.029, 104.834, 126.213], ['C', ' O ', 183.5, 105.197, 127.262], ['C', ' CB ', 185.816, 106.347, 125.498], ['C', ' H ', 183.836, 107.857, 125.308], ['C', ' HA ', 184.468, 105.314, 124.193], ['C', ' HB ', 186.522, 105.523, 125.56], ['C', ' HB ', 186.137, 107.051, 124.739], ['C', ' HB ', 185.754, 106.851, 126.451]]
[['C', ' N ', 184.322, 103.572, 125.955], ['C', ' CA ', 184.037, 102.504, 126.895], ['C', ' C ', 183.052, 101.568, 126.236], ['C', ' O ', 182.382, 101.946, 125.275], ['C', ' H ', 184.734, 103.334, 125.067], ['C', ' HA ', 184.956, 101.977, 127.157], ['C', ' HA ', 183.615, 102.913, 127.812]]
[['C', ' N ', 182.948, 100.351, 126.729], ['C', ' CA ', 182.033, 99.414, 126.109], ['C', ' C ', 180.852, 99.182, 127.002], ['C', ' O ', 180.997, 98.901, 128.187], ['C', ' CB ', 182.721, 98.076, 125.785], ['C', ' OG1', 183.804, 98.296, 124.868], ['C', ' CG2', 181.724, 97.132, 125.124], ['C', ' H ', 183.492, 100.072, 127.532], ['C', ' HA ', 181.667, 99.835, 125.174], ['C', ' HB ', 183.107, 97.628, 126.701], ['C', ' HG1', 184.371, 97.523, 124.862], ['C', ' HG2', 182.222, 96.195, 124.888], ['C', ' HG2', 180.888, 96.93, 125.786], ['C', ' HG2', 181.35, 97.581, 124.207]]
[['C', ' N ', 179.683, 99.341, 126.428], ['C', ' CA ', 178.44, 99.121, 127.118], ['C', ' C ', 177.978, 97.79, 126.578], ['C', ' O ', 178.199, 97.508, 125.403], ['C', ' CB ', 177.468, 100.281, 126.862], ['C', ' CG ', 177.752, 101.553, 127.736], ['C', ' CD ', 178.898, 102.478, 127.228], ['C', ' CE ', 178.447, 103.405, 126.113], ['C', ' NZ ', 179.559, 104.306, 125.645], ['C', ' H ', 179.669, 99.594, 125.449], ['C', ' HA ', 178.615, 99.021, 128.19], ['C', ' HB ', 177.497, 100.56, 125.812], ['C', ' HB ', 176.45, 99.96, 127.084], ['C', ' HG ', 176.841, 102.151, 127.776], ['C', ' HG ', 177.989, 101.249, 128.732], ['C', ' HD ', 179.238, 103.091, 128.061], ['C', ' HD ', 179.746, 101.915, 126.875], ['C', ' HE ', 178.091, 102.827, 125.265], ['C', ' HE ', 177.629, 104.029, 126.483], ['C', ' HZ ', 179.19, 104.915, 124.908], ['C', ' HZ ', 179.912, 104.881, 126.391], ['C', ' HZ ', 180.326, 103.754, 125.26]]
[['C', ' N ', 177.353, 96.977, 127.412], ['C', ' CA ', 176.947, 95.632, 126.999], ['C', ' C ', 175.466, 95.439, 126.821], ['C', ' O ', 174.98, 94.303, 126.851], ['C', ' CB ', 177.548, 94.619, 127.96], ['C', ' CG ', 179.024, 94.653, 127.84], ['C', ' CD1', 179.735, 95.454, 128.665], ['C', ' CD2', 179.673, 93.914, 126.871], ['C', ' CE1', 181.07, 95.539, 128.531], ['C', ' CE2', 181.042, 94.004, 126.755], ['C', ' CZ ', 181.73, 94.828, 127.602], ['C', ' OH ', 183.097, 94.981, 127.512], ['C', ' H ', 177.206, 97.286, 128.364], ['C', ' HA ', 177.393, 95.441, 126.021], ['C', ' HB ', 177.273, 94.86, 128.988], ['C', ' HB ', 177.195, 93.613, 127.732], ['C', ' HD1', 179.231, 96.055, 129.421], ['C', ' HD2', 179.106, 93.271, 126.195], ['C', ' HE1', 181.623, 96.195, 129.157], ['C', ' HE2', 181.569, 93.434, 125.991], ['C', ' HH ', 183.434, 95.432, 128.344]]
[['C', ' N ', 174.764, 96.544, 126.664], ['C', ' CA ', 173.342, 96.521, 126.413], ['C', ' C ', 173.042, 97.134, 125.068], ['C', ' O ', 173.938, 97.393, 124.265], ['C', ' CB ', 172.498, 97.163, 127.521], ['C', ' OG1', 171.125, 96.868, 127.262], ['C', ' CG2', 172.706, 98.613, 127.602], ['C', ' H ', 175.255, 97.425, 126.672], ['C', ' HA ', 173.039, 95.487, 126.336], ['C', ' HB ', 172.757, 96.714, 128.455], ['C', ' HG1', 171.023, 95.901, 127.431], ['C', ' HG2', 172.092, 99.018, 128.395], ['C', ' HG2', 173.754, 98.807, 127.816], ['C', ' HG2', 172.432, 99.083, 126.668]]
[['C', ' N ', 171.776, 97.306, 124.797], ['C', ' CA ', 171.334, 97.784, 123.516], ['C', ' C ', 171.34, 99.27, 123.353], ['C', ' O ', 170.789, 100.014, 124.161], ['C', ' CB ', 169.943, 97.255, 123.264], ['C', ' CG ', 170.031, 95.848, 123.039], ['C', ' CD1', 169.979, 94.968, 124.083], ['C', ' CD2', 170.222, 95.379, 121.782], ['C', ' CE1', 170.128, 93.651, 123.858], ['C', ' CE2', 170.369, 94.076, 121.56], ['C', ' CZ ', 170.329, 93.213, 122.585], ['C', ' H ', 171.12, 97.104, 125.535], ['C', ' HA ', 172.002, 97.366, 122.761], ['C', ' HB ', 169.298, 97.441, 124.124], ['C', ' HB ', 169.509, 97.733, 122.387], ['C', ' HD1', 169.841, 95.336, 125.081], ['C', ' HD2', 170.276, 96.073, 120.938], ['C', ' HE1', 170.104, 92.945, 124.677], ['C', ' HE2', 170.535, 93.722, 120.552], ['C', ' HZ ', 170.478, 92.176, 122.39]]
[['C', ' N ', 171.908, 99.675, 122.236], ['C', ' CA ', 172.001, 101.053, 121.826], ['C', ' C ', 171.702, 101.083, 120.346], ['C', ' O ', 172.545, 100.668, 119.549], ['C', ' CB ', 173.385, 101.598, 121.982], ['C', ' OG ', 173.393, 102.926, 121.591], ['C', ' H ', 172.332, 98.97, 121.65], ['C', ' HA ', 171.312, 101.649, 122.411], ['C', ' HB ', 173.725, 101.498, 122.974], ['C', ' HB ', 174.07, 101.032, 121.352], ['C', ' HG ', 174.311, 103.202, 121.575]]
[['C', ' N ', 170.535, 101.535, 119.904], ['C', ' CA ', 170.121, 101.535, 118.521], ['C', ' C ', 170.825, 102.679, 117.823], ['C', ' O ', 170.221, 103.669, 117.443], ['C', ' CB ', 168.615, 101.725, 118.64], ['C', ' CG ', 168.452, 102.559, 119.881], ['C', ' CD ', 169.545, 102.087, 120.827], ['C', ' HA ', 170.367, 100.568, 118.055], ['C', ' HB ', 168.223, 102.224, 117.742], ['C', ' HB ', 168.123, 100.742, 118.705], ['C', ' HG ', 168.561, 103.61, 119.624], ['C', ' HG ', 167.441, 102.443, 120.299], ['C', ' HD ', 169.944, 102.965, 121.359], ['C', ' HD ', 169.166, 101.306, 121.51]]
[['C', ' N ', 172.133, 102.548, 117.667], ['C', ' CA ', 172.966, 103.614, 117.136], ['C', ' C ', 172.624, 103.984, 115.719], ['C', ' O ', 172.673, 105.147, 115.339], ['C', ' CB ', 174.42, 103.211, 117.174], ['C', ' CG ', 175.024, 103.217, 118.53], ['C', ' OD1', 174.619, 103.925, 119.461], ['C', ' ND2', 176.018, 102.387, 118.665], ['C', ' H ', 172.556, 101.689, 118.016], ['C', ' HA ', 172.826, 104.489, 117.742], ['C', ' HB ', 174.523, 102.205, 116.757], ['C', ' HB ', 174.997, 103.88, 116.539], ['C', ' HD2', 176.49, 102.294, 119.535], ['C', ' HD2', 176.308, 101.828, 117.886]]
[['C', ' N ', 172.178, 103.027, 114.948], ['C', ' CA ', 171.894, 103.27, 113.553], ['C', ' C ', 170.84, 104.327, 113.338], ['C', ' O ', 170.97, 105.153, 112.447], ['C', ' CB ', 171.491, 101.97, 112.871], ['C', ' CG1', 170.992, 102.205, 111.502], ['C', ' CG2', 172.672, 101.066, 112.841], ['C', ' H ', 172.121, 102.09, 115.325], ['C', ' HA ', 172.814, 103.617, 113.082], ['C', ' HB ', 170.713, 101.522, 113.412], ['C', ' HG1', 170.735, 101.269, 111.079], ['C', ' HG1', 170.113, 102.835, 111.525], ['C', ' HG1', 171.759, 102.664, 110.905], ['C', ' HG2', 172.4, 100.113, 112.372], ['C', ' HG2', 173.463, 101.532, 112.277], ['C', ' HG2', 173.005, 100.887, 113.852]]
[['C', ' N ', 169.808, 104.366, 114.152], ['C', ' CA ', 168.729, 105.302, 113.895], ['C', ' C ', 169.161, 106.742, 113.979], ['C', ' O ', 168.543, 107.613, 113.373], ['C', ' CB ', 167.563, 105.047, 114.831], ['C', ' CG ', 167.711, 105.546, 116.227], ['C', ' SD ', 166.334, 105.027, 117.214], ['C', ' CE ', 166.633, 105.877, 118.739], ['C', ' H ', 169.755, 103.719, 114.926], ['C', ' HA ', 168.39, 105.154, 112.897], ['C', ' HB ', 166.662, 105.48, 114.406], ['C', ' HB ', 167.395, 103.98, 114.903], ['C', ' HG ', 168.617, 105.186, 116.668], ['C', ' HG ', 167.741, 106.634, 116.234], ['C', ' HE ', 165.837, 105.633, 119.457], ['C', ' HE ', 167.589, 105.585, 119.146], ['C', ' HE ', 166.631, 106.951, 118.564]]
[['C', ' N ', 170.246, 107.017, 114.675], ['C', ' CA ', 170.75, 108.359, 114.832], ['C', ' C ', 171.361, 108.891, 113.538], ['C', ' O ', 171.478, 110.108, 113.354], ['C', ' CB ', 171.704, 108.392, 116.007], ['C', ' CG ', 172.321, 109.706, 116.29], ['C', ' SD ', 171.145, 110.905, 116.773], ['C', ' CE ', 172.011, 112.33, 116.196], ['C', ' H ', 170.787, 106.261, 115.1], ['C', ' HA ', 169.908, 109.003, 115.075], ['C', ' HB ', 171.155, 108.11, 116.899], ['C', ' HB ', 172.445, 107.657, 115.875], ['C', ' HG ', 173.03, 109.579, 117.102], ['C', ' HG ', 172.871, 110.075, 115.429], ['C', ' HE ', 171.427, 113.202, 116.417], ['C', ' HE ', 172.955, 112.39, 116.702], ['C', ' HE ', 172.173, 112.258, 115.116]]
[['C', ' N ', 171.714, 107.999, 112.614], ['C', ' CA ', 172.343, 108.395, 111.369], ['C', ' C ', 171.39, 109.275, 110.561], ['C', ' O ', 171.829, 110.117, 109.776], ['C', ' CB ', 172.707, 107.16, 110.537], ['C', ' CG ', 173.835, 106.204, 111.057], ['C', ' CD1', 173.849, 104.956, 110.201], ['C', ' CD2', 175.196, 106.849, 110.974], ['C', ' H ', 171.525, 107.004, 112.764], ['C', ' HA ', 173.239, 108.957, 111.594], ['C', ' HB ', 171.821, 106.562, 110.488], ['C', ' HB ', 172.967, 107.478, 109.527], ['C', ' HG ', 173.618, 105.924, 112.091], ['C', ' HD1', 174.613, 104.273, 110.564], ['C', ' HD1', 172.882, 104.481, 110.264], ['C', ' HD1', 174.058, 105.216, 109.165], ['C', ' HD2', 175.953, 106.151, 111.338], ['C', ' HD2', 175.417, 107.111, 109.938], ['C', ' HD2', 175.22, 107.73, 111.576]]
[['C', ' N ', 170.066, 109.095, 110.706], ['C', ' CA ', 169.169, 109.896, 109.885], ['C', ' C ', 169.288, 111.382, 110.186], ['C', ' O ', 169.111, 112.218, 109.289], ['C', ' CB ', 167.702, 109.495, 110.113], ['C', ' CG ', 167.101, 109.934, 111.491], ['C', ' CD ', 165.69, 109.396, 111.704], ['C', ' CE ', 165.045, 109.887, 113.031], ['C', ' NZ ', 165.705, 109.342, 114.249], ['C', ' H ', 169.672, 108.421, 111.372], ['C', ' HA ', 169.423, 109.731, 108.851], ['C', ' HB ', 167.085, 109.936, 109.333], ['C', ' HB ', 167.596, 108.42, 110.027], ['C', ' HG ', 167.745, 109.626, 112.299], ['C', ' HG ', 167.01, 111.017, 111.516], ['C', ' HD ', 165.059, 109.705, 110.873], ['C', ' HD ', 165.718, 108.315, 111.721], ['C', ' HE ', 165.086, 110.973, 113.072], ['C', ' HE ', 164.006, 109.568, 113.04], ['C', ' HZ ', 165.223, 109.679, 115.073], ['C', ' HZ ', 165.648, 108.332, 114.213], ['C', ' HZ ', 166.671, 109.64, 114.29]]
[['C', ' N ', 169.571, 111.713, 111.457], ['C', ' CA ', 169.619, 113.084, 111.921], ['C', ' C ', 171.03, 113.586, 111.756], ['C', ' O ', 171.306, 114.761, 111.49], ['C', ' CB ', 169.182, 113.14, 113.379], ['C', ' CG ', 169.005, 114.518, 113.926], ['C', ' CD ', 168.43, 114.49, 115.34], ['C', ' CE ', 168.169, 115.899, 115.828], ['C', ' NZ ', 167.514, 115.94, 117.174], ['C', ' H ', 169.758, 110.991, 112.151], ['C', ' HA ', 168.946, 113.684, 111.319], ['C', ' HB ', 168.238, 112.612, 113.488], ['C', ' HB ', 169.916, 112.618, 113.993], ['C', ' HG ', 169.942, 115.03, 113.929], ['C', ' HG ', 168.326, 115.07, 113.273], ['C', ' HD ', 167.493, 113.934, 115.35], ['C', ' HD ', 169.13, 114.003, 116.016], ['C', ' HE ', 169.104, 116.454, 115.873], ['C', ' HE ', 167.514, 116.376, 115.109], ['C', ' HZ ', 167.319, 116.927, 117.415], ['C', ' HZ ', 166.631, 115.454, 117.125], ['C', ' HZ ', 168.096, 115.521, 117.874]]
[['C', ' N ', 171.96, 112.673, 111.928], ['C', ' CA ', 173.331, 113.045, 111.816], ['C', ' C ', 173.589, 113.581, 110.41], ['C', ' O ', 174.341, 114.545, 110.249], ['C', ' CB ', 174.191, 111.866, 112.156], ['C', ' H ', 171.709, 111.716, 112.181], ['C', ' HA ', 173.537, 113.833, 112.532], ['C', ' HB ', 175.205, 112.145, 112.098], ['C', ' HB ', 173.96, 111.532, 113.164], ['C', ' HB ', 173.99, 111.075, 111.464]]
[['C', ' N ', 172.943, 112.998, 109.393], ['C', ' CA ', 173.171, 113.559, 108.079], ['C', ' C ', 172.255, 114.764, 107.885], ['C', ' O ', 172.718, 115.828, 107.489], ['C', ' CB ', 172.895, 112.568, 106.941], ['C', ' CG1', 173.089, 113.269, 105.584], ['C', ' CG2', 173.788, 111.409, 107.05], ['C', ' H ', 172.369, 112.161, 109.549], ['C', ' HA ', 174.209, 113.882, 108.01], ['C', ' HB ', 171.87, 112.236, 107.004], ['C', ' HG1', 172.882, 112.56, 104.782], ['C', ' HG1', 172.441, 114.127, 105.471], ['C', ' HG1', 174.129, 113.608, 105.51], ['C', ' HG2', 173.589, 110.706, 106.24], ['C', ' HG2', 174.829, 111.744, 106.995], ['C', ' HG2', 173.602, 110.925, 107.994]]
[['C', ' N ', 170.955, 114.616, 108.137], ['C', ' CA ', 170.049, 115.734, 107.948], ['C', ' C ', 169.746, 116.361, 109.27], ['C', ' O ', 169.246, 115.682, 110.151], ['C', ' CB ', 168.766, 115.318, 107.288], ['C', ' CG ', 168.879, 115.034, 105.798], ['C', ' CD ', 169.373, 113.677, 105.558], ['C', ' NE ', 168.569, 112.723, 106.232], ['C', ' CZ ', 167.469, 112.188, 105.747], ['C', ' NH1', 167.09, 112.493, 104.538], ['C', ' NH2', 166.777, 111.352, 106.499], ['C', ' H ', 170.573, 113.729, 108.471], ['C', ' HA ', 170.524, 116.463, 107.319], ['C', ' HB ', 168.36, 114.457, 107.806], ['C', ' HB ', 168.041, 116.123, 107.402], ['C', ' HG ', 167.9, 115.148, 105.338], ['C', ' HG ', 169.578, 115.74, 105.351], ['C', ' HD ', 169.372, 113.461, 104.496], ['C', ' HD ', 170.343, 113.57, 105.9], ['C', ' HE ', 168.842, 112.464, 107.192], ['C', ' HH1', 167.624, 113.134, 103.978], ['C', ' HH1', 166.264, 112.065, 104.157], ['C', ' HH2', 167.103, 111.136, 107.432], ['C', ' HH2', 165.897, 110.926, 106.16]]
[['C', ' N ', 169.916, 117.676, 109.349], ['C', ' CA ', 169.754, 118.51, 110.539], ['C', ' C ', 171.139, 118.849, 111.087], ['C', ' O ', 171.48, 120.032, 111.248], ['C', ' CB ', 168.975, 117.796, 111.645], ['C', ' CG ', 168.496, 118.679, 112.67], ['C', ' CD ', 167.388, 119.466, 112.067], ['C', ' OE1', 166.451, 118.844, 111.565], ['C', ' NE2', 167.467, 120.763, 112.093], ['C', ' H ', 170.255, 118.143, 108.521], ['C', ' HA ', 169.26, 119.437, 110.263], ['C', ' HB ', 168.086, 117.319, 111.248], ['C', ' HB ', 169.6, 117.044, 112.129], ['C', ' HG ', 168.116, 118.101, 113.502], ['C', ' HG ', 169.284, 119.361, 112.995], ['C', ' HE2', 166.725, 121.326, 111.707], ['C', ' HE2', 168.261, 121.198, 112.541]]
[['C', ' N ', 171.961, 117.838, 111.345], ['C', ' CA ', 173.326, 118.141, 111.739], ['C', ' C ', 174.196, 118.548, 110.547], ['C', ' O ', 175.144, 119.307, 110.707], ['C', ' CB ', 173.958, 117.009, 112.508], ['C', ' CG ', 173.503, 116.94, 113.893], ['C', ' CD1', 172.574, 116.042, 114.283], ['C', ' CD2', 174.034, 117.798, 114.788], ['C', ' CE1', 172.169, 116.003, 115.575], ['C', ' CE2', 173.641, 117.766, 116.088], ['C', ' CZ ', 172.708, 116.865, 116.481], ['C', ' OH ', 172.3, 116.819, 117.786], ['C', ' H ', 171.64, 116.862, 111.272], ['C', ' HA ', 173.282, 118.983, 112.419], ['C', ' HB ', 173.717, 116.087, 112.03], ['C', ' HB ', 175.032, 117.123, 112.507], ['C', ' HD1', 172.155, 115.365, 113.578], ['C', ' HD2', 174.774, 118.512, 114.462], ['C', ' HE1', 171.425, 115.294, 115.886], ['C', ' HE2', 174.074, 118.461, 116.81], ['C', ' HH ', 172.759, 117.499, 118.289]]
[['C', ' N ', 173.867, 118.079, 109.345], ['C', ' CA ', 174.633, 118.437, 108.154], ['C', ' C ', 175.951, 117.728, 108.003], ['C', ' O ', 176.902, 118.301, 107.468], ['C', ' H ', 173.084, 117.445, 109.242], ['C', ' HA ', 174.034, 118.205, 107.282], ['C', ' HA ', 174.815, 119.502, 108.131]]
[['C', ' N ', 176.044, 116.502, 108.471], ['C', ' CA ', 177.298, 115.818, 108.359], ['C', ' C ', 177.247, 114.956, 107.106], ['C', ' O ', 176.467, 114.018, 107.021], ['C', ' CB ', 177.465, 114.956, 109.6], ['C', ' CG1', 177.382, 115.849, 110.85], ['C', ' CG2', 178.792, 114.33, 109.55], ['C', ' CD1', 177.168, 115.099, 112.105], ['C', ' H ', 175.257, 116.022, 108.923], ['C', ' HA ', 178.113, 116.538, 108.275], ['C', ' HB ', 176.692, 114.203, 109.649], ['C', ' HG1', 178.306, 116.412, 110.946], ['C', ' HG1', 176.564, 116.548, 110.744], ['C', ' HG2', 178.977, 113.755, 110.411], ['C', ' HG2', 178.891, 113.698, 108.676], ['C', ' HG2', 179.488, 115.121, 109.516], ['C', ' HD1', 177.106, 115.779, 112.932], ['C', ' HD1', 176.229, 114.56, 112.021], ['C', ' HD1', 177.962, 114.408, 112.282]]
[['C', ' N ', 178.089, 115.254, 106.124], ['C', ' CA ', 178.036, 114.559, 104.842], ['C', ' C ', 179.001, 113.379, 104.77], ['C', ' O ', 179.159, 112.744, 103.726], ['C', ' CB ', 178.313, 115.541, 103.703], ['C', ' CG ', 177.263, 116.666, 103.572], ['C', ' CD ', 177.501, 117.589, 102.373], ['C', ' OE1', 178.271, 117.227, 101.515], ['C', ' OE2', 176.899, 118.645, 102.315], ['C', ' H ', 178.777, 116.012, 106.233], ['C', ' HA ', 177.026, 114.172, 104.71], ['C', ' HB ', 179.284, 116.014, 103.87], ['C', ' HB ', 178.367, 115.009, 102.758], ['C', ' HG ', 176.276, 116.213, 103.482], ['C', ' HG ', 177.274, 117.262, 104.489]]
[['C', ' N ', 179.715, 113.144, 105.849], ['C', ' CA ', 180.686, 112.066, 105.918], ['C', ' C ', 180.678, 111.393, 107.283], ['C', ' O ', 181.469, 111.743, 108.158], ['C', ' CB ', 182.081, 112.598, 105.652], ['C', ' CG ', 182.296, 113.214, 104.289], ['C', ' CD ', 183.717, 113.686, 104.149], ['C', ' CE ', 183.967, 114.335, 102.828], ['C', ' NZ ', 185.339, 114.902, 102.762], ['C', ' H ', 179.533, 113.725, 106.654], ['C', ' HA ', 180.426, 111.315, 105.173], ['C', ' HB ', 182.319, 113.34, 106.386], ['C', ' HB ', 182.803, 111.79, 105.768], ['C', ' HG ', 182.057, 112.493, 103.511], ['C', ' HG ', 181.646, 114.081, 104.176], ['C', ' HD ', 183.963, 114.39, 104.941], ['C', ' HD ', 184.383, 112.835, 104.237], ['C', ' HE ', 183.851, 113.593, 102.041], ['C', ' HE ', 183.242, 115.136, 102.672], ['C', ' HZ ', 185.487, 115.331, 101.865], ['C', ' HZ ', 185.437, 115.604, 103.49], ['C', ' HZ ', 186.023, 114.169, 102.905]]
[['C', ' N ', 179.761, 110.485, 107.515], ['C', ' CA ', 179.657, 109.878, 108.823], ['C', ' C ', 180.461, 108.649, 109.062], ['C', ' O ', 180.671, 107.795, 108.179], ['C', ' CB ', 178.21, 109.516, 109.157], ['C', ' CG ', 177.274, 110.648, 109.324], ['C', ' CD1', 175.905, 110.149, 109.393], ['C', ' CD2', 177.567, 111.328, 110.641], ['C', ' H ', 179.107, 110.224, 106.79], ['C', ' HA ', 180.01, 110.607, 109.532], ['C', ' HB ', 177.824, 108.887, 108.358], ['C', ' HB ', 178.207, 108.932, 110.082], ['C', ' HG ', 177.379, 111.347, 108.487], ['C', ' HD1', 175.247, 110.99, 109.529], ['C', ' HD1', 175.66, 109.628, 108.465], ['C', ' HD1', 175.809, 109.48, 110.223], ['C', ' HD2', 176.894, 112.153, 110.767], ['C', ' HD2', 177.443, 110.623, 111.461], ['C', ' HD2', 178.556, 111.686, 110.659]]
[['C', ' N ', 180.861, 108.541, 110.311], ['C', ' CA ', 181.463, 107.333, 110.777], ['C', ' C ', 180.573, 106.74, 111.857], ['C', ' O ', 179.611, 107.373, 112.307], ['C', ' H ', 180.735, 109.34, 110.943], ['C', ' HA ', 181.561, 106.633, 109.955], ['C', ' HA ', 182.459, 107.531, 111.156]]
[['C', ' N ', 180.882, 105.52, 112.234], ['C', ' CA ', 180.188, 104.799, 113.305], ['C', ' C ', 181.016, 103.586, 113.679], ['C', ' O ', 181.808, 103.182, 112.851], ['C', ' CB ', 178.762, 104.412, 112.919], ['C', ' OG1', 178.131, 103.864, 114.07], ['C', ' CG2', 178.756, 103.397, 111.782], ['C', ' H ', 181.649, 105.077, 111.72], ['C', ' HA ', 180.126, 105.442, 114.186], ['C', ' HB ', 178.214, 105.3, 112.612], ['C', ' HG1', 178.1, 104.578, 114.783], ['C', ' HG2', 177.733, 103.147, 111.543], ['C', ' HG2', 179.242, 103.829, 110.905], ['C', ' HG2', 179.286, 102.498, 112.08]]
[['C', ' N ', 180.807, 102.981, 114.856], ['C', ' CA ', 181.037, 101.979, 115.896], ['C', ' C ', 179.926, 100.94, 116.042], ['C', ' O ', 179.689, 100.434, 117.132], ['C', ' CB ', 181.239, 102.652, 117.249], ['C', ' CG1', 182.478, 103.493, 117.203], ['C', ' CG2', 180.047, 103.468, 117.585], ['C', ' H ', 181.459, 102.321, 114.421], ['C', ' HA ', 181.961, 101.458, 115.664], ['C', ' HB ', 181.385, 101.899, 118.002], ['C', ' HG1', 182.649, 103.964, 118.172], ['C', ' HG1', 183.325, 102.873, 116.947], ['C', ' HG1', 182.35, 104.255, 116.45], ['C', ' HG2', 180.211, 103.932, 118.55], ['C', ' HG2', 179.909, 104.23, 116.82], ['C', ' HG2', 179.154, 102.849, 117.635]]
[['C', ' N ', 179.231, 100.654, 114.964], ['C', ' CA ', 178.15, 99.676, 114.979], ['C', ' C ', 178.605, 98.257, 115.363], ['C', ' O ', 179.678, 97.791, 114.995], ['C', ' CB ', 177.493, 99.631, 113.615], ['C', ' H ', 179.462, 101.14, 114.11], ['C', ' HA ', 177.417, 99.998, 115.719], ['C', ' HB ', 176.678, 98.943, 113.621], ['C', ' HB ', 177.13, 100.621, 113.351], ['C', ' HB ', 178.212, 99.311, 112.901]]
[['C', ' N ', 177.751, 97.568, 116.084], ['C', ' CA ', 177.973, 96.174, 116.469], ['C', ' C ', 177.569, 95.387, 115.195], ['C', ' O ', 176.814, 95.955, 114.416], ['C', ' CB ', 177.092, 95.928, 117.718], ['C', ' CG1', 177.466, 94.721, 118.469], ['C', ' CG2', 175.714, 95.804, 117.266], ['C', ' CD1', 176.907, 94.611, 119.843], ['C', ' H ', 176.884, 98.054, 116.376], ['C', ' HA ', 179.027, 96.008, 116.7], ['C', ' HB ', 177.177, 96.788, 118.386], ['C', ' HG1', 177.092, 93.872, 117.929], ['C', ' HG1', 178.56, 94.678, 118.548], ['C', ' HG2', 175.028, 95.684, 118.09], ['C', ' HG2', 175.466, 96.656, 116.744], ['C', ' HG2', 175.634, 94.97, 116.63], ['C', ' HD1', 177.246, 93.687, 120.301], ['C', ' HD1', 177.253, 95.451, 120.445], ['C', ' HD1', 175.837, 94.607, 119.81]]
[['C', ' N ', 177.984, 94.141, 114.869], ['C', ' CA ', 177.569, 93.452, 113.655], ['C', ' C ', 176.061, 93.381, 113.467], ['C', ' O ', 175.551, 93.601, 112.366], ['C', ' CB ', 178.145, 92.059, 113.871], ['C', ' CG ', 178.447, 91.999, 115.295], ['C', ' CD ', 178.881, 93.385, 115.634], ['C', ' HA ', 178.07, 93.901, 112.804], ['C', ' HB ', 177.404, 91.299, 113.586], ['C', ' HB ', 179.005, 91.885, 113.25], ['C', ' HG ', 177.556, 91.668, 115.835], ['C', ' HG ', 179.234, 91.231, 115.461], ['C', ' HD ', 178.838, 93.558, 116.643], ['C', ' HD ', 179.886, 93.535, 115.262]]
[['C', ' N ', 175.337, 93.313, 114.57], ['C', ' CA ', 173.884, 93.259, 114.587], ['C', ' C ', 173.273, 94.511, 113.93], ['C', ' O ', 172.103, 94.53, 113.552], ['C', ' CB ', 173.417, 93.247, 116.038], ['C', ' SG ', 174.192, 91.988, 117.078], ['C', ' H ', 175.826, 93.134, 115.436], ['C', ' HA ', 173.551, 92.363, 114.054], ['C', ' HB ', 173.561, 94.212, 116.484], ['C', ' HB ', 172.367, 93.067, 116.06], ['C', ' HG ', 173.387, 90.963, 116.724]]
[['C', ' N ', 174.072, 95.578, 113.88], ['C', ' CA ', 173.763, 96.89, 113.342], ['C', ' C ', 174.515, 97.166, 112.055], ['C', ' O ', 173.968, 97.751, 111.117], ['C', ' CB ', 174.123, 97.936, 114.374], ['C', ' CG ', 173.296, 97.88, 115.573], ['C', ' CD ', 173.793, 98.731, 116.666], ['C', ' OE1', 175.013, 99.046, 116.76], ['C', ' NE2', 172.876, 99.082, 117.554], ['C', ' H ', 175.025, 95.453, 114.214], ['C', ' HA ', 172.693, 96.943, 113.14], ['C', ' HB ', 175.131, 97.768, 114.692], ['C', ' HB ', 174.081, 98.911, 113.944], ['C', ' HG ', 172.334, 98.269, 115.298], ['C', ' HG ', 173.193, 96.858, 115.928], ['C', ' HE2', 173.131, 99.639, 118.365], ['C', ' HE2', 171.886, 98.773, 117.472]]
[['C', ' N ', 175.74, 96.654, 111.968], ['C', ' CA ', 176.615, 96.856, 110.818], ['C', ' C ', 175.902, 96.345, 109.613], ['C', ' O ', 175.883, 96.988, 108.558], ['C', ' CB ', 177.901, 96.048, 110.967], ['C', ' OG1', 178.632, 96.497, 112.115], ['C', ' CG2', 178.765, 96.137, 109.75], ['C', ' H ', 176.11, 96.17, 112.774], ['C', ' HA ', 176.827, 97.918, 110.7], ['C', ' HB ', 177.634, 95.022, 111.083], ['C', ' HG1', 178.102, 96.369, 112.922], ['C', ' HG2', 179.64, 95.524, 109.908], ['C', ' HG2', 178.236, 95.783, 108.885], ['C', ' HG2', 179.058, 97.134, 109.581]]
[['C', ' N ', 175.304, 95.174, 109.77], ['C', ' CA ', 174.575, 94.608, 108.678], ['C', ' C ', 173.379, 95.456, 108.367], ['C', ' O ', 173.014, 95.552, 107.213], ['C', ' CB ', 174.161, 93.183, 109.007], ['C', ' CG ', 173.108, 93.027, 110.106], ['C', ' SD ', 172.65, 91.304, 110.404], ['C', ' CE ', 174.13, 90.622, 111.158], ['C', ' H ', 175.402, 94.676, 110.661], ['C', ' HA ', 175.214, 94.608, 107.801], ['C', ' HB ', 173.812, 92.693, 108.12], ['C', ' HB ', 175.045, 92.655, 109.342], ['C', ' HG ', 173.473, 93.448, 111.036], ['C', ' HG ', 172.203, 93.557, 109.838], ['C', ' HE ', 173.974, 89.572, 111.407], ['C', ' HE ', 174.968, 90.694, 110.472], ['C', ' HE ', 174.372, 91.169, 112.065]]
[['C', ' N ', 172.801, 96.123, 109.352], ['C', ' CA ', 171.638, 96.944, 109.125], ['C', ' C ', 171.986, 98.089, 108.204], ['C', ' O ', 171.188, 98.483, 107.353], ['C', ' H ', 173.156, 96.053, 110.296], ['C', ' HA ', 170.832, 96.349, 108.705], ['C', ' HA ', 171.309, 97.333, 110.087]]
[['C', ' N ', 173.181, 98.618, 108.373], ['C', ' CA ', 173.615, 99.722, 107.557], ['C', ' C ', 173.826, 99.263, 106.142], ['C', ' O ', 173.363, 99.92, 105.215], ['C', ' CB ', 174.897, 100.348, 108.098], ['C', ' CG1', 174.583, 101.008, 109.447], ['C', ' CG2', 175.46, 101.358, 107.069], ['C', ' CD1', 175.797, 101.403, 110.245], ['C', ' H ', 173.761, 98.242, 109.13], ['C', ' HA ', 172.837, 100.484, 107.559], ['C', ' HB ', 175.632, 99.564, 108.281], ['C', ' HG1', 173.98, 101.895, 109.267], ['C', ' HG1', 173.997, 100.311, 110.047], ['C', ' HG2', 176.367, 101.809, 107.443], ['C', ' HG2', 175.691, 100.868, 106.126], ['C', ' HG2', 174.716, 102.134, 106.891], ['C', ' HD1', 175.485, 101.857, 111.182], ['C', ' HD1', 176.394, 100.519, 110.461], ['C', ' HD1', 176.397, 102.117, 109.695]]
[['C', ' N ', 174.506, 98.132, 105.969], ['C', ' CA ', 174.767, 97.644, 104.625], ['C', ' C ', 173.487, 97.214, 103.948], ['C', ' O ', 173.391, 97.199, 102.724], ['C', ' CB ', 175.718, 96.492, 104.614], ['C', ' CG ', 177.065, 96.772, 105.134], ['C', ' CD ', 177.669, 97.963, 104.597], ['C', ' NE ', 178.993, 98.066, 105.041], ['C', ' CZ ', 179.766, 99.144, 104.974], ['C', ' NH1', 179.353, 100.277, 104.444], ['C', ' NH2', 180.954, 99.018, 105.48], ['C', ' H ', 174.87, 97.639, 106.792], ['C', ' HA ', 175.185, 98.456, 104.038], ['C', ' HB ', 175.295, 95.668, 105.185], ['C', ' HB ', 175.842, 96.171, 103.602], ['C', ' HG ', 177.066, 96.825, 106.223], ['C', ' HG ', 177.696, 95.978, 104.802], ['C', ' HD ', 177.653, 97.962, 103.507], ['C', ' HD ', 177.144, 98.82, 104.993], ['C', ' HE ', 179.413, 97.236, 105.477], ['C', ' HH1', 178.403, 100.359, 104.053], ['C', ' HH1', 179.978, 101.074, 104.424], ['C', ' HH2', 181.179, 98.093, 105.879], ['C', ' HH2', 181.631, 99.808, 105.499]]
[['C', ' N ', 172.541, 96.764, 104.747], ['C', ' CA ', 171.222, 96.378, 104.312], ['C', ' C ', 170.379, 97.59, 103.857], ['C', ' O ', 169.538, 97.445, 102.965], ['C', ' CB ', 170.613, 95.497, 105.403], ['C', ' CG ', 171.264, 94.052, 105.409], ['C', ' CD ', 170.752, 93.101, 106.46], ['C', ' CE ', 171.434, 91.728, 106.301], ['C', ' NZ ', 170.919, 90.694, 107.259], ['C', ' H ', 172.743, 96.654, 105.743], ['C', ' HA ', 171.337, 95.749, 103.436], ['C', ' HB ', 170.82, 95.949, 106.352], ['C', ' HB ', 169.585, 95.46, 105.352], ['C', ' HG ', 171.046, 93.6, 104.482], ['C', ' HG ', 172.34, 94.118, 105.474], ['C', ' HD ', 171.026, 93.497, 107.433], ['C', ' HD ', 169.676, 93.001, 106.41], ['C', ' HE ', 171.297, 91.371, 105.286], ['C', ' HE ', 172.493, 91.86, 106.476], ['C', ' HZ ', 171.451, 89.81, 107.114], ['C', ' HZ ', 171.053, 91.007, 108.208], ['C', ' HZ ', 169.944, 90.517, 107.112]]
[['C', ' N ', 170.578, 98.778, 104.479], ['C', ' CA ', 169.9, 100.008, 104.03], ['C', ' C ', 170.597, 100.54, 102.789], ['C', ' O ', 169.997, 101.178, 101.929], ['C', ' CB ', 169.878, 101.065, 105.111], ['C', ' CG ', 168.995, 100.705, 106.264], ['C', ' SD ', 168.993, 101.887, 107.573], ['C', ' CE ', 168.047, 103.157, 106.814], ['C', ' H ', 171.209, 98.815, 105.281], ['C', ' HA ', 168.876, 99.763, 103.756], ['C', ' HB ', 170.892, 101.199, 105.5], ['C', ' HB ', 169.564, 102.0, 104.675], ['C', ' HG ', 167.979, 100.618, 105.902], ['C', ' HG ', 169.272, 99.742, 106.663], ['C', ' HE ', 167.878, 103.956, 107.483], ['C', ' HE ', 168.565, 103.539, 105.947], ['C', ' HE ', 167.11, 102.743, 106.53]]
[['C', ' N ', 171.881, 100.265, 102.694], ['C', ' CA ', 172.646, 100.593, 101.524], ['C', ' C ', 172.274, 99.441, 100.632], ['C', ' O ', 171.503, 98.595, 101.061], ['C', ' CB ', 174.146, 100.627, 101.805], ['C', ' CG ', 174.577, 101.702, 102.747], ['C', ' CD ', 176.055, 101.667, 103.075], ['C', ' OE1', 176.635, 100.626, 103.418], ['C', ' NE2', 176.677, 102.819, 102.96], ['C', ' H ', 172.346, 99.819, 103.488], ['C', ' HA ', 172.303, 101.523, 101.082], ['C', ' HB ', 174.45, 99.674, 102.213], ['C', ' HB ', 174.688, 100.767, 100.876], ['C', ' HG ', 174.391, 102.638, 102.262], ['C', ' HG ', 174.009, 101.654, 103.663], ['C', ' HE2', 177.655, 102.912, 103.143], ['C', ' HE2', 176.152, 103.644, 102.666]]
[['C', ' N ', 172.732, 99.407, 99.396], ['C', ' CA ', 172.413, 98.324, 98.446], ['C', ' C ', 170.943, 98.435, 97.994], ['C', ' O ', 170.694, 98.68, 96.816], ['C', ' CB ', 172.68, 96.911, 99.033], ['C', ' OG1', 174.031, 96.828, 99.491], ['C', ' CG2', 172.539, 95.881, 97.897], ['C', ' H ', 173.35, 100.14, 99.091], ['C', ' HA ', 173.044, 98.437, 97.563], ['C', ' HB ', 171.989, 96.656, 99.829], ['C', ' HG1', 174.088, 97.265, 100.359], ['C', ' HG2', 172.749, 94.885, 98.278], ['C', ' HG2', 171.545, 95.908, 97.492], ['C', ' HG2', 173.246, 96.119, 97.106]]
[['C', ' N ', 169.998, 98.36, 98.935], ['C', ' CA ', 168.567, 98.515, 98.707], ['C', ' C ', 167.937, 99.63, 99.532], ['C', ' O ', 167.128, 99.358, 100.426], ['C', ' CB ', 167.826, 97.257, 99.076], ['C', ' CG ', 168.159, 96.143, 98.294], ['C', ' CD1', 169.091, 95.264, 98.722], ['C', ' CD2', 167.509, 95.972, 97.118], ['C', ' CE1', 169.387, 94.208, 97.95], ['C', ' CE2', 167.792, 94.919, 96.357], ['C', ' CZ ', 168.733, 94.038, 96.762], ['C', ' OH ', 169.031, 92.987, 95.986], ['C', ' H ', 170.319, 98.144, 99.873], ['C', ' HA ', 168.402, 98.708, 97.652], ['C', ' HB ', 168.023, 97.013, 100.123], ['C', ' HB ', 166.774, 97.428, 98.98], ['C', ' HD1', 169.603, 95.418, 99.674], ['C', ' HD2', 166.758, 96.693, 96.795], ['C', ' HE1', 170.143, 93.507, 98.266], ['C', ' HE2', 167.273, 94.781, 95.411], ['C', ' HH ', 168.471, 93.019, 95.185]]
[['C', ' N ', 168.196, 100.898, 99.212], ['C', ' CA ', 167.748, 102.054, 99.947], ['C', ' C ', 166.291, 102.432, 99.726], ['C', ' O ', 165.98, 103.571, 99.346], ['C', ' CB ', 168.694, 103.121, 99.394], ['C', ' CG ', 168.969, 102.702, 98.001], ['C', ' CD ', 169.079, 101.223, 98.087], ['C', ' HA ', 167.924, 101.886, 101.018], ['C', ' HB ', 168.25, 104.12, 99.44], ['C', ' HB ', 169.594, 103.144, 100.004], ['C', ' HG ', 168.167, 103.035, 97.334], ['C', ' HG ', 169.895, 103.181, 97.642], ['C', ' HD ', 168.778, 100.772, 97.146], ['C', ' HD ', 170.111, 100.993, 98.347]]
[['C', ' N ', 165.385, 101.526, 100.065], ['C', ' CA ', 163.984, 101.827, 99.859], ['C', ' C ', 163.547, 102.719, 100.976], ['C', ' O ', 163.641, 102.344, 102.143], ['C', ' CB ', 163.078, 100.596, 99.982], ['C', ' CG ', 163.176, 99.548, 98.989], ['C', ' CD1', 163.961, 98.453, 99.222], ['C', ' CD2', 162.459, 99.611, 97.823], ['C', ' CE1', 164.032, 97.451, 98.304], ['C', ' CE2', 162.553, 98.596, 96.899], ['C', ' CZ ', 163.339, 97.523, 97.15], ['C', ' H ', 165.706, 100.623, 100.408], ['C', ' HA ', 163.846, 102.329, 98.903], ['C', ' HB ', 163.21, 100.143, 100.962], ['C', ' HB ', 162.059, 100.951, 99.933], ['C', ' HD1', 164.532, 98.378, 100.157], ['C', ' HD2', 161.812, 100.48, 97.625], ['C', ' HE1', 164.642, 96.598, 98.489], ['C', ' HE2', 162.004, 98.643, 95.97], ['C', ' HZ ', 163.41, 96.722, 96.425]]
[['C', ' N ', 163.118, 103.912, 100.62], ['C', ' CA ', 162.655, 104.892, 101.585], ['C', ' C ', 163.73, 105.509, 102.487], ['C', ' O ', 163.4, 105.958, 103.579], ['C', ' H ', 163.066, 104.1, 99.635], ['C', ' HA ', 162.135, 105.691, 101.051], ['C', ' HA ', 161.908, 104.421, 102.213]]
[['C', ' N ', 165.002, 105.55, 102.085], ['C', ' CA ', 165.99, 106.103, 103.027], ['C', ' C ', 166.666, 107.351, 102.478], ['C', ' O ', 167.763, 107.707, 102.91], ['C', ' CB ', 167.048, 105.055, 103.37], ['C', ' CG1', 166.343, 103.864, 103.992], ['C', ' CG2', 167.823, 104.69, 102.197], ['C', ' H ', 165.289, 105.177, 101.173], ['C', ' HA ', 165.484, 106.379, 103.952], ['C', ' HB ', 167.722, 105.456, 104.124], ['C', ' HG1', 167.065, 103.11, 104.249], ['C', ' HG1', 165.799, 104.187, 104.874], ['C', ' HG1', 165.646, 103.434, 103.279], ['C', ' HG2', 168.563, 103.936, 102.467], ['C', ' HG2', 167.147, 104.301, 101.49], ['C', ' HG2', 168.338, 105.55, 101.772]]
[['C', ' N ', 166.049, 107.963, 101.485], ['C', ' CA ', 166.586, 109.147, 100.829], ['C', ' C ', 168.033, 108.953, 100.417], ['C', ' O ', 168.335, 108.042, 99.66], ['C', ' CB ', 166.441, 110.356, 101.722], ['C', ' CG ', 165.009, 110.73, 102.069], ['C', ' CD ', 164.269, 111.233, 100.921], ['C', ' NE ', 164.884, 112.454, 100.41], ['C', ' CZ ', 164.78, 112.891, 99.158], ['C', ' NH1', 164.106, 112.224, 98.277], ['C', ' NH2', 165.352, 114.003, 98.77], ['C', ' H ', 165.139, 107.602, 101.234], ['C', ' HA ', 166.024, 109.32, 99.917], ['C', ' HB ', 166.962, 110.184, 102.664], ['C', ' HB ', 166.893, 111.223, 101.242], ['C', ' HG ', 164.481, 109.872, 102.491], ['C', ' HG ', 165.027, 111.518, 102.776], ['C', ' HD ', 164.209, 110.496, 100.135], ['C', ' HD ', 163.256, 111.478, 101.252], ['C', ' HE ', 165.423, 113.026, 101.052], ['C', ' HH1', 163.63, 111.374, 98.514], ['C', ' HH1', 164.064, 112.607, 97.323], ['C', ' HH2', 165.912, 114.598, 99.423], ['C', ' HH2', 165.212, 114.265, 97.788]]
[['C', ' N ', 168.932, 109.799, 100.905], ['C', ' CA ', 170.326, 109.718, 100.504], ['C', ' C ', 171.22, 109.159, 101.59], ['C', ' O ', 172.44, 109.204, 101.461], ['C', ' CB ', 170.84, 111.097, 100.125], ['C', ' CG ', 170.102, 111.724, 98.992], ['C', ' CD1', 169.271, 112.81, 99.21], ['C', ' CD2', 170.228, 111.237, 97.706], ['C', ' CE1', 168.6, 113.396, 98.167], ['C', ' CE2', 169.552, 111.822, 96.66], ['C', ' CZ ', 168.739, 112.904, 96.889], ['C', ' H ', 168.654, 110.52, 101.548], ['C', ' HA ', 170.401, 109.06, 99.634], ['C', ' HB ', 170.777, 111.76, 100.986], ['C', ' HB ', 171.891, 111.023, 99.843], ['C', ' HD1', 169.156, 113.215, 100.218], ['C', ' HD2', 170.881, 110.375, 97.519], ['C', ' HE1', 167.964, 114.259, 98.36], ['C', ' HE2', 169.666, 111.431, 95.645], ['C', ' HZ ', 168.208, 113.37, 96.054]]
[['C', ' N ', 170.627, 108.563, 102.623], ['C', ' CA ', 171.35, 108.061, 103.798], ['C', ' C ', 172.205, 106.85, 103.528], ['C', ' O ', 172.953, 106.419, 104.398], ['C', ' CB ', 170.359, 107.678, 104.894], ['C', ' CG ', 169.55, 108.803, 105.531], ['C', ' CD1', 168.466, 108.192, 106.45], ['C', ' CD2', 170.496, 109.71, 106.328], ['C', ' H ', 169.604, 108.472, 102.618], ['C', ' HA ', 172.02, 108.845, 104.14], ['C', ' HB ', 169.659, 106.957, 104.48], ['C', ' HB ', 170.92, 107.195, 105.679], ['C', ' HG ', 169.046, 109.382, 104.757], ['C', ' HD1', 167.883, 108.972, 106.899], ['C', ' HD1', 167.807, 107.552, 105.855], ['C', ' HD1', 168.914, 107.62, 107.223], ['C', ' HD2', 169.936, 110.501, 106.787], ['C', ' HD2', 171.002, 109.133, 107.105], ['C', ' HD2', 171.234, 110.15, 105.679]]
[['C', ' N ', 172.031, 106.236, 102.365], ['C', ' CA ', 172.882, 105.135, 101.968], ['C', ' C ', 174.29, 105.691, 101.77], ['C', ' O ', 175.301, 105.025, 101.985], ['C', ' CB ', 172.365, 104.492, 100.702], ['C', ' H ', 171.346, 106.603, 101.72], ['C', ' HA ', 172.907, 104.404, 102.774], ['C', ' HB ', 173.017, 103.678, 100.409], ['C', ' HB ', 171.372, 104.118, 100.889], ['C', ' HB ', 172.332, 105.236, 99.898]]
[['C', ' N ', 174.369, 106.927, 101.305], ['C', ' CA ', 175.637, 107.578, 101.112], ['C', ' C ', 175.91, 108.34, 102.376], ['C', ' O ', 175.12, 108.328, 103.312], ['C', ' CB ', 175.63, 108.535, 99.909], ['C', ' CG ', 177.077, 109.017, 99.457], ['C', ' OD1', 178.077, 108.479, 99.966], ['C', ' OD2', 177.163, 109.948, 98.687], ['C', ' H ', 173.538, 107.494, 101.131], ['C', ' HA ', 176.417, 106.833, 100.973], ['C', ' HB ', 175.145, 108.041, 99.064], ['C', ' HB ', 175.024, 109.409, 100.155]]
[['C', ' N ', 177.024, 109.01, 102.392], ['C', ' CA ', 177.465, 109.842, 103.477], ['C', ' C ', 177.854, 109.008, 104.676], ['C', ' O ', 177.918, 109.512, 105.784], ['C', ' CB ', 176.359, 110.842, 103.904], ['C', ' CG ', 175.607, 111.58, 102.741], ['C', ' CD ', 176.56, 112.241, 101.753], ['C', ' CE ', 175.838, 112.991, 100.656], ['C', ' NZ ', 176.777, 113.34, 99.53], ['C', ' H ', 177.624, 108.893, 101.581], ['C', ' HA ', 178.345, 110.396, 103.158], ['C', ' HB ', 175.62, 110.342, 104.524], ['C', ' HB ', 176.798, 111.606, 104.529], ['C', ' HG ', 174.942, 110.9, 102.217], ['C', ' HG ', 174.994, 112.359, 103.186], ['C', ' HD ', 177.182, 112.943, 102.277], ['C', ' HD ', 177.199, 111.501, 101.284], ['C', ' HE ', 175.023, 112.379, 100.266], ['C', ' HE ', 175.428, 113.912, 101.07], ['C', ' HZ ', 176.284, 113.843, 98.81], ['C', ' HZ ', 177.551, 113.905, 99.87], ['C', ' HZ ', 177.146, 112.461, 99.141]]
[['C', ' N ', 178.112, 107.723, 104.469], ['C', ' CA ', 178.648, 106.875, 105.505], ['C', ' C ', 179.97, 106.482, 104.925], ['C', ' O ', 180.014, 105.801, 103.904], ['C', ' CB ', 177.773, 105.649, 105.787], ['C', ' CG1', 176.36, 106.134, 106.19], ['C', ' CG2', 178.441, 104.795, 106.913], ['C', ' CD1', 175.316, 105.052, 106.288], ['C', ' H ', 177.981, 107.334, 103.546], ['C', ' HA ', 178.807, 107.436, 106.424], ['C', ' HB ', 177.669, 105.055, 104.88], ['C', ' HG1', 176.425, 106.652, 107.145], ['C', ' HG1', 176.005, 106.844, 105.436], ['C', ' HG2', 177.844, 103.918, 107.128], ['C', ' HG2', 179.434, 104.47, 106.59], ['C', ' HG2', 178.54, 105.4, 107.821], ['C', ' HD1', 174.358, 105.504, 106.555], ['C', ' HD1', 175.216, 104.551, 105.319], ['C', ' HD1', 175.592, 104.337, 107.043]]
[['C', ' N ', 181.044, 106.952, 105.511], ['C', ' CA ', 182.325, 106.706, 104.886], ['C', ' C ', 183.15, 105.709, 105.669], ['C', ' O ', 184.023, 105.059, 105.105], ['C', ' CB ', 183.079, 108.012, 104.668], ['C', ' CG ', 182.323, 109.08, 103.81], ['C', ' CD ', 181.948, 108.629, 102.363], ['C', ' CE ', 181.396, 109.845, 101.547], ['C', ' NZ ', 180.859, 109.49, 100.129], ['C', ' H ', 180.944, 107.463, 106.388], ['C', ' HA ', 182.161, 106.259, 103.909], ['C', ' HB ', 183.287, 108.462, 105.622], ['C', ' HB ', 184.035, 107.807, 104.189], ['C', ' HG ', 181.401, 109.333, 104.326], ['C', ' HG ', 182.935, 109.981, 103.753], ['C', ' HD ', 182.823, 108.217, 101.86], ['C', ' HD ', 181.173, 107.862, 102.403], ['C', ' HE ', 180.6, 110.328, 102.115], ['C', ' HE ', 182.218, 110.55, 101.431], ['C', ' HZ ', 180.558, 110.34, 99.677], ['C', ' HZ ', 181.588, 109.065, 99.581], ['C', ' HZ ', 180.03, 108.855, 100.137]]
[['C', ' N ', 182.921, 105.615, 106.977], ['C', ' CA ', 183.71, 104.653, 107.73], ['C', ' C ', 182.923, 103.928, 108.776], ['C', ' O ', 182.584, 104.484, 109.831], ['C', ' CB ', 184.883, 105.352, 108.413], ['C', ' CG ', 185.78, 104.497, 109.299], ['C', ' CD1', 186.452, 103.387, 108.47], ['C', ' CD2', 186.812, 105.421, 109.971], ['C', ' H ', 182.204, 106.189, 107.417], ['C', ' HA ', 184.087, 103.911, 107.029], ['C', ' HB ', 185.505, 105.817, 107.647], ['C', ' HB ', 184.477, 106.13, 109.053], ['C', ' HG ', 185.192, 104.018, 110.056], ['C', ' HD1', 187.09, 102.794, 109.12], ['C', ' HD1', 185.711, 102.737, 108.026], ['C', ' HD1', 187.051, 103.832, 107.679], ['C', ' HD2', 187.463, 104.837, 110.625], ['C', ' HD2', 187.406, 105.911, 109.205], ['C', ' HD2', 186.293, 106.177, 110.562]]
[['C', ' N ', 182.72, 102.64, 108.535], ['C', ' CA ', 181.972, 101.844, 109.469], ['C', ' C ', 182.985, 100.983, 110.213], ['C', ' O ', 183.604, 100.066, 109.642], ['C', ' CB ', 180.96, 100.973, 108.718], ['C', ' CG ', 179.754, 100.398, 109.506], ['C', ' CD1', 178.82, 99.747, 108.493], ['C', ' CD2', 180.191, 99.429, 110.585], ['C', ' H ', 183.023, 102.213, 107.646], ['C', ' HA ', 181.461, 102.485, 110.183], ['C', ' HB ', 180.564, 101.565, 107.894], ['C', ' HB ', 181.498, 100.132, 108.28], ['C', ' HG ', 179.199, 101.205, 109.966], ['C', ' HD1', 177.942, 99.353, 108.996], ['C', ' HD1', 178.51, 100.481, 107.752], ['C', ' HD1', 179.339, 98.933, 107.996], ['C', ' HD2', 179.324, 99.043, 111.077], ['C', ' HD2', 180.738, 98.619, 110.157], ['C', ' HD2', 180.805, 99.915, 111.32]]
[['C', ' N ', 183.161, 101.299, 111.48], ['C', ' CA ', 184.071, 100.602, 112.342], ['C', ' C ', 183.174, 99.673, 113.117], ['C', ' O ', 182.262, 100.127, 113.8], ['C', ' CB ', 184.761, 101.558, 113.338], ['C', ' CG1', 185.72, 100.772, 114.207], ['C', ' CG2', 185.438, 102.692, 112.606], ['C', ' H ', 182.638, 102.06, 111.871], ['C', ' HA ', 184.789, 100.056, 111.762], ['C', ' HB ', 184.014, 101.983, 114.002], ['C', ' HG1', 186.182, 101.444, 114.916], ['C', ' HG1', 185.182, 99.989, 114.745], ['C', ' HG1', 186.492, 100.318, 113.598], ['C', ' HG2', 185.907, 103.367, 113.323], ['C', ' HG2', 186.192, 102.303, 111.932], ['C', ' HG2', 184.685, 103.231, 112.045]]
[['C', ' N ', 183.381, 98.379, 112.959], ['C', ' CA ', 182.526, 97.405, 113.603], ['C', ' C ', 183.09, 96.957, 114.941], ['C', ' O ', 184.307, 96.963, 115.136], ['C', ' H ', 184.163, 98.102, 112.381], ['C', ' HA ', 181.546, 97.838, 113.727], ['C', ' HA ', 182.404, 96.55, 112.949]]
[['C', ' N ', 182.228, 96.503, 115.835], ['C', ' CA ', 182.669, 95.973, 117.13], ['C', ' C ', 182.222, 94.534, 117.327], ['C', ' O ', 181.049, 94.235, 117.214], ['C', ' CB ', 182.18, 96.868, 118.279], ['C', ' CG1', 182.784, 98.273, 118.075], ['C', ' CG2', 182.571, 96.266, 119.638], ['C', ' CD1', 182.303, 99.34, 119.016], ['C', ' H ', 181.231, 96.597, 115.608], ['C', ' HA ', 183.757, 95.977, 117.155], ['C', ' HB ', 181.097, 96.965, 118.225], ['C', ' HG1', 183.862, 98.187, 118.143], ['C', ' HG1', 182.528, 98.619, 117.077], ['C', ' HG2', 182.22, 96.896, 120.446], ['C', ' HG2', 182.118, 95.277, 119.756], ['C', ' HG2', 183.658, 96.172, 119.697], ['C', ' HD1', 182.79, 100.275, 118.758], ['C', ' HD1', 181.22, 99.452, 118.918], ['C', ' HD1', 182.548, 99.091, 120.041]]
[['C', ' N ', 183.125, 93.639, 117.69], ['C', ' CA ', 182.753, 92.222, 117.819], ['C', ' C ', 181.637, 92.008, 118.843], ['C', ' O ', 181.645, 92.593, 119.931], ['C', ' CB ', 183.945, 91.379, 118.243], ['C', ' CG ', 185.129, 91.344, 117.286], ['C', ' CD1', 185.08, 91.899, 116.021], ['C', ' CD2', 186.295, 90.78, 117.723], ['C', ' CE1', 186.195, 91.891, 115.25], ['C', ' CE2', 187.398, 90.788, 116.941], ['C', ' CZ ', 187.344, 91.343, 115.718], ['C', ' OH ', 188.44, 91.385, 114.948], ['C', ' H ', 184.099, 93.935, 117.802], ['C', ' HA ', 182.377, 91.874, 116.86], ['C', ' HB ', 184.302, 91.722, 119.211], ['C', ' HB ', 183.593, 90.379, 118.37], ['C', ' HD1', 184.18, 92.359, 115.635], ['C', ' HD2', 186.344, 90.344, 118.721], ['C', ' HE1', 186.177, 92.338, 114.269], ['C', ' HE2', 188.329, 90.355, 117.308], ['C', ' HH ', 189.203, 91.133, 115.467]]
[['C', ' N ', 180.675, 91.152, 118.489], ['C', ' CA ', 179.515, 90.886, 119.346], ['C', ' C ', 179.354, 89.483, 119.798], ['C', ' O ', 179.074, 88.602, 118.997], ['C', ' CB ', 178.224, 91.158, 118.596], ['C', ' SG ', 176.647, 90.884, 119.513], ['C', ' H ', 180.782, 90.677, 117.584], ['C', ' HA ', 179.582, 91.533, 120.218], ['C', ' HB ', 178.251, 92.131, 118.259], ['C', ' HB ', 178.2, 90.514, 117.729], ['C', ' HG ', 175.831, 91.176, 118.493]]
[['C', ' N ', 179.449, 89.265, 121.084], ['C', ' CA ', 179.184, 87.919, 121.523], ['C', ' C ', 177.692, 87.795, 121.719], ['C', ' O ', 177.055, 86.864, 121.215], ['C', ' CB ', 179.902, 87.575, 122.818], ['C', ' CG ', 179.712, 86.125, 123.21], ['C', ' SD ', 180.36, 84.982, 121.966], ['C', ' CE ', 182.096, 84.986, 122.307], ['C', ' H ', 179.691, 90.028, 121.7], ['C', ' HA ', 179.481, 87.218, 120.748], ['C', ' HB ', 180.955, 87.799, 122.753], ['C', ' HB ', 179.49, 88.178, 123.628], ['C', ' HG ', 180.216, 85.934, 124.156], ['C', ' HG ', 178.646, 85.914, 123.35], ['C', ' HE ', 182.587, 84.335, 121.599], ['C', ' HE ', 182.494, 85.985, 122.218], ['C', ' HE ', 182.272, 84.621, 123.32]]
[['C', ' N ', 177.14, 88.773, 122.44], ['C', ' CA ', 175.732, 88.84, 122.781], ['C', ' C ', 175.454, 90.09, 123.609], ['C', ' O ', 176.199, 90.372, 124.545], ['C', ' CB ', 175.342, 87.577, 123.56], ['C', ' CG ', 176.096, 87.371, 124.901], ['C', ' CD ', 175.835, 86.009, 125.515], ['C', ' OE1', 175.195, 85.236, 124.86], ['C', ' OE2', 176.342, 85.716, 126.586], ['C', ' H ', 177.737, 89.508, 122.78], ['C', ' HA ', 175.148, 88.896, 121.86], ['C', ' HB ', 174.298, 87.641, 123.799], ['C', ' HB ', 175.46, 86.689, 122.958], ['C', ' HG ', 177.164, 87.504, 124.754], ['C', ' HG ', 175.758, 88.126, 125.596]]
[['C', ' N ', 174.389, 90.835, 123.301], ['C', ' CA ', 174.016, 91.949, 124.18], ['C', ' C ', 172.936, 91.559, 125.145], ['C', ' O ', 172.074, 90.719, 124.848], ['C', ' CB ', 173.584, 93.197, 123.463], ['C', ' CG ', 174.626, 93.985, 122.924], ['C', ' OD1', 175.762, 93.959, 123.409], ['C', ' ND2', 174.284, 94.759, 121.943], ['C', ' H ', 173.821, 90.597, 122.501], ['C', ' HA ', 174.882, 92.215, 124.791], ['C', ' HB ', 172.966, 92.908, 122.638], ['C', ' HB ', 172.993, 93.822, 124.135], ['C', ' HD2', 174.957, 95.378, 121.544], ['C', ' HD2', 173.34, 94.756, 121.604]]
[['C', ' N ', 172.938, 92.235, 126.279], ['C', ' CA ', 171.984, 91.99, 127.325], ['C', ' C ', 171.047, 93.159, 127.46], ['C', ' O ', 171.508, 94.285, 127.514], ['C', ' CB ', 172.749, 91.83, 128.613], ['C', ' CG ', 173.583, 90.673, 128.583], ['C', ' CD1', 174.896, 90.774, 128.205], ['C', ' CD2', 173.07, 89.461, 128.892], ['C', ' CE1', 175.673, 89.666, 128.15], ['C', ' CE2', 173.835, 88.349, 128.834], ['C', ' CZ ', 175.14, 88.452, 128.463], ['C', ' H ', 173.671, 92.94, 126.436], ['C', ' HA ', 171.466, 91.069, 127.107], ['C', ' HB ', 173.385, 92.701, 128.748], ['C', ' HB ', 172.094, 91.767, 129.453], ['C', ' HD1', 175.311, 91.755, 127.94], ['C', ' HD2', 172.032, 89.391, 129.182], ['C', ' HE1', 176.717, 89.744, 127.842], ['C', ' HE2', 173.413, 87.368, 129.075], ['C', ' HZ ', 175.762, 87.553, 128.403]]
[['C', ' N ', 169.748, 92.984, 127.517], ['C', ' CA ', 168.84, 94.061, 127.735], ['C', ' C ', 169.22, 94.718, 129.029], ['C', ' O ', 169.597, 94.02, 129.981], ['C', ' CB ', 167.494, 93.358, 127.812], ['C', ' CG ', 167.695, 92.092, 127.032], ['C', ' CD ', 169.123, 91.693, 127.295], ['C', ' HA ', 168.871, 94.775, 126.902], ['C', ' HB ', 167.22, 93.185, 128.87], ['C', ' HB ', 166.71, 94.001, 127.381], ['C', ' HG ', 166.976, 91.324, 127.357], ['C', ' HG ', 167.496, 92.283, 125.965], ['C', ' HD ', 169.203, 91.051, 128.179], ['C', ' HD ', 169.494, 91.21, 126.391]]
[['C', ' N ', 169.101, 96.023, 129.097], ['C', ' CA ', 169.377, 96.69, 130.341], ['C', ' C ', 168.287, 96.063, 131.176], ['C', ' O ', 167.186, 95.886, 130.663], ['C', ' CB ', 169.26, 98.194, 130.209], ['C', ' CG ', 169.781, 98.945, 131.369], ['C', ' CD1', 171.141, 99.16, 131.462], ['C', ' CD2', 168.942, 99.429, 132.325], ['C', ' CE1', 171.651, 99.869, 132.501], ['C', ' CE2', 169.456, 100.136, 133.368], ['C', ' CZ ', 170.806, 100.364, 133.455], ['C', ' OH ', 171.313, 101.088, 134.502], ['C', ' H ', 168.81, 96.561, 128.288], ['C', ' HA ', 170.355, 96.406, 130.731], ['C', ' HB ', 169.8, 98.523, 129.32], ['C', ' HB ', 168.215, 98.465, 130.072], ['C', ' HD1', 171.809, 98.772, 130.698], ['C', ' HD2', 167.867, 99.258, 132.255], ['C', ' HE1', 172.722, 100.048, 132.57], ['C', ' HE2', 168.789, 100.535, 134.13], ['C', ' HH ', 172.117, 101.573, 134.208]]
[['C', ' N ', 168.572, 95.732, 132.426], ['C', ' CA ', 167.719, 94.923, 133.323], ['C', ' C ', 168.403, 93.567, 133.474], ['C', ' O ', 168.519, 93.064, 134.598], ['C', ' CB ', 166.276, 94.625, 132.822], ['C', ' OG1', 165.568, 95.828, 132.594], ['C', ' CG2', 165.527, 93.828, 133.881], ['C', ' H ', 169.472, 96.013, 132.768], ['C', ' HA ', 167.658, 95.399, 134.298], ['C', ' HB ', 166.303, 94.03, 131.905], ['C', ' HG1', 165.946, 96.2, 131.785], ['C', ' HG2', 164.518, 93.628, 133.526], ['C', ' HG2', 166.025, 92.882, 134.076], ['C', ' HG2', 165.481, 94.408, 134.801]]
[['C', ' N ', 168.839, 92.937, 132.376], ['C', ' CA ', 169.591, 91.702, 132.534], ['C', ' C ', 170.923, 92.062, 133.126], ['C', ' O ', 171.393, 91.414, 134.063], ['C', ' CB ', 169.829, 90.976, 131.23], ['C', ' OG ', 168.675, 90.374, 130.7], ['C', ' H ', 168.736, 93.339, 131.445], ['C', ' HA ', 169.062, 91.04, 133.22], ['C', ' HB ', 170.189, 91.687, 130.517], ['C', ' HB ', 170.605, 90.276, 131.373], ['C', ' HG ', 168.994, 89.788, 129.949]]
[['C', ' N ', 171.496, 93.169, 132.653], ['C', ' CA ', 172.783, 93.549, 133.213], ['C', ' C ', 172.612, 93.901, 134.665], ['C', ' O ', 173.391, 93.487, 135.511], ['C', ' CB ', 173.38, 94.787, 132.538], ['C', ' CG ', 173.857, 94.694, 131.114], ['C', ' CD1', 174.268, 96.079, 130.688], ['C', ' CD2', 175.028, 93.726, 130.993], ['C', ' H ', 171.048, 93.648, 131.866], ['C', ' HA ', 173.464, 92.705, 133.15], ['C', ' HB ', 172.634, 95.576, 132.571], ['C', ' HB ', 174.214, 95.115, 133.117], ['C', ' HG ', 173.04, 94.364, 130.466], ['C', ' HD1', 174.612, 96.047, 129.66], ['C', ' HD1', 173.42, 96.756, 130.77], ['C', ' HD1', 175.079, 96.433, 131.327], ['C', ' HD2', 175.363, 93.689, 129.958], ['C', ' HD2', 175.846, 94.055, 131.628], ['C', ' HD2', 174.719, 92.748, 131.289]]
[['C', ' N ', 171.53, 94.583, 134.994], ['C', ' CA ', 171.346, 94.968, 136.374], ['C', ' C ', 171.162, 93.741, 137.227], ['C', ' O ', 171.749, 93.634, 138.295], ['C', ' CB ', 170.133, 95.864, 136.536], ['C', ' CG ', 170.274, 97.224, 135.959], ['C', ' CD ', 168.992, 97.97, 136.039], ['C', ' OE1', 167.95, 97.418, 135.7], ['C', ' NE2', 169.035, 99.201, 136.506], ['C', ' H ', 170.877, 94.852, 134.284], ['C', ' HA ', 172.234, 95.496, 136.718], ['C', ' HB ', 169.269, 95.382, 136.088], ['C', ' HB ', 169.921, 95.982, 137.599], ['C', ' HG ', 171.002, 97.757, 136.539], ['C', ' HG ', 170.59, 97.166, 134.92], ['C', ' HE2', 168.193, 99.74, 136.588], ['C', ' HE2', 169.908, 99.607, 136.778]]
[['C', ' N ', 170.442, 92.748, 136.733], ['C', ' CA ', 170.244, 91.559, 137.529], ['C', ' C ', 171.566, 90.891, 137.849], ['C', ' O ', 171.865, 90.605, 139.018], ['C', ' CB ', 169.364, 90.537, 136.783], ['C', ' OG1', 168.068, 91.106, 136.53], ['C', ' CG2', 169.206, 89.272, 137.634], ['C', ' H ', 169.945, 92.849, 135.85], ['C', ' HA ', 169.757, 91.838, 138.463], ['C', ' HB ', 169.827, 90.278, 135.83], ['C', ' HG1', 168.155, 91.826, 135.864], ['C', ' HG2', 168.579, 88.566, 137.109], ['C', ' HG2', 170.173, 88.812, 137.827], ['C', ' HG2', 168.736, 89.534, 138.587]]
[['C', ' N ', 172.428, 90.726, 136.859], ['C', ' CA ', 173.629, 90.023, 137.227], ['C', ' C ', 174.759, 90.914, 137.72], ['C', ' O ', 175.727, 90.426, 138.292], ['C', ' CB ', 174.049, 89.017, 136.172], ['C', ' CG ', 174.268, 89.464, 134.793], ['C', ' CD1', 175.413, 90.132, 134.432], ['C', ' CD2', 173.346, 89.132, 133.81], ['C', ' CE1', 175.621, 90.47, 133.135], ['C', ' CE2', 173.566, 89.475, 132.519], ['C', ' CZ ', 174.705, 90.141, 132.183], ['C', ' H ', 172.2, 91.005, 135.893], ['C', ' HA ', 173.37, 89.395, 138.066], ['C', ' HB ', 174.923, 88.543, 136.513], ['C', ' HB ', 173.287, 88.24, 136.133], ['C', ' HD1', 176.16, 90.383, 135.188], ['C', ' HD2', 172.438, 88.585, 134.079], ['C', ' HE1', 176.522, 90.995, 132.857], ['C', ' HE2', 172.845, 89.215, 131.756], ['C', ' HZ ', 174.888, 90.409, 131.15]]
[['C', ' N ', 174.628, 92.214, 137.62], ['C', ' CA ', 175.637, 93.052, 138.214], ['C', ' C ', 175.241, 93.401, 139.649], ['C', ' O ', 176.044, 93.227, 140.572], ['C', ' CB ', 175.87, 94.289, 137.361], ['C', ' CG1', 176.45, 93.812, 136.022], ['C', ' CG2', 176.755, 95.29, 138.065], ['C', ' CD1', 176.505, 94.845, 135.006], ['C', ' H ', 173.874, 92.638, 137.071], ['C', ' HA ', 176.573, 92.501, 138.249], ['C', ' HB ', 174.908, 94.758, 137.152], ['C', ' HG1', 177.444, 93.422, 136.182], ['C', ' HG1', 175.828, 93.008, 135.635], ['C', ' HG2', 176.899, 96.167, 137.456], ['C', ' HG2', 176.286, 95.596, 138.987], ['C', ' HG2', 177.714, 94.834, 138.28], ['C', ' HD1', 176.902, 94.439, 134.084], ['C', ' HD1', 175.513, 95.216, 134.842], ['C', ' HD1', 177.117, 95.618, 135.341]]
[['C', ' N ', 173.986, 93.797, 139.855], ['C', ' CA ', 173.523, 94.21, 141.161], ['C', ' C ', 173.058, 93.079, 142.081], ['C', ' O ', 173.09, 93.261, 143.297], ['C', ' CB ', 172.385, 95.189, 140.983], ['C', ' SG ', 172.891, 96.635, 140.065], ['C', ' H ', 173.338, 93.871, 139.08], ['C', ' HA ', 174.335, 94.725, 141.654], ['C', ' HB ', 171.546, 94.719, 140.481], ['C', ' HB ', 172.046, 95.514, 141.964], ['C', ' HG ', 174.171, 96.637, 140.533]]
[['C', ' N ', 172.624, 91.917, 141.557], ['C', ' CA ', 172.19, 90.863, 142.472], ['C', ' C ', 173.199, 89.724, 142.538], ['C', ' O ', 173.508, 89.239, 143.624], ['C', ' CB ', 170.815, 90.298, 142.084], ['C', ' CG ', 169.656, 91.299, 142.156], ['C', ' CD ', 168.307, 90.679, 141.792], ['C', ' OE1', 168.291, 89.535, 141.403], ['C', ' OE2', 167.307, 91.35, 141.913], ['C', ' H ', 172.558, 91.746, 140.553], ['C', ' HA ', 172.1, 91.282, 143.472], ['C', ' HB ', 170.848, 89.893, 141.083], ['C', ' HB ', 170.572, 89.472, 142.749], ['C', ' HG ', 169.604, 91.708, 143.164], ['C', ' HG ', 169.87, 92.12, 141.47]]
[['C', ' N ', 173.777, 89.333, 141.399], ['C', ' CA ', 174.742, 88.223, 141.446], ['C', ' C ', 176.072, 88.658, 142.06], ['C', ' O ', 176.702, 87.901, 142.796], ['C', ' CB ', 175.041, 87.654, 140.061], ['C', ' CG ', 173.917, 86.93, 139.325], ['C', ' CD ', 173.629, 85.569, 139.883], ['C', ' CE ', 172.628, 84.834, 138.996], ['C', ' NZ ', 172.356, 83.464, 139.49], ['C', ' H ', 173.456, 89.758, 140.527], ['C', ' HA ', 174.332, 87.435, 142.075], ['C', ' HB ', 175.414, 88.422, 139.431], ['C', ' HB ', 175.847, 86.935, 140.171], ['C', ' HG ', 173.004, 87.525, 139.397], ['C', ' HG ', 174.186, 86.827, 138.276], ['C', ' HD ', 174.553, 84.989, 139.938], ['C', ' HD ', 173.211, 85.658, 140.885], ['C', ' HE ', 171.693, 85.395, 138.968], ['C', ' HE ', 173.03, 84.768, 137.981], ['C', ' HZ ', 171.699, 83.008, 138.871], ['C', ' HZ ', 173.228, 82.953, 139.493], ['C', ' HZ ', 171.975, 83.5, 140.424]]
[['C', ' N ', 176.506, 89.876, 141.751], ['C', ' CA ', 177.763, 90.386, 142.281], ['C', ' C ', 177.547, 91.318, 143.465], ['C', ' O ', 178.451, 91.523, 144.274], ['C', ' CB ', 178.562, 91.065, 141.173], ['C', ' CG ', 178.923, 90.168, 139.985], ['C', ' CD1', 179.622, 90.997, 138.947], ['C', ' CD2', 179.813, 89.016, 140.435], ['C', ' H ', 175.966, 90.444, 141.11], ['C', ' HA ', 178.336, 89.552, 142.666], ['C', ' HB ', 178.001, 91.898, 140.794], ['C', ' HB ', 179.481, 91.44, 141.593], ['C', ' HG ', 178.009, 89.766, 139.539], ['C', ' HD1', 179.868, 90.379, 138.085], ['C', ' HD1', 178.956, 91.794, 138.642], ['C', ' HD1', 180.532, 91.417, 139.355], ['C', ' HD2', 180.046, 88.417, 139.595], ['C', ' HD2', 180.732, 89.398, 140.869], ['C', ' HD2', 179.31, 88.391, 141.159]]
[['C', ' N ', 176.346, 91.873, 143.584], ['C', ' CA ', 176.028, 92.789, 144.671], ['C', ' C ', 176.464, 94.244, 144.494], ['C', ' O ', 176.625, 94.957, 145.486], ['C', ' H ', 175.627, 91.644, 142.915], ['C', ' HA ', 174.951, 92.764, 144.834], ['C', ' HA ', 176.473, 92.402, 145.585]]
[['C', ' N ', 176.69, 94.706, 143.269], ['C', ' CA ', 177.128, 96.089, 143.126], ['C', ' C ', 176.181, 96.928, 142.278], ['C', ' O ', 175.821, 96.558, 141.168], ['C', ' CB ', 178.563, 96.134, 142.572], ['C', ' CG1', 178.661, 95.45, 141.235], ['C', ' CG2', 179.001, 97.556, 142.452], ['C', ' H ', 176.52, 94.117, 142.448], ['C', ' HA ', 177.159, 96.544, 144.114], ['C', ' HB ', 179.215, 95.604, 143.264], ['C', ' HG1', 179.685, 95.492, 140.891], ['C', ' HG1', 178.352, 94.41, 141.322], ['C', ' HG1', 178.038, 95.952, 140.521], ['C', ' HG2', 179.992, 97.614, 142.1], ['C', ' HG2', 178.37, 98.074, 141.755], ['C', ' HG2', 178.949, 98.033, 143.423]]
[['C', ' N ', 175.856, 98.108, 142.773], ['C', ' CA ', 174.974, 99.037, 142.081], ['C', ' C ', 175.598, 99.501, 140.762], ['C', ' O ', 176.813, 99.546, 140.611], ['C', ' CB ', 174.675, 100.21, 142.97], ['C', ' OG ', 174.047, 99.802, 144.148], ['C', ' H ', 176.194, 98.345, 143.695], ['C', ' HA ', 174.036, 98.532, 141.868], ['C', ' HB ', 175.574, 100.752, 143.194], ['C', ' HB ', 174.016, 100.873, 142.44], ['C', ' HG ', 173.854, 100.614, 144.635]]
[['C', ' N ', 174.776, 99.853, 139.78], ['C', ' CA ', 175.309, 100.217, 138.461], ['C', ' C ', 176.171, 101.471, 138.498], ['C', ' O ', 177.149, 101.591, 137.763], ['C', ' CB ', 174.162, 100.452, 137.487], ['C', ' CG ', 173.328, 99.221, 137.169], ['C', ' SD ', 174.213, 97.81, 136.466], ['C', ' CE ', 174.511, 98.334, 134.806], ['C', ' H ', 173.779, 99.854, 139.946], ['C', ' HA ', 175.932, 99.395, 138.105], ['C', ' HB ', 173.491, 101.206, 137.898], ['C', ' HB ', 174.552, 100.852, 136.551], ['C', ' HG ', 172.824, 98.892, 138.068], ['C', ' HG ', 172.565, 99.522, 136.45], ['C', ' HE ', 175.015, 97.543, 134.263], ['C', ' HE ', 173.564, 98.548, 134.321], ['C', ' HE ', 175.129, 99.221, 134.816]]
[['C', ' N ', 175.85, 102.398, 139.387], ['C', ' CA ', 176.58, 103.656, 139.476], ['C', ' C ', 177.958, 103.476, 140.074], ['C', ' O ', 178.764, 104.404, 140.088], ['C', ' CB ', 175.796, 104.698, 140.278], ['C', ' CG ', 175.64, 104.426, 141.757], ['C', ' CD ', 174.482, 103.553, 142.056], ['C', ' OE1', 173.976, 102.927, 141.14], ['C', ' OE2', 174.097, 103.476, 143.194], ['C', ' H ', 175.039, 102.269, 139.995], ['C', ' HA ', 176.709, 104.04, 138.467], ['C', ' HB ', 176.276, 105.669, 140.171], ['C', ' HB ', 174.798, 104.783, 139.867], ['C', ' HG ', 176.537, 103.978, 142.154], ['C', ' HG ', 175.502, 105.38, 142.262]]
[['C', ' N ', 178.221, 102.306, 140.631], ['C', ' CA ', 179.492, 102.038, 141.244], ['C', ' C ', 180.421, 101.338, 140.28], ['C', ' O ', 181.565, 101.051, 140.63], ['C', ' CB ', 179.278, 101.18, 142.479], ['C', ' CG ', 178.412, 101.793, 143.59], ['C', ' CD1', 178.204, 100.755, 144.671], ['C', ' CD2', 179.072, 103.04, 144.164], ['C', ' H ', 177.54, 101.546, 140.588], ['C', ' HA ', 179.959, 102.978, 141.513], ['C', ' HB ', 178.777, 100.291, 142.153], ['C', ' HB ', 180.245, 100.904, 142.897], ['C', ' HG ', 177.444, 102.062, 143.187], ['C', ' HD1', 177.575, 101.171, 145.457], ['C', ' HD1', 177.717, 99.887, 144.246], ['C', ' HD1', 179.165, 100.464, 145.09], ['C', ' HD2', 178.439, 103.449, 144.951], ['C', ' HD2', 180.047, 102.781, 144.58], ['C', ' HD2', 179.196, 103.794, 143.393]]
[['C', ' N ', 179.945, 101.047, 139.071], ['C', ' CA ', 180.786, 100.333, 138.137], ['C', ' C ', 181.481, 101.287, 137.196], ['C', ' O ', 180.848, 102.116, 136.541], ['C', ' CB ', 179.987, 99.31, 137.337], ['C', ' CG1', 180.941, 98.614, 136.349], ['C', ' CG2', 179.319, 98.352, 138.303], ['C', ' H ', 178.998, 101.325, 138.792], ['C', ' HA ', 181.548, 99.792, 138.697], ['C', ' HB ', 179.213, 99.805, 136.753], ['C', ' HG1', 180.419, 97.888, 135.787], ['C', ' HG1', 181.372, 99.328, 135.661], ['C', ' HG1', 181.745, 98.123, 136.898], ['C', ' HG2', 178.748, 97.619, 137.748], ['C', ' HG2', 180.061, 97.861, 138.898], ['C', ' HG2', 178.648, 98.901, 138.962]]
[['C', ' N ', 182.798, 101.157, 137.144], ['C', ' CA ', 183.67, 101.966, 136.32], ['C', ' C ', 183.817, 101.401, 134.917], ['C', ' O ', 183.719, 102.13, 133.928], ['C', ' CB ', 185.036, 101.996, 136.979], ['C', ' CG ', 185.072, 102.724, 138.299], ['C', ' CD ', 186.337, 102.492, 139.02], ['C', ' OE1', 186.857, 101.4, 138.905], ['C', ' OE2', 186.789, 103.368, 139.705], ['C', ' H ', 183.221, 100.428, 137.715], ['C', ' HA ', 183.258, 102.973, 136.256], ['C', ' HB ', 185.376, 100.974, 137.146], ['C', ' HB ', 185.751, 102.472, 136.309], ['C', ' HG ', 184.95, 103.791, 138.124], ['C', ' HG ', 184.239, 102.385, 138.92]]
[['C', ' N ', 184.063, 100.095, 134.851], ['C', ' CA ', 184.289, 99.39, 133.586], ['C', ' C ', 183.682, 98.005, 133.547], ['C', ' O ', 183.526, 97.346, 134.577], ['C', ' CB ', 185.775, 99.314, 133.231], ['C', ' CG ', 186.398, 100.653, 132.915], ['C', ' CD ', 187.826, 100.543, 132.427], ['C', ' CE ', 188.35, 101.935, 132.048], ['C', ' NZ ', 189.769, 101.926, 131.61], ['C', ' H ', 184.105, 99.592, 135.741], ['C', ' HA ', 183.814, 99.963, 132.796], ['C', ' HB ', 186.332, 98.885, 134.044], ['C', ' HB ', 185.907, 98.663, 132.379], ['C', ' HG ', 185.796, 101.165, 132.161], ['C', ' HG ', 186.405, 101.26, 133.815], ['C', ' HD ', 188.455, 100.11, 133.206], ['C', ' HD ', 187.864, 99.899, 131.544], ['C', ' HE ', 187.741, 102.323, 131.227], ['C', ' HE ', 188.251, 102.6, 132.905], ['C', ' HZ ', 190.035, 102.91, 131.361], ['C', ' HZ ', 190.361, 101.597, 132.349], ['C', ' HZ ', 189.887, 101.331, 130.797]]
[['C', ' N ', 183.386, 97.526, 132.341], ['C', ' CA ', 182.868, 96.173, 132.171], ['C', ' C ', 183.541, 95.417, 131.014], ['C', ' O ', 183.872, 96.0, 129.974], ['C', ' CB ', 181.37, 96.237, 131.932], ['C', ' CG ', 180.573, 96.767, 133.042], ['C', ' SD ', 178.848, 96.829, 132.634], ['C', ' CE ', 178.288, 97.727, 134.045], ['C', ' H ', 183.522, 98.107, 131.52], ['C', ' HA ', 183.062, 95.616, 133.082], ['C', ' HB ', 181.173, 96.908, 131.113], ['C', ' HB ', 180.991, 95.246, 131.666], ['C', ' HG ', 180.713, 96.139, 133.924], ['C', ' HG ', 180.897, 97.773, 133.279], ['C', ' HE ', 177.233, 97.898, 133.972], ['C', ' HE ', 178.511, 97.179, 134.938], ['C', ' HE ', 178.793, 98.661, 134.092]]
[['C', ' N ', 183.657, 94.102, 131.175], ['C', ' CA ', 184.224, 93.206, 130.153], ['C', ' C ', 183.525, 91.857, 130.152], ['C', ' O ', 182.871, 91.496, 131.123], ['C', ' CB ', 185.744, 93.052, 130.352], ['C', ' CG ', 186.516, 92.413, 129.169], ['C', ' OD1', 185.894, 91.953, 128.217], ['C', ' OD2', 187.711, 92.356, 129.248], ['C', ' H ', 183.349, 93.724, 132.077], ['C', ' HA ', 184.075, 93.646, 129.181], ['C', ' HB ', 186.172, 94.036, 130.543], ['C', ' HB ', 185.942, 92.457, 131.211]]
[['C', ' N ', 183.631, 91.142, 129.043], ['C', ' CA ', 183.057, 89.808, 128.884], ['C', ' C ', 184.078, 88.744, 128.488], ['C', ' O ', 183.726, 87.574, 128.317], ['C', ' CB ', 181.926, 89.821, 127.841], ['C', ' CG1', 182.478, 90.238, 126.449], ['C', ' CG2', 180.85, 90.756, 128.312], ['C', ' CD1', 181.514, 90.034, 125.289], ['C', ' H ', 184.215, 91.539, 128.31], ['C', ' HA ', 182.633, 89.505, 129.836], ['C', ' HB ', 181.515, 88.816, 127.746], ['C', ' HG1', 182.755, 91.288, 126.484], ['C', ' HG1', 183.365, 89.653, 126.229], ['C', ' HG2', 180.014, 90.775, 127.624], ['C', ' HG2', 180.528, 90.412, 129.247], ['C', ' HG2', 181.246, 91.754, 128.418], ['C', ' HD1', 181.998, 90.345, 124.362], ['C', ' HD1', 181.256, 88.978, 125.228], ['C', ' HD1', 180.611, 90.619, 125.43]]
[['C', ' N ', 185.322, 89.142, 128.257], ['C', ' CA ', 186.291, 88.172, 127.786], ['C', ' C ', 186.937, 87.342, 128.887], ['C', ' O ', 186.626, 87.46, 130.075], ['C', ' H ', 185.596, 90.126, 128.369], ['C', ' HA ', 185.809, 87.511, 127.068], ['C', ' HA ', 187.07, 88.706, 127.241]]
[['C', ' N ', 187.835, 86.449, 128.466], ['C', ' CA ', 188.575, 85.547, 129.351], ['C', ' C ', 187.675, 84.573, 130.103], ['C', ' O ', 188.075, 83.997, 131.114], ['C', ' CB ', 189.367, 86.356, 130.364], ['C', ' CG ', 190.281, 87.36, 129.757], ['C', ' CD ', 190.983, 88.13, 130.815], ['C', ' CE ', 191.83, 89.198, 130.211], ['C', ' NZ ', 192.459, 90.025, 131.229], ['C', ' H ', 188.029, 86.404, 127.474], ['C', ' HA ', 189.267, 84.961, 128.744], ['C', ' HB ', 188.707, 86.857, 131.051], ['C', ' HB ', 189.981, 85.678, 130.955], ['C', ' HG ', 191.014, 86.853, 129.131], ['C', ' HG ', 189.718, 88.055, 129.141], ['C', ' HD ', 190.247, 88.601, 131.466], ['C', ' HD ', 191.604, 87.464, 131.411], ['C', ' HE ', 192.605, 88.743, 129.599], ['C', ' HE ', 191.208, 89.834, 129.581], ['C', ' HZ ', 193.017, 90.741, 130.758], ['C', ' HZ ', 191.759, 90.477, 131.792], ['C', ' HZ ', 193.058, 89.475, 131.816]]
[['C', ' N ', 186.468, 84.364, 129.6], ['C', ' CA ', 185.543, 83.423, 130.203], ['C', ' C ', 184.763, 83.978, 131.398], ['C', ' O ', 184.138, 83.194, 132.129], ['C', ' H ', 186.194, 84.871, 128.771], ['C', ' HA ', 184.835, 83.095, 129.442], ['C', ' HA ', 186.093, 82.537, 130.515]]
[['C', ' N ', 184.816, 85.297, 131.632], ['C', ' CA ', 184.112, 85.903, 132.763], ['C', ' C ', 183.473, 87.238, 132.417], ['C', ' O ', 183.944, 87.96, 131.549], ['C', ' CB ', 185.066, 86.115, 133.938], ['C', ' CG ', 185.692, 84.857, 134.513], ['C', ' CD ', 186.629, 85.191, 135.661], ['C', ' CE ', 187.243, 83.952, 136.301], ['C', ' NZ ', 188.179, 83.23, 135.385], ['C', ' H ', 185.365, 85.906, 131.017], ['C', ' HA ', 183.313, 85.241, 133.08], ['C', ' HB ', 185.869, 86.75, 133.624], ['C', ' HB ', 184.537, 86.635, 134.736], ['C', ' HG ', 184.91, 84.184, 134.856], ['C', ' HG ', 186.263, 84.363, 133.734], ['C', ' HD ', 187.427, 85.836, 135.302], ['C', ' HD ', 186.087, 85.717, 136.422], ['C', ' HE ', 187.791, 84.262, 137.189], ['C', ' HE ', 186.444, 83.273, 136.598], ['C', ' HZ ', 188.562, 82.426, 135.861], ['C', ' HZ ', 187.681, 82.918, 134.562], ['C', ' HZ ', 188.932, 83.845, 135.11]]
[['C', ' N ', 182.408, 87.585, 133.125], ['C', ' CA ', 181.836, 88.912, 133.002], ['C', ' C ', 182.47, 89.712, 134.14], ['C', ' O ', 182.336, 89.369, 135.322], ['C', ' CB ', 180.307, 88.901, 133.092], ['C', ' CG ', 179.696, 90.233, 132.819], ['C', ' CD1', 179.214, 90.511, 131.569], ['C', ' CD2', 179.642, 91.22, 133.773], ['C', ' CE1', 178.699, 91.747, 131.254], ['C', ' CE2', 179.125, 92.46, 133.463], ['C', ' CZ ', 178.662, 92.722, 132.203], ['C', ' H ', 182.016, 86.932, 133.803], ['C', ' HA ', 182.13, 89.357, 132.057], ['C', ' HB ', 179.907, 88.187, 132.374], ['C', ' HB ', 180.007, 88.59, 134.041], ['C', ' HD1', 179.248, 89.727, 130.816], ['C', ' HD2', 180.025, 91.019, 134.776], ['C', ' HE1', 178.327, 91.947, 130.246], ['C', ' HE2', 179.09, 93.239, 134.21], ['C', ' HZ ', 178.262, 93.704, 131.963]]
[['C', ' N ', 183.234, 90.722, 133.784], ['C', ' CA ', 184.019, 91.469, 134.755], ['C', ' C ', 183.353, 92.78, 135.06], ['C', ' O ', 182.929, 93.494, 134.147], ['C', ' CB ', 185.364, 91.815, 134.137], ['C', ' CG ', 186.155, 90.648, 133.73], ['C', ' CD1', 185.982, 89.982, 132.571], ['C', ' CD2', 187.251, 90.007, 134.383], ['C', ' NE1', 186.857, 88.984, 132.467], ['C', ' CE2', 187.648, 88.969, 133.562], ['C', ' CE3', 187.915, 90.219, 135.562], ['C', ' CZ2', 188.673, 88.132, 133.897], ['C', ' CZ3', 188.95, 89.389, 135.903], ['C', ' CH2', 189.318, 88.366, 135.091], ['C', ' H ', 183.238, 90.967, 132.8], ['C', ' HA ', 184.132, 90.891, 135.671], ['C', ' HB ', 185.2, 92.443, 133.283], ['C', ' HB ', 185.943, 92.389, 134.852], ['C', ' HD1', 185.232, 90.206, 131.817], ['C', ' HE1', 186.881, 88.335, 131.637], ['C', ' HE3', 187.63, 91.005, 136.209], ['C', ' HZ2', 188.981, 87.308, 133.258], ['C', ' HZ3', 189.462, 89.57, 136.846], ['C', ' HH2', 190.141, 87.719, 135.392]]
[['C', ' N ', 183.326, 93.141, 136.332], ['C', ' CA ', 182.819, 94.427, 136.752], ['C', ' C ', 183.869, 95.142, 137.598], ['C', ' O ', 184.195, 94.703, 138.699], ['C', ' CB ', 181.515, 94.192, 137.541], ['C', ' CG1', 180.959, 95.417, 138.017], ['C', ' CG2', 180.505, 93.56, 136.651], ['C', ' H ', 183.641, 92.474, 137.043], ['C', ' HA ', 182.609, 95.038, 135.871], ['C', ' HB ', 181.725, 93.556, 138.395], ['C', ' HG1', 180.048, 95.215, 138.562], ['C', ' HG1', 181.655, 95.909, 138.657], ['C', ' HG1', 180.74, 96.026, 137.171], ['C', ' HG2', 179.593, 93.403, 137.198], ['C', ' HG2', 180.317, 94.226, 135.813], ['C', ' HG2', 180.871, 92.61, 136.289]]
[['C', ' N ', 184.375, 96.267, 137.123], ['C', ' CA ', 185.426, 96.993, 137.836], ['C', ' C ', 184.749, 98.033, 138.687], ['C', ' O ', 184.009, 98.858, 138.139], ['C', ' CB ', 186.379, 97.605, 136.829], ['C', ' CG ', 187.156, 96.558, 136.06], ['C', ' CD1', 186.61, 95.96, 134.923], ['C', ' CD2', 188.407, 96.195, 136.483], ['C', ' CE1', 187.311, 95.008, 134.238], ['C', ' CE2', 189.114, 95.239, 135.793], ['C', ' CZ ', 188.571, 94.644, 134.681], ['C', ' OH ', 189.285, 93.683, 134.01], ['C', ' H ', 184.052, 96.606, 136.212], ['C', ' HA ', 185.969, 96.316, 138.492], ['C', ' HB ', 185.818, 98.203, 136.133], ['C', ' HB ', 187.084, 98.261, 137.339], ['C', ' HD1', 185.631, 96.234, 134.575], ['C', ' HD2', 188.84, 96.659, 137.369], ['C', ' HE1', 186.876, 94.54, 133.354], ['C', ' HE2', 190.108, 94.946, 136.134], ['C', ' HH ', 188.769, 93.355, 133.268]]
[['C', ' N ', 184.986, 98.004, 140.009], ['C', ' CA ', 184.24, 98.886, 140.91], ['C', ' C ', 185.111, 99.658, 141.893], ['C', ' O ', 184.875, 99.542, 143.103], ['C', ' CB ', 183.312, 98.059, 141.806], ['C', ' OG1', 184.098, 97.196, 142.597], ['C', ' CG2', 182.446, 97.193, 140.955], ['C', ' H ', 185.653, 97.33, 140.416], ['C', ' HA ', 183.671, 99.605, 140.32], ['C', ' HB ', 182.701, 98.709, 142.436], ['C', ' HG1', 184.543, 97.762, 143.262], ['C', ' HG2', 181.825, 96.579, 141.584], ['C', ' HG2', 181.837, 97.821, 140.319], ['C', ' HG2', 183.062, 96.544, 140.353]]
[['C', ' N ', 186.145, 100.367, 141.432], ['C', ' CA ', 187.092, 101.104, 142.286], ['C', ' C ', 187.982, 100.187, 143.116], ['C', ' O ', 189.201, 100.162, 142.953], ['C', ' CB ', 186.392, 102.063, 143.267], ['C', ' CG ', 185.676, 103.215, 142.642], ['C', ' CD ', 184.984, 104.063, 143.682], ['C', ' OE1', 184.785, 103.612, 144.812], ['C', ' NE2', 184.622, 105.284, 143.316], ['C', ' H ', 186.306, 100.458, 140.421], ['C', ' HA ', 187.736, 101.696, 141.632], ['C', ' HB ', 185.703, 101.551, 143.911], ['C', ' HB ', 187.15, 102.492, 143.919], ['C', ' HG ', 186.399, 103.834, 142.117], ['C', ' HG ', 184.931, 102.835, 141.942], ['C', ' HE2', 184.162, 105.89, 143.968], ['C', ' HE2', 184.815, 105.603, 142.385]]
[['C', ' N ', 187.369, 99.459, 144.032], ['C', ' CA ', 188.059, 98.514, 144.879], ['C', ' C ', 187.95, 97.107, 144.306], ['C', ' O ', 186.928, 96.436, 144.475], ['C', ' CB ', 187.495, 98.553, 146.299], ['C', ' CG ', 188.252, 97.647, 147.274], ['C', ' OD1', 189.108, 96.913, 146.831], ['C', ' OD2', 187.974, 97.708, 148.452], ['C', ' H ', 186.361, 99.538, 144.095], ['C', ' HA ', 189.113, 98.785, 144.918], ['C', ' HB ', 187.526, 99.576, 146.674], ['C', ' HB ', 186.449, 98.245, 146.274]]
[['C', ' N ', 189.003, 96.68, 143.619], ['C', ' CA ', 189.082, 95.38, 142.967], ['C', ' C ', 188.065, 95.215, 141.824], ['C', ' O ', 187.293, 96.132, 141.503], ['C', ' CB ', 188.867, 94.286, 144.041], ['C', ' CG ', 189.445, 92.928, 143.686], ['C', ' OD1', 189.995, 92.835, 142.614], ['C', ' OD2', 189.338, 92.008, 144.459], ['C', ' H ', 189.802, 97.295, 143.552], ['C', ' HA ', 190.083, 95.271, 142.55], ['C', ' HB ', 189.288, 94.623, 144.995], ['C', ' HB ', 187.794, 94.147, 144.197]]
[['C', ' N ', 188.088, 94.035, 141.213], ['C', ' CA ', 187.166, 93.69, 140.149], ['C', ' C ', 186.342, 92.485, 140.566], ['C', ' O ', 186.864, 91.487, 141.058], ['C', ' CB ', 187.929, 93.408, 138.836], ['C', ' CG1', 188.878, 92.226, 138.976], ['C', ' CG2', 186.953, 93.175, 137.704], ['C', ' H ', 188.794, 93.369, 141.523], ['C', ' HA ', 186.487, 94.524, 139.985], ['C', ' HB ', 188.538, 94.274, 138.616], ['C', ' HG1', 189.421, 92.096, 138.042], ['C', ' HG1', 189.587, 92.42, 139.783], ['C', ' HG1', 188.332, 91.313, 139.19], ['C', ' HG2', 187.503, 93.03, 136.799], ['C', ' HG2', 186.332, 92.302, 137.893], ['C', ' HG2', 186.335, 94.03, 137.592]]
[['C', ' N ', 185.051, 92.563, 140.344], ['C', ' CA ', 184.194, 91.465, 140.697], ['C', ' C ', 183.948, 90.645, 139.464], ['C', ' O ', 183.783, 91.184, 138.367], ['C', ' CB ', 182.867, 91.998, 141.226], ['C', ' CG ', 182.938, 92.96, 142.417], ['C', ' CD1', 181.518, 93.426, 142.746], ['C', ' CD2', 183.595, 92.286, 143.609], ['C', ' H ', 184.671, 93.4, 139.901], ['C', ' HA ', 184.684, 90.832, 141.432], ['C', ' HB ', 182.375, 92.529, 140.42], ['C', ' HB ', 182.244, 91.156, 141.512], ['C', ' HG ', 183.524, 93.844, 142.136], ['C', ' HD1', 181.548, 94.136, 143.574], ['C', ' HD1', 181.094, 93.906, 141.875], ['C', ' HD1', 180.901, 92.575, 143.031], ['C', ' HD2', 183.632, 92.99, 144.441], ['C', ' HD2', 183.014, 91.41, 143.901], ['C', ' HD2', 184.612, 91.984, 143.362]]
[['C', ' N ', 183.876, 89.336, 139.604], ['C', ' CA ', 183.574, 88.572, 138.417], ['C', ' C ', 182.449, 87.615, 138.592], ['C', ' O ', 182.299, 86.957, 139.626], ['C', ' CB ', 184.758, 87.74, 137.973], ['C', ' OG1', 185.092, 86.821, 139.018], ['C', ' CG2', 185.932, 88.614, 137.659], ['C', ' H ', 184.031, 88.88, 140.494], ['C', ' HA ', 183.295, 89.248, 137.613], ['C', ' HB ', 184.473, 87.184, 137.087], ['C', ' HG1', 184.341, 86.222, 139.168], ['C', ' HG2', 186.761, 87.998, 137.33], ['C', ' HG2', 185.64, 89.295, 136.87], ['C', ' HG2', 186.232, 89.181, 138.537]]
[['C', ' N ', 181.738, 87.468, 137.505], ['C', ' CA ', 180.661, 86.539, 137.328], ['C', ' C ', 181.095, 85.525, 136.282], ['C', ' O ', 181.386, 85.918, 135.157], ['C', ' CB ', 179.467, 87.316, 136.815], ['C', ' CG ', 178.23, 86.582, 136.471], ['C', ' CD1', 177.6, 85.998, 137.721], ['C', ' CD2', 177.33, 87.538, 135.803], ['C', ' H ', 181.971, 88.113, 136.741], ['C', ' HA ', 180.432, 86.085, 138.282], ['C', ' HB ', 179.185, 88.04, 137.563], ['C', ' HB ', 179.778, 87.857, 135.972], ['C', ' HG ', 178.455, 85.762, 135.784], ['C', ' HD1', 176.678, 85.48, 137.456], ['C', ' HD1', 178.264, 85.301, 138.199], ['C', ' HD1', 177.376, 86.806, 138.408], ['C', ' HD2', 176.409, 87.026, 135.532], ['C', ' HD2', 177.122, 88.359, 136.49], ['C', ' HD2', 177.806, 87.93, 134.906]]
[['C', ' N ', 181.165, 84.231, 136.555], ['C', ' CA ', 181.592, 83.265, 135.575], ['C', ' C ', 180.719, 83.409, 134.349], ['C', ' O ', 179.503, 83.592, 134.454], ['C', ' CB ', 181.362, 81.943, 136.303], ['C', ' CG ', 181.489, 82.3, 137.766], ['C', ' CD ', 180.884, 83.684, 137.88], ['C', ' HA ', 182.652, 83.419, 135.327], ['C', ' HB ', 180.389, 81.525, 136.032], ['C', ' HB ', 182.114, 81.21, 135.979], ['C', ' HG ', 180.954, 81.556, 138.38], ['C', ' HG ', 182.543, 82.272, 138.078], ['C', ' HD ', 179.808, 83.622, 138.06], ['C', ' HD ', 181.425, 84.229, 138.672]]
[['C', ' N ', 181.316, 83.333, 133.183], ['C', ' CA ', 180.54, 83.514, 131.991], ['C', ' C ', 179.663, 82.303, 131.904], ['C', ' O ', 180.033, 81.235, 132.398], ['C', ' CB ', 181.437, 83.733, 130.783], ['C', ' CG ', 180.845, 84.339, 129.519], ['C', ' CD1', 180.425, 85.828, 129.792], ['C', ' CD2', 181.914, 84.306, 128.439], ['C', ' H ', 182.32, 83.145, 133.089], ['C', ' HA ', 179.899, 84.384, 132.126], ['C', ' HB ', 182.176, 84.431, 131.083], ['C', ' HB ', 181.922, 82.79, 130.528], ['C', ' HG ', 179.973, 83.772, 129.193], ['C', ' HD1', 180.027, 86.261, 128.874], ['C', ' HD1', 179.664, 85.892, 130.559], ['C', ' HD1', 181.305, 86.403, 130.108], ['C', ' HD2', 181.521, 84.743, 127.519], ['C', ' HD2', 182.785, 84.888, 128.771], ['C', ' HD2', 182.215, 83.276, 128.252]]
[['C', ' N ', 178.491, 82.497, 131.337], ['C', ' CA ', 177.412, 81.529, 131.196], ['C', ' C ', 176.514, 81.528, 132.431], ['C', ' O ', 175.407, 81.004, 132.389], ['C', ' CB ', 177.912, 80.114, 130.883], ['C', ' CG ', 178.76, 80.012, 129.602], ['C', ' CD ', 179.151, 78.576, 129.326], ['C', ' CE ', 180.037, 78.466, 128.098], ['C', ' NZ ', 180.473, 77.06, 127.854], ['C', ' H ', 178.335, 83.422, 130.952], ['C', ' HA ', 176.797, 81.841, 130.352], ['C', ' HB ', 178.44, 79.677, 131.723], ['C', ' HB ', 177.042, 79.479, 130.716], ['C', ' HG ', 178.188, 80.397, 128.76], ['C', ' HG ', 179.665, 80.603, 129.701], ['C', ' HD ', 179.689, 78.181, 130.189], ['C', ' HD ', 178.254, 77.979, 129.173], ['C', ' HE ', 179.489, 78.822, 127.227], ['C', ' HE ', 180.921, 79.09, 128.238], ['C', ' HZ ', 181.06, 77.024, 127.033], ['C', ' HZ ', 180.994, 76.724, 128.652], ['C', ' HZ ', 179.663, 76.473, 127.712]]
[['C', ' N ', 176.821, 82.367, 133.426], ['C', ' CA ', 175.861, 82.554, 134.518], ['C', ' C ', 174.88, 83.629, 134.043], ['C', ' O ', 173.891, 83.956, 134.698], ['C', ' CB ', 176.556, 82.946, 135.812], ['C', ' CG ', 177.473, 81.871, 136.357], ['C', ' CD ', 176.746, 80.641, 136.829], ['C', ' OE1', 175.834, 80.773, 137.606], ['C', ' OE2', 177.1, 79.564, 136.412], ['C', ' H ', 177.743, 82.819, 133.504], ['C', ' HA ', 175.315, 81.624, 134.686], ['C', ' HB ', 177.157, 83.826, 135.633], ['C', ' HB ', 175.816, 83.194, 136.571], ['C', ' HG ', 178.15, 81.578, 135.562], ['C', ' HG ', 178.061, 82.282, 137.169]]
[['C', ' N ', 175.184, 84.121, 132.84], ['C', ' CA ', 174.496, 85.099, 132.037], ['C', ' C ', 173.814, 84.383, 130.854], ['C', ' O ', 173.267, 85.023, 129.961], ['C', ' CB ', 175.495, 86.116, 131.467], ['C', ' OG1', 176.431, 85.446, 130.595], ['C', ' CG2', 176.266, 86.735, 132.588], ['C', ' H ', 176.047, 83.782, 132.455], ['C', ' HA ', 173.758, 85.613, 132.646], ['C', ' HB ', 174.97, 86.887, 130.931], ['C', ' HG1', 176.009, 85.298, 129.726], ['C', ' HG2', 176.974, 87.46, 132.186], ['C', ' HG2', 175.577, 87.234, 133.254], ['C', ' HG2', 176.81, 85.971, 133.138]]
[['C', ' N ', 173.869, 83.045, 130.824], ['C', ' CA ', 173.372, 82.242, 129.704], ['C', ' C ', 171.909, 82.458, 129.379], ['C', ' O ', 171.516, 82.389, 128.223], ['C', ' CB ', 173.587, 80.755, 129.96], ['C', ' CG ', 173.173, 79.893, 128.838], ['C', ' ND1', 173.906, 79.784, 127.677], ['C', ' CD2', 172.095, 79.097, 128.68], ['C', ' CE1', 173.297, 78.954, 126.855], ['C', ' NE2', 172.195, 78.521, 127.439], ['C', ' H ', 174.297, 82.534, 131.596], ['C', ' HA ', 173.935, 82.504, 128.807], ['C', ' HB ', 174.637, 80.567, 130.119], ['C', ' HB ', 173.055, 80.449, 130.858], ['C', ' HD1', 174.762, 80.253, 127.47], ['C', ' HD2', 171.245, 78.868, 129.323], ['C', ' HE1', 173.721, 78.733, 125.877]]
[['C', ' N ', 171.078, 82.632, 130.388], ['C', ' CA ', 169.653, 82.806, 130.156], ['C', ' C ', 169.23, 84.27, 130.051], ['C', ' O ', 168.037, 84.568, 130.099], ['C', ' H ', 171.44, 82.637, 131.331], ['C', ' HA ', 169.373, 82.282, 129.243], ['C', ' HA ', 169.103, 82.334, 130.968]]
[['C', ' N ', 170.192, 85.188, 129.98], ['C', ' CA ', 169.878, 86.603, 129.996], ['C', ' C ', 170.071, 87.46, 128.738], ['C', ' O ', 169.779, 88.668, 128.793], ['C', ' CB ', 170.697, 87.219, 131.103], ['C', ' CG ', 170.3, 86.811, 132.448], ['C', ' CD1', 170.88, 85.736, 133.054], ['C', ' CD2', 169.351, 87.545, 133.102], ['C', ' CE1', 170.512, 85.386, 134.32], ['C', ' CE2', 168.975, 87.205, 134.362], ['C', ' CZ ', 169.551, 86.127, 134.977], ['C', ' OH ', 169.17, 85.785, 136.248], ['C', ' H ', 171.174, 84.909, 129.915], ['C', ' HA ', 168.825, 86.69, 130.263], ['C', ' HB ', 171.744, 86.951, 130.966], ['C', ' HB ', 170.633, 88.245, 131.037], ['C', ' HD1', 171.623, 85.157, 132.537], ['C', ' HD2', 168.893, 88.406, 132.614], ['C', ' HE1', 170.975, 84.523, 134.804], ['C', ' HE2', 168.216, 87.794, 134.878], ['C', ' HH ', 168.47, 86.376, 136.543]]
[['C', ' N ', 170.573, 86.908, 127.629], ['C', ' CA ', 170.849, 87.733, 126.452], ['C', ' C ', 169.599, 87.886, 125.609], ['C', ' O ', 168.66, 87.095, 125.707], ['C', ' CB ', 171.992, 87.173, 125.604], ['C', ' CG ', 171.634, 86.09, 124.591], ['C', ' CD ', 171.412, 84.772, 125.166], ['C', ' OE1', 171.092, 84.7, 126.323], ['C', ' OE2', 171.559, 83.795, 124.451], ['C', ' H ', 170.782, 85.905, 127.569], ['C', ' HA ', 171.147, 88.725, 126.779], ['C', ' HB ', 172.447, 87.999, 125.062], ['C', ' HB ', 172.761, 86.763, 126.261], ['C', ' HG ', 170.763, 86.374, 124.008], ['C', ' HG ', 172.468, 86.011, 123.894]]
[['C', ' N ', 169.565, 88.915, 124.787], ['C', ' CA ', 168.415, 89.111, 123.926], ['C', ' C ', 168.276, 88.077, 122.828], ['C', ' O ', 169.234, 87.778, 122.107], ['C', ' CB ', 168.426, 90.489, 123.333], ['C', ' CG ', 167.226, 90.815, 122.514], ['C', ' CD ', 167.074, 92.247, 122.296], ['C', ' OE1', 167.134, 93.018, 123.256], ['C', ' NE2', 166.839, 92.677, 121.091], ['C', ' H ', 170.37, 89.55, 124.762], ['C', ' HA ', 167.526, 89.037, 124.553], ['C', ' HB ', 168.557, 91.229, 124.103], ['C', ' HB ', 169.265, 90.529, 122.67], ['C', ' HG ', 167.341, 90.37, 121.538], ['C', ' HG ', 166.326, 90.448, 123.002], ['C', ' HE2', 166.733, 93.658, 120.924], ['C', ' HE2', 166.722, 92.05, 120.3]]
[['C', ' N ', 167.029, 87.651, 122.616], ['C', ' CA ', 166.641, 86.621, 121.657], ['C', ' C ', 167.104, 86.893, 120.241], ['C', ' O ', 167.424, 85.967, 119.499], ['C', ' CB ', 165.139, 86.467, 121.636], ['C', ' H ', 166.314, 88.005, 123.238], ['C', ' HA ', 167.081, 85.69, 121.993], ['C', ' HB ', 164.867, 85.665, 120.946], ['C', ' HB ', 164.783, 86.225, 122.636], ['C', ' HB ', 164.681, 87.398, 121.3]]
[['C', ' N ', 167.198, 88.139, 119.848], ['C', ' CA ', 167.617, 88.434, 118.488], ['C', ' C ', 168.997, 87.849, 118.101], ['C', ' O ', 169.257, 87.717, 116.894], ['C', ' H ', 166.931, 88.899, 120.45], ['C', ' HA ', 166.858, 88.047, 117.806], ['C', ' HA ', 167.621, 89.514, 118.348]]
[['C', ' N ', 169.907, 87.524, 119.095], ['C', ' CA ', 171.21, 86.929, 118.812], ['C', ' C ', 171.256, 85.447, 119.125], ['C', ' O ', 172.306, 84.817, 119.038], ['C', ' CB ', 172.393, 87.665, 119.511], ['C', ' SG ', 172.958, 89.208, 118.698], ['C', ' H ', 169.636, 87.672, 120.068], ['C', ' HA ', 171.392, 86.998, 117.746], ['C', ' HB ', 172.104, 87.924, 120.535], ['C', ' HB ', 173.267, 87.013, 119.591]]
[['C', ' N ', 170.086, 84.825, 119.209], ['C', ' CA ', 170.09, 83.376, 119.285], ['C', ' C ', 170.507, 82.925, 117.898], ['C', ' O ', 171.035, 81.836, 117.706], ['C', ' CB ', 168.722, 82.802, 119.664], ['C', ' CG ', 168.263, 83.107, 121.076], ['C', ' CD ', 169.08, 82.404, 122.147], ['C', ' CE ', 168.518, 82.688, 123.542], ['C', ' NZ ', 169.369, 82.093, 124.615], ['C', ' H ', 169.202, 85.348, 119.26], ['C', ' HA ', 170.846, 83.044, 119.994], ['C', ' HB ', 167.967, 83.213, 118.989], ['C', ' HB ', 168.725, 81.722, 119.529], ['C', ' HG ', 168.412, 84.161, 121.225], ['C', ' HG ', 167.206, 82.879, 121.193], ['C', ' HD ', 169.09, 81.326, 121.965], ['C', ' HD ', 170.108, 82.769, 122.137], ['C', ' HE ', 168.474, 83.77, 123.692], ['C', ' HE ', 167.513, 82.277, 123.619], ['C', ' HZ ', 168.989, 82.318, 125.522], ['C', ' HZ ', 169.434, 81.096, 124.517], ['C', ' HZ ', 170.305, 82.508, 124.538]]
[['C', ' N ', 170.252, 83.793, 116.921], ['C', ' CA ', 170.593, 83.555, 115.545], ['C', ' C ', 171.641, 84.547, 114.952], ['C', ' O ', 171.647, 84.716, 113.729], ['C', ' CB ', 169.331, 83.543, 114.683], ['C', ' CG1', 168.59, 84.887, 114.75], ['C', ' CG2', 168.425, 82.411, 115.218], ['C', ' CD1', 167.5, 85.052, 113.7], ['C', ' H ', 169.799, 84.666, 117.161], ['C', ' HA ', 171.026, 82.559, 115.482], ['C', ' HB ', 169.6, 83.358, 113.653], ['C', ' HG1', 168.135, 85.004, 115.736], ['C', ' HG1', 169.313, 85.694, 114.608], ['C', ' HG2', 167.533, 82.335, 114.624], ['C', ' HG2', 168.95, 81.472, 115.186], ['C', ' HG2', 168.149, 82.612, 116.248], ['C', ' HD1', 167.055, 86.036, 113.815], ['C', ' HD1', 167.941, 84.967, 112.699], ['C', ' HD1', 166.731, 84.297, 113.813]]
[['C', ' N ', 172.492, 85.234, 115.795], ['C', ' CA ', 173.581, 86.116, 115.305], ['C', ' C ', 174.744, 85.165, 115.085], ['C', ' O ', 175.114, 84.4, 115.978], ['C', ' CB ', 174.043, 87.299, 116.269], ['C', ' SG ', 172.904, 88.766, 116.562], ['C', ' H ', 172.428, 85.036, 116.801], ['C', ' HA ', 173.29, 86.569, 114.354], ['C', ' HB ', 174.242, 86.876, 117.246], ['C', ' HB ', 174.998, 87.72, 115.911]]
[['C', ' N ', 175.296, 85.201, 113.893], ['C', ' CA ', 176.389, 84.312, 113.503], ['C', ' C ', 177.728, 85.04, 113.331], ['C', ' O ', 178.819, 84.485, 113.495], ['C', ' CB ', 175.933, 83.633, 112.209], ['C', ' CG ', 175.775, 84.614, 111.055], ['C', ' CD ', 175.139, 84.002, 109.829], ['C', ' CE ', 174.913, 85.11, 108.783], ['C', ' NZ ', 174.193, 84.648, 107.575], ['C', ' H ', 174.907, 85.854, 113.225], ['C', ' HA ', 176.513, 83.556, 114.279], ['C', ' HB ', 176.63, 82.866, 111.915], ['C', ' HB ', 174.97, 83.155, 112.374], ['C', ' HG ', 175.175, 85.466, 111.361], ['C', ' HG ', 176.758, 84.978, 110.757], ['C', ' HD ', 175.79, 83.233, 109.414], ['C', ' HD ', 174.174, 83.552, 110.084], ['C', ' HE ', 174.327, 85.904, 109.245], ['C', ' HE ', 175.878, 85.516, 108.48], ['C', ' HZ ', 174.063, 85.46, 106.935], ['C', ' HZ ', 174.706, 83.932, 107.108], ['C', ' HZ ', 173.259, 84.278, 107.823]]
[['C', ' N ', 177.649, 86.305, 113.001], ['C', ' CA ', 178.8, 87.101, 112.66], ['C', ' C ', 179.496, 87.757, 113.825], ['C', ' O ', 179.447, 88.969, 113.987], ['C', ' CB ', 178.391, 88.12, 111.614], ['C', ' CG ', 177.21, 88.91, 112.048], ['C', ' OD1', 176.443, 88.392, 112.864], ['C', ' OD2', 177.032, 89.991, 111.563], ['C', ' H ', 176.744, 86.763, 112.949], ['C', ' HA ', 179.525, 86.439, 112.186], ['C', ' HB ', 179.226, 88.8, 111.426], ['C', ' HB ', 178.164, 87.613, 110.671]]
[['C', ' N ', 180.208, 86.959, 114.616], ['C', ' CA ', 180.891, 87.506, 115.801], ['C', ' C ', 181.716, 88.691, 115.345], ['C', ' O ', 181.661, 89.801, 115.893], ['C', ' CB ', 181.832, 86.464, 116.439], ['C', ' CG ', 182.551, 86.99, 117.616], ['C', ' CD1', 181.881, 87.138, 118.78], ['C', ' CD2', 183.864, 87.319, 117.551], ['C', ' CE1', 182.505, 87.637, 119.869], ['C', ' CE2', 184.487, 87.81, 118.65], ['C', ' CZ ', 183.806, 87.976, 119.807], ['C', ' OH ', 184.428, 88.491, 120.916], ['C', ' H ', 180.165, 85.96, 114.397], ['C', ' HA ', 180.151, 87.85, 116.526], ['C', ' HB ', 181.308, 85.577, 116.735], ['C', ' HB ', 182.573, 86.156, 115.709], ['C', ' HD1', 180.834, 86.869, 118.836], ['C', ' HD2', 184.413, 87.199, 116.636], ['C', ' HE1', 181.965, 87.768, 120.782], ['C', ' HE2', 185.523, 88.082, 118.603], ['C', ' HH ', 183.796, 88.567, 121.635]]
[['C', ' N ', 182.456, 88.441, 114.287], ['C', ' CA ', 183.292, 89.417, 113.649], ['C', ' C ', 182.441, 90.204, 112.666], ['C', ' O ', 181.823, 89.624, 111.771], ['C', ' CB ', 184.432, 88.691, 112.933], ['C', ' CG1', 185.267, 89.631, 112.179], ['C', ' CG2', 185.261, 87.978, 113.957], ['C', ' H ', 182.395, 87.511, 113.901], ['C', ' HA ', 183.693, 90.088, 114.403], ['C', ' HB ', 184.017, 87.97, 112.226], ['C', ' HG1', 186.062, 89.07, 111.697], ['C', ' HG1', 184.664, 90.137, 111.425], ['C', ' HG1', 185.697, 90.36, 112.853], ['C', ' HG2', 186.057, 87.449, 113.478], ['C', ' HG2', 185.672, 88.702, 114.656], ['C', ' HG2', 184.649, 87.27, 114.487]]
[['C', ' N ', 182.492, 91.526, 112.745], ['C', ' CA ', 181.664, 92.368, 111.893], ['C', ' C ', 182.194, 92.422, 110.474], ['C', ' O ', 182.765, 93.407, 110.021], ['C', ' CB ', 181.578, 93.768, 112.478], ['C', ' H ', 183.043, 91.934, 113.482], ['C', ' HA ', 180.672, 91.929, 111.851], ['C', ' HB ', 180.929, 94.389, 111.86], ['C', ' HB ', 181.176, 93.722, 113.474], ['C', ' HB ', 182.556, 94.201, 112.513]]
[['C', ' N ', 181.919, 91.353, 109.756], ['C', ' CA ', 182.393, 91.097, 108.408], ['C', ' C ', 181.909, 92.093, 107.366], ['C', ' O ', 182.448, 92.157, 106.267], ['C', ' CB ', 182.023, 89.683, 107.994], ['C', ' CG ', 180.567, 89.419, 107.778], ['C', ' CD ', 180.316, 87.962, 107.462], ['C', ' OE1', 181.28, 87.236, 107.318], ['C', ' OE2', 179.169, 87.573, 107.317], ['C', ' H ', 181.438, 90.607, 110.26], ['C', ' HA ', 183.47, 91.142, 108.435], ['C', ' HB ', 182.55, 89.425, 107.077], ['C', ' HB ', 182.352, 88.996, 108.774], ['C', ' HG ', 179.999, 89.704, 108.665], ['C', ' HG ', 180.223, 90.018, 106.942]]
[['C', ' N ', 180.852, 92.816, 107.66], ['C', ' CA ', 180.352, 93.806, 106.724], ['C', ' C ', 180.879, 95.221, 107.015], ['C', ' O ', 180.518, 96.19, 106.342], ['C', ' CB ', 178.832, 93.76, 106.712], ['C', ' CG ', 178.169, 92.466, 106.187], ['C', ' CD1', 176.691, 92.584, 106.379], ['C', ' CD2', 178.476, 92.262, 104.697], ['C', ' H ', 180.415, 92.691, 108.56], ['C', ' HA ', 180.714, 93.547, 105.736], ['C', ' HB ', 178.49, 93.883, 107.726], ['C', ' HB ', 178.481, 94.564, 106.149], ['C', ' HG ', 178.522, 91.61, 106.755], ['C', ' HD1', 176.198, 91.677, 106.026], ['C', ' HD1', 176.501, 92.71, 107.432], ['C', ' HD1', 176.313, 93.44, 105.824], ['C', ' HD2', 177.976, 91.36, 104.355], ['C', ' HD2', 178.109, 93.114, 104.127], ['C', ' HD2', 179.542, 92.151, 104.532]]
[['C', ' N ', 181.695, 95.35, 108.044], ['C', ' CA ', 182.268, 96.621, 108.462], ['C', ' C ', 183.415, 96.935, 107.536], ['C', ' O ', 183.843, 96.045, 106.818], ['C', ' CB ', 182.73, 96.557, 109.893], ['C', ' H ', 181.981, 94.513, 108.558], ['C', ' HA ', 181.516, 97.399, 108.356], ['C', ' HB ', 183.153, 97.516, 110.177], ['C', ' HB ', 181.892, 96.325, 110.538], ['C', ' HB ', 183.485, 95.788, 109.985]]
[['C', ' N ', 183.925, 98.171, 107.514], ['C', ' CA ', 185.076, 98.438, 106.657], ['C', ' C ', 186.307, 97.987, 107.425], ['C', ' O ', 187.269, 97.451, 106.864], ['C', ' CB ', 185.155, 99.941, 106.367], ['C', ' CG ', 183.981, 100.438, 105.535], ['C', ' OD1', 183.858, 100.039, 104.409], ['C', ' OD2', 183.157, 101.186, 106.046], ['C', ' H ', 183.574, 98.914, 108.122], ['C', ' HA ', 184.997, 97.866, 105.729], ['C', ' HB ', 185.172, 100.485, 107.312], ['C', ' HB ', 186.076, 100.166, 105.843]]
[['C', ' N ', 186.244, 98.206, 108.725], ['C', ' CA ', 187.25, 97.798, 109.687], ['C', ' C ', 186.503, 97.334, 110.915], ['C', ' O ', 185.474, 97.913, 111.224], ['C', ' CB ', 188.243, 98.951, 109.976], ['C', ' CG1', 187.517, 100.143, 110.499], ['C', ' CG2', 189.302, 98.511, 111.019], ['C', ' H ', 185.416, 98.706, 109.066], ['C', ' HA ', 187.802, 96.959, 109.278], ['C', ' HB ', 188.732, 99.226, 109.049], ['C', ' HG1', 188.218, 100.948, 110.677], ['C', ' HG1', 186.772, 100.468, 109.776], ['C', ' HG1', 187.036, 99.888, 111.419], ['C', ' HG2', 190.0, 99.327, 111.194], ['C', ' HG2', 188.828, 98.248, 111.961], ['C', ' HG2', 189.847, 97.649, 110.644]]
[['C', ' N ', 186.983, 96.328, 111.616], ['C', ' CA ', 186.311, 95.943, 112.85], ['C', ' C ', 187.291, 95.572, 113.931], ['C', ' O ', 188.423, 95.163, 113.663], ['C', ' CB ', 185.371, 94.789, 112.615], ['C', ' OG ', 186.067, 93.659, 112.211], ['C', ' H ', 187.814, 95.84, 111.278], ['C', ' HA ', 185.743, 96.795, 113.21], ['C', ' HB ', 184.825, 94.576, 113.535], ['C', ' HB ', 184.649, 95.063, 111.859], ['C', ' HG ', 185.418, 92.959, 112.155]]
[['C', ' N ', 186.869, 95.751, 115.178], ['C', ' CA ', 187.725, 95.429, 116.3], ['C', ' C ', 187.07, 94.66, 117.442], ['C', ' O ', 185.843, 94.602, 117.582], ['C', ' CB ', 188.293, 96.709, 116.946], ['C', ' OG1', 187.228, 97.409, 117.593], ['C', ' CG2', 188.911, 97.642, 115.897], ['C', ' H ', 185.936, 96.132, 115.331], ['C', ' HA ', 188.521, 94.815, 115.916], ['C', ' HB ', 189.058, 96.438, 117.678], ['C', ' HG1', 186.88, 96.872, 118.313], ['C', ' HG2', 189.298, 98.529, 116.389], ['C', ' HG2', 189.71, 97.131, 115.393], ['C', ' HG2', 188.162, 97.94, 115.172]]
[['C', ' N ', 187.926, 94.174, 118.33], ['C', ' CA ', 187.526, 93.532, 119.588], ['C', ' C ', 188.782, 93.12, 120.318], ['C', ' O ', 189.85, 93.23, 119.754], ['C', ' H ', 188.917, 94.251, 118.069], ['C', ' HA ', 186.959, 94.237, 120.196], ['C', ' HA ', 186.89, 92.68, 119.413]]
[['C', ' N ', 188.696, 92.592, 121.524], ['C', ' CA ', 189.908, 92.265, 122.29], ['C', ' C ', 190.29, 90.795, 122.344], ['C', ' O ', 191.207, 90.403, 123.06], ['C', ' CB ', 189.737, 92.776, 123.691], ['C', ' OG ', 188.658, 92.151, 124.312], ['C', ' H ', 187.795, 92.468, 121.973], ['C', ' HA ', 190.74, 92.8, 121.843], ['C', ' HB ', 190.651, 92.599, 124.264], ['C', ' HB ', 189.573, 93.847, 123.667], ['C', ' HG ', 188.608, 92.547, 125.202]]
[['C', ' N ', 189.641, 89.976, 121.558], ['C', ' CA ', 189.837, 88.537, 121.656], ['C', ' C ', 191.26, 88.047, 121.414], ['C', ' O ', 191.733, 87.16, 122.111], ['C', ' CB ', 188.915, 87.849, 120.66], ['C', ' CG1', 189.203, 86.346, 120.592], ['C', ' CG2', 187.508, 88.109, 121.06], ['C', ' H ', 188.951, 90.369, 120.938], ['C', ' HA ', 189.545, 88.235, 122.663], ['C', ' HB ', 189.087, 88.259, 119.672], ['C', ' HG1', 188.53, 85.906, 119.903], ['C', ' HG1', 190.223, 86.137, 120.271], ['C', ' HG1', 189.042, 85.909, 121.575], ['C', ' HG2', 186.856, 87.641, 120.349], ['C', ' HG2', 187.326, 87.694, 122.05], ['C', ' HG2', 187.304, 89.174, 121.081]]
[['C', ' N ', 191.93, 88.589, 120.421], ['C', ' CA ', 193.288, 88.171, 120.079], ['C', ' C ', 194.351, 89.037, 120.741], ['C', ' O ', 195.508, 89.03, 120.326], ['C', ' H ', 191.488, 89.316, 119.879], ['C', ' HA ', 193.436, 87.132, 120.371], ['C', ' HA ', 193.413, 88.212, 118.998]]
[['C', ' N ', 193.971, 89.856, 121.718], ['C', ' CA ', 194.947, 90.76, 122.284], ['C', ' C ', 195.102, 90.718, 123.812], ['C', ' O ', 194.201, 90.294, 124.531], ['C', ' CB ', 194.58, 92.14, 121.849], ['C', ' OG ', 194.728, 92.297, 120.469], ['C', ' H ', 193.01, 89.875, 122.076], ['C', ' HA ', 195.896, 90.503, 121.831], ['C', ' HB ', 193.542, 92.322, 122.123], ['C', ' HB ', 195.152, 92.83, 122.358], ['C', ' HG ', 194.58, 93.227, 120.297]]
[['C', ' N ', 196.273, 91.114, 124.342], ['C', ' CA ', 196.559, 91.297, 125.749], ['C', ' C ', 195.849, 92.538, 126.241], ['C', ' O ', 195.56, 93.428, 125.446], ['C', ' CB ', 198.072, 91.451, 125.779], ['C', ' CG ', 198.408, 92.006, 124.453], ['C', ' CD ', 197.434, 91.358, 123.486], ['C', ' HA ', 196.232, 90.407, 126.309], ['C', ' HB ', 198.359, 92.129, 126.6], ['C', ' HB ', 198.551, 90.476, 125.977], ['C', ' HG ', 198.296, 93.079, 124.484], ['C', ' HG ', 199.454, 91.814, 124.235], ['C', ' HD ', 197.244, 92.073, 122.687], ['C', ' HD ', 197.809, 90.4, 123.11]]
[['C', ' N ', 195.669, 92.659, 127.539], ['C', ' CA ', 194.979, 93.824, 128.07], ['C', ' C ', 195.543, 95.138, 127.56], ['C', ' O ', 196.749, 95.393, 127.637], ['C', ' CB ', 195.142, 93.887, 129.586], ['C', ' CG ', 194.502, 92.768, 130.367], ['C', ' OD1', 193.808, 91.943, 129.815], ['C', ' OD2', 194.714, 92.739, 131.55], ['C', ' H ', 195.941, 91.914, 128.17], ['C', ' HA ', 193.919, 93.771, 127.794], ['C', ' HB ', 196.206, 93.901, 129.824], ['C', ' HB ', 194.727, 94.833, 129.941]]
[['C', ' N ', 194.644, 95.999, 127.084], ['C', ' CA ', 194.982, 97.323, 126.583], ['C', ' C ', 195.083, 97.377, 125.071], ['C', ' O ', 194.955, 98.453, 124.482], ['C', ' H ', 193.647, 95.716, 127.049], ['C', ' HA ', 194.23, 98.034, 126.927], ['C', ' HA ', 195.934, 97.627, 127.014]]
[['C', ' N ', 195.201, 96.221, 124.445], ['C', ' CA ', 195.323, 96.063, 123.006], ['C', ' C ', 194.065, 95.47, 122.432], ['C', ' O ', 193.378, 94.703, 123.101], ['C', ' CB ', 196.491, 95.143, 122.697], ['C', ' CG ', 197.801, 95.676, 122.97], ['C', ' CD1', 198.399, 95.78, 124.174], ['C', ' CD2', 198.75, 96.125, 122.01], ['C', ' NE1', 199.652, 96.282, 124.027], ['C', ' CE2', 199.881, 96.503, 122.706], ['C', ' CE3', 198.737, 96.223, 120.638], ['C', ' CZ2', 200.989, 96.989, 122.072], ['C', ' CZ3', 199.848, 96.703, 119.998], ['C', ' CH2', 200.943, 97.079, 120.696], ['C', ' H ', 195.251, 95.355, 124.997], ['C', ' HA ', 195.482, 97.024, 122.544], ['C', ' HB ', 196.407, 94.277, 123.318], ['C', ' HB ', 196.446, 94.823, 121.66], ['C', ' HD1', 197.943, 95.492, 125.129], ['C', ' HE1', 200.308, 96.445, 124.78], ['C', ' HE3', 197.867, 95.919, 120.078], ['C', ' HZ2', 201.883, 97.295, 122.617], ['C', ' HZ3', 199.834, 96.77, 118.924], ['C', ' HH2', 201.812, 97.46, 120.157]]
[['C', ' N ', 193.774, 95.748, 121.175], ['C', ' CA ', 192.628, 95.107, 120.557], ['C', ' C ', 192.981, 94.618, 119.162], ['C', ' O ', 193.959, 95.048, 118.558], ['C', ' CB ', 191.46, 96.062, 120.524], ['C', ' OG ', 191.748, 97.151, 119.736], ['C', ' H ', 194.323, 96.426, 120.637], ['C', ' HA ', 192.342, 94.245, 121.152], ['C', ' HB ', 190.58, 95.566, 120.142], ['C', ' HB ', 191.232, 96.393, 121.537], ['C', ' HG ', 190.998, 97.755, 119.837]]
[['C', ' N ', 192.234, 93.652, 118.684], ['C', ' CA ', 192.391, 93.084, 117.362], ['C', ' C ', 191.739, 94.003, 116.378], ['C', ' O ', 190.625, 94.46, 116.619], ['C', ' CB ', 191.732, 91.698, 117.292], ['C', ' OG1', 192.374, 90.833, 118.233], ['C', ' CG2', 191.833, 91.104, 115.876], ['C', ' H ', 191.463, 93.339, 119.246], ['C', ' HA ', 193.445, 92.997, 117.119], ['C', ' HB ', 190.68, 91.787, 117.566], ['C', ' HG1', 192.275, 91.214, 119.113], ['C', ' HG2', 191.368, 90.126, 115.861], ['C', ' HG2', 191.327, 91.745, 115.16], ['C', ' HG2', 192.869, 91.01, 115.593]]
[['C', ' N ', 192.423, 94.289, 115.284], ['C', ' CA ', 191.895, 95.122, 114.228], ['C', ' C ', 191.894, 94.389, 112.909], ['C', ' O ', 192.949, 93.986, 112.407], ['C', ' CB ', 192.797, 96.346, 114.032], ['C', ' CG1', 192.251, 97.26, 112.931], ['C', ' CG2', 192.965, 97.052, 115.292], ['C', ' H ', 193.354, 93.901, 115.182], ['C', ' HA ', 190.876, 95.414, 114.472], ['C', ' HB ', 193.765, 96.007, 113.702], ['C', ' HG1', 192.926, 98.102, 112.795], ['C', ' HG1', 192.17, 96.722, 111.988], ['C', ' HG1', 191.268, 97.627, 113.22], ['C', ' HG2', 193.625, 97.88, 115.107], ['C', ' HG2', 192.008, 97.408, 115.646], ['C', ' HG2', 193.406, 96.398, 116.048]]
[['C', ' N ', 190.737, 94.27, 112.302], ['C', ' CA ', 190.681, 93.631, 111.017], ['C', ' C ', 190.242, 94.62, 109.971], ['C', ' O ', 189.151, 95.185, 110.065], ['C', ' CB ', 189.686, 92.472, 110.986], ['C', ' CG1', 190.044, 91.435, 112.045], ['C', ' CG2', 189.728, 91.884, 109.578], ['C', ' CD1', 189.044, 90.332, 112.208], ['C', ' H ', 189.891, 94.596, 112.772], ['C', ' HA ', 191.67, 93.265, 110.745], ['C', ' HB ', 188.68, 92.822, 111.218], ['C', ' HG1', 190.945, 91.01, 111.829], ['C', ' HG1', 190.126, 91.941, 112.997], ['C', ' HG2', 189.086, 91.065, 109.5], ['C', ' HG2', 189.43, 92.619, 108.837], ['C', ' HG2', 190.715, 91.561, 109.346], ['C', ' HD1', 189.381, 89.667, 112.996], ['C', ' HD1', 188.084, 90.761, 112.48], ['C', ' HD1', 188.942, 89.766, 111.296]]
[['C', ' N ', 191.057, 94.815, 108.949], ['C', ' CA ', 190.672, 95.723, 107.884], ['C', ' C ', 190.165, 94.857, 106.748], ['C', ' O ', 190.807, 93.867, 106.35], ['C', ' CB ', 191.849, 96.598, 107.463], ['C', ' OG1', 192.931, 95.751, 107.085], ['C', ' CG2', 192.273, 97.489, 108.638], ['C', ' H ', 191.958, 94.32, 108.912], ['C', ' HA ', 189.861, 96.368, 108.217], ['C', ' HB ', 191.558, 97.203, 106.621], ['C', ' HG1', 193.613, 96.234, 106.615], ['C', ' HG2', 193.118, 98.104, 108.363], ['C', ' HG2', 191.441, 98.129, 108.919], ['C', ' HG2', 192.553, 96.867, 109.483]]
[['C', ' N ', 188.965, 95.178, 106.278], ['C', ' CA ', 188.27, 94.389, 105.282], ['C', ' C ', 187.483, 95.142, 104.218], ['C', ' O ', 186.287, 95.323, 104.382], ['C', ' CB ', 187.343, 93.45, 105.987], ['C', ' CG ', 186.41, 94.085, 106.966], ['C', ' CD ', 185.365, 93.175, 107.269], ['C', ' NE ', 185.882, 91.97, 107.817], ['C', ' CZ ', 186.135, 91.77, 109.098], ['C', ' NH1', 185.898, 92.724, 109.969], ['C', ' NH2', 186.621, 90.625, 109.46], ['C', ' H ', 188.488, 96.026, 106.606], ['C', ' HA ', 189.017, 93.792, 104.764], ['C', ' HB ', 186.76, 92.885, 105.264], ['C', ' HB ', 187.935, 92.747, 106.562], ['C', ' HG ', 186.963, 94.286, 107.882], ['C', ' HG ', 185.992, 95.0, 106.629], ['C', ' HD ', 184.649, 93.62, 107.959], ['C', ' HD ', 184.854, 92.931, 106.342], ['C', ' HE ', 186.108, 91.22, 107.148], ['C', ' HH1', 185.52, 93.608, 109.653], ['C', ' HH1', 186.11, 92.626, 110.96], ['C', ' HH2', 186.807, 89.918, 108.763], ['C', ' HH2', 186.827, 90.449, 110.428]]
[['C', ' N ', 188.119, 95.515, 103.119], ['C', ' CA ', 187.553, 96.335, 102.027], ['C', ' C ', 188.318, 97.611, 101.991], ['C', ' O ', 188.505, 98.266, 103.029], ['C', ' CB ', 186.035, 96.701, 102.141], ['C', ' OG1', 185.248, 95.524, 102.163], ['C', ' CG2', 185.577, 97.543, 100.95], ['C', ' H ', 189.095, 95.269, 103.049], ['C', ' HA ', 187.706, 95.822, 101.078], ['C', ' HB ', 185.856, 97.286, 103.05], ['C', ' HG1', 185.354, 95.165, 103.039], ['C', ' HG2', 184.517, 97.766, 101.065], ['C', ' HG2', 186.125, 98.476, 100.901], ['C', ' HG2', 185.726, 96.984, 100.026]]
[['C', ' N ', 188.773, 97.965, 100.788], ['C', ' CA ', 189.552, 99.161, 100.655], ['C', ' C ', 188.682, 100.287, 101.145], ['C', ' O ', 187.629, 100.563, 100.568], ['C', ' CB ', 189.912, 99.412, 99.192], ['C', ' CG ', 190.855, 98.355, 98.57], ['C', ' OD1', 191.324, 97.457, 99.26], ['C', ' OD2', 191.105, 98.462, 97.399], ['C', ' H ', 188.595, 97.386, 99.98], ['C', ' HA ', 190.449, 99.09, 101.261], ['C', ' HB ', 188.998, 99.447, 98.601], ['C', ' HB ', 190.385, 100.391, 99.108]]
[['C', ' N ', 189.156, 100.931, 102.191], ['C', ' CA ', 188.514, 102.012, 102.928], ['C', ' C ', 188.971, 101.899, 104.359], ['C', ' O ', 189.449, 102.87, 104.955], ['C', ' CB ', 186.983, 101.961, 102.893], ['C', ' H ', 190.058, 100.585, 102.532], ['C', ' HA ', 188.855, 102.964, 102.528], ['C', ' HB ', 186.589, 102.776, 103.499], ['C', ' HB ', 186.594, 102.076, 101.897], ['C', ' HB ', 186.633, 101.014, 103.305]]
[['C', ' N ', 188.762, 100.705, 104.926], ['C', ' CA ', 189.12, 100.431, 106.306], ['C', ' C ', 190.618, 100.353, 106.464], ['C', ' O ', 191.18, 100.799, 107.468], ['C', ' H ', 188.392, 99.933, 104.356], ['C', ' HA ', 188.71, 101.201, 106.958], ['C', ' HA ', 188.678, 99.485, 106.604]]
[['C', ' N ', 191.277, 99.802, 105.451], ['C', ' CA ', 192.706, 99.636, 105.501], ['C', ' C ', 193.345, 100.955, 105.24], ['C', ' O ', 194.372, 101.262, 105.814], ['C', ' CB ', 193.144, 98.663, 104.434], ['C', ' CG ', 192.694, 99.172, 103.109], ['C', ' OD1', 191.63, 99.838, 103.087], ['C', ' OD2', 193.379, 98.962, 102.136], ['C', ' H ', 190.772, 99.484, 104.622], ['C', ' HA ', 193.009, 99.295, 106.483], ['C', ' HB ', 194.23, 98.562, 104.443], ['C', ' HB ', 192.708, 97.683, 104.607]]
[['C', ' N ', 192.689, 101.749, 104.422], ['C', ' CA ', 193.183, 103.042, 104.05], ['C', ' C ', 193.186, 103.938, 105.254], ['C', ' O ', 194.22, 104.505, 105.593], ['C', ' CB ', 192.32, 103.625, 102.959], ['C', ' OG ', 192.774, 104.891, 102.586], ['C', ' H ', 191.871, 101.35, 103.983], ['C', ' HA ', 194.203, 102.937, 103.684], ['C', ' HB ', 192.322, 102.956, 102.101], ['C', ' HB ', 191.297, 103.699, 103.312], ['C', ' HG ', 192.202, 105.176, 101.872]]
[['C', ' N ', 192.082, 104.008, 105.981], ['C', ' CA ', 192.11, 104.893, 107.119], ['C', ' C ', 193.025, 104.388, 108.217], ['C', ' O ', 193.647, 105.182, 108.917], ['C', ' CB ', 190.702, 105.182, 107.66], ['C', ' CG1', 190.723, 106.355, 108.693], ['C', ' CG2', 190.092, 103.955, 108.281], ['C', ' CD1', 191.129, 107.704, 108.158], ['C', ' H ', 191.232, 103.516, 105.689], ['C', ' HA ', 192.517, 105.833, 106.764], ['C', ' HB ', 190.071, 105.492, 106.829], ['C', ' HG1', 189.729, 106.444, 109.095], ['C', ' HG1', 191.393, 106.125, 109.496], ['C', ' HG2', 189.115, 104.195, 108.619], ['C', ' HG2', 190.039, 103.168, 107.547], ['C', ' HG2', 190.659, 103.613, 109.115], ['C', ' HD1', 191.08, 108.435, 108.958], ['C', ' HD1', 192.143, 107.689, 107.776], ['C', ' HD1', 190.461, 107.982, 107.371]]
[['C', ' N ', 193.104, 103.068, 108.41], ['C', ' CA ', 193.976, 102.574, 109.446], ['C', ' C ', 195.434, 102.802, 109.032], ['C', ' O ', 196.234, 103.271, 109.822], ['C', ' CB ', 193.671, 101.116, 109.76], ['C', ' CG ', 194.346, 100.636, 110.995], ['C', ' CD1', 193.894, 101.069, 112.234], ['C', ' CD2', 195.405, 99.773, 110.95], ['C', ' CE1', 194.488, 100.663, 113.392], ['C', ' CE2', 196.006, 99.358, 112.118], ['C', ' CZ ', 195.544, 99.809, 113.336], ['C', ' H ', 192.546, 102.408, 107.863], ['C', ' HA ', 193.804, 103.146, 110.348], ['C', ' HB ', 192.591, 100.985, 109.876], ['C', ' HB ', 193.985, 100.496, 108.921], ['C', ' HD1', 193.061, 101.747, 112.275], ['C', ' HD2', 195.776, 99.423, 109.985], ['C', ' HE1', 194.12, 101.024, 114.358], ['C', ' HE2', 196.853, 98.682, 112.079], ['C', ' HZ ', 196.026, 99.485, 114.243]]
[['C', ' N ', 195.778, 102.547, 107.771], ['C', ' CA ', 197.137, 102.744, 107.272], ['C', ' C ', 197.527, 104.214, 107.154], ['C', ' O ', 198.712, 104.53, 107.143], ['C', ' CB ', 197.356, 102.042, 105.943], ['C', ' CG ', 197.398, 100.553, 106.077], ['C', ' CD ', 197.606, 99.867, 104.746], ['C', ' CE ', 197.546, 98.37, 104.932], ['C', ' NZ ', 198.673, 97.862, 105.764], ['C', ' H ', 195.094, 102.176, 107.126], ['C', ' HA ', 197.818, 102.297, 107.996], ['C', ' HB ', 196.56, 102.316, 105.25], ['C', ' HB ', 198.296, 102.376, 105.509], ['C', ' HG ', 198.219, 100.302, 106.742], ['C', ' HG ', 196.477, 100.199, 106.531], ['C', ' HD ', 196.816, 100.172, 104.053], ['C', ' HD ', 198.571, 100.144, 104.325], ['C', ' HE ', 196.61, 98.125, 105.434], ['C', ' HE ', 197.565, 97.872, 103.964], ['C', ' HZ ', 198.547, 96.854, 105.89], ['C', ' HZ ', 199.556, 98.047, 105.321], ['C', ' HZ ', 198.654, 98.292, 106.668]]
[['C', ' N ', 196.556, 105.127, 107.092], ['C', ' CA ', 196.86, 106.557, 107.114], ['C', ' C ', 197.189, 106.981, 108.54], ['C', ' O ', 197.595, 108.119, 108.778], ['C', ' CB ', 195.709, 107.398, 106.58], ['C', ' CG ', 195.468, 107.285, 105.1], ['C', ' CD ', 194.194, 107.977, 104.697], ['C', ' OE1', 193.402, 108.382, 105.553], ['C', ' NE2', 193.985, 108.124, 103.4], ['C', ' H ', 195.582, 104.836, 106.963], ['C', ' HA ', 197.74, 106.738, 106.498], ['C', ' HB ', 194.792, 107.092, 107.089], ['C', ' HB ', 195.88, 108.447, 106.817], ['C', ' HG ', 196.287, 107.798, 104.602], ['C', ' HG ', 195.453, 106.266, 104.777], ['C', ' HE2', 193.155, 108.577, 103.074], ['C', ' HE2', 194.654, 107.779, 102.739]]
[['C', ' N ', 196.945, 106.077, 109.475], ['C', ' CA ', 197.206, 106.173, 110.876], ['C', ' C ', 198.298, 105.129, 111.058], ['C', ' O ', 198.798, 104.614, 110.062], ['C', ' CB ', 195.972, 105.938, 111.714], ['C', ' H ', 196.619, 105.157, 109.192], ['C', ' HA ', 197.621, 107.156, 111.106], ['C', ' HB ', 196.241, 106.011, 112.747], ['C', ' HB ', 195.245, 106.683, 111.488], ['C', ' HB ', 195.556, 104.957, 111.498]]
[['C', ' N ', 198.755, 104.88, 112.279], ['C', ' CA ', 199.89, 103.971, 112.584], ['C', ' C ', 201.15, 104.795, 112.264], ['C', ' O ', 202.011, 104.997, 113.12], ['C', ' CB ', 199.857, 102.613, 111.834], ['C', ' CG1', 201.119, 101.838, 112.163], ['C', ' CG2', 198.593, 101.827, 112.236], ['C', ' H ', 198.315, 105.384, 113.026], ['C', ' HA ', 199.901, 103.754, 113.651], ['C', ' HB ', 199.868, 102.762, 110.772], ['C', ' HG1', 201.107, 100.887, 111.636], ['C', ' HG1', 201.996, 102.406, 111.857], ['C', ' HG1', 201.16, 101.661, 113.239], ['C', ' HG2', 198.579, 100.878, 111.706], ['C', ' HG2', 198.594, 101.639, 113.3], ['C', ' HG2', 197.701, 102.397, 111.967]]
[['C', ' N ', 201.241, 105.3, 111.033], ['C', ' CA ', 202.216, 106.327, 110.746], ['C', ' C ', 201.416, 107.44, 111.364], ['C', ' O ', 200.308, 107.137, 111.777], ['C', ' CB ', 202.451, 106.556, 109.261], ['C', ' CG ', 201.261, 107.147, 108.491], ['C', ' CD ', 201.613, 107.395, 107.069], ['C', ' OE1', 202.641, 106.914, 106.652], ['C', ' OE2', 200.897, 108.099, 106.397], ['C', ' H ', 200.551, 105.01, 110.34], ['C', ' HA ', 203.147, 106.179, 111.292], ['C', ' HB ', 203.3, 107.223, 109.127], ['C', ' HB ', 202.703, 105.606, 108.789], ['C', ' HG ', 200.424, 106.441, 108.531], ['C', ' HG ', 200.926, 108.078, 108.933]]
[['C', ' N ', 201.856, 108.698, 111.447], ['C', ' CA ', 200.957, 109.613, 112.174], ['C', ' C ', 200.601, 108.876, 113.472], ['C', ' O ', 199.43, 108.604, 113.746], ['C', ' CB ', 199.706, 109.963, 111.359], ['C', ' H ', 202.747, 108.983, 111.068], ['C', ' HA ', 201.498, 110.526, 112.421], ['C', ' HB ', 199.067, 110.621, 111.946], ['C', ' HB ', 200.001, 110.468, 110.441], ['C', ' HB ', 199.137, 109.077, 111.095]]
[['C', ' N ', 201.651, 108.514, 114.223], ['C', ' CA ', 201.659, 107.567, 115.349], ['C', ' C ', 200.673, 107.693, 116.504], ['C', ' O ', 201.065, 107.739, 117.675], ['C', ' H ', 202.548, 108.863, 113.922], ['C', ' HA ', 201.542, 106.568, 114.929], ['C', ' HA ', 202.663, 107.568, 115.769]]
[['C', ' N ', 199.393, 107.612, 116.165], ['C', ' CA ', 198.3, 107.533, 117.106], ['C', ' C ', 198.057, 106.08, 117.457], ['C', ' O ', 197.287, 105.769, 118.359], ['C', ' CB ', 197.031, 108.099, 116.486], ['C', ' CG ', 197.061, 109.572, 116.087], ['C', ' CD1', 195.785, 109.882, 115.401], ['C', ' CD2', 197.25, 110.466, 117.309], ['C', ' H ', 199.177, 107.665, 115.179], ['C', ' HA ', 198.557, 108.071, 118.011], ['C', ' HB ', 196.811, 107.52, 115.588], ['C', ' HB ', 196.212, 107.955, 117.189], ['C', ' HG ', 197.875, 109.748, 115.386], ['C', ' HD1', 195.792, 110.923, 115.091], ['C', ' HD1', 195.692, 109.237, 114.531], ['C', ' HD1', 194.947, 109.709, 116.076], ['C', ' HD2', 197.254, 111.509, 116.991], ['C', ' HD2', 196.433, 110.306, 118.015], ['C', ' HD2', 198.196, 110.246, 117.796]]
[['C', ' N ', 198.684, 105.178, 116.708], ['C', ' CA ', 198.558, 103.75, 116.944], ['C', ' C ', 199.883, 103.061, 116.901], ['C', ' O ', 200.778, 103.434, 116.143], ['C', ' CB ', 197.7, 103.004, 115.931], ['C', ' CG ', 196.377, 103.438, 115.855], ['C', ' CD1', 195.924, 104.044, 114.748], ['C', ' CD2', 195.57, 103.302, 116.913], ['C', ' CE1', 194.658, 104.499, 114.697], ['C', ' CE2', 194.325, 103.766, 116.879], ['C', ' CZ ', 193.874, 104.354, 115.77], ['C', ' H ', 199.307, 105.517, 115.994], ['C', ' HA ', 198.136, 103.602, 117.933], ['C', ' HB ', 198.134, 103.098, 114.966], ['C', ' HB ', 197.695, 101.941, 116.182], ['C', ' HD1', 196.586, 104.146, 113.901], ['C', ' HD2', 195.948, 102.822, 117.799], ['C', ' HE1', 194.277, 104.984, 113.801], ['C', ' HE2', 193.686, 103.667, 117.75], ['C', ' HZ ', 192.91, 104.703, 115.746]]
[['C', ' N ', 199.959, 101.981, 117.634], ['C', ' CA ', 201.079, 101.08, 117.525], ['C', ' C ', 200.463, 99.747, 117.207], ['C', ' O ', 199.326, 99.479, 117.604], ['C', ' CB ', 201.953, 101.08, 118.772], ['C', ' CG ', 201.284, 100.734, 120.066], ['C', ' CD ', 202.287, 100.758, 121.189], ['C', ' OE1', 203.439, 100.962, 120.901], ['C', ' OE2', 201.914, 100.583, 122.33], ['C', ' H ', 199.191, 101.789, 118.285], ['C', ' HA ', 201.704, 101.373, 116.68], ['C', ' HB ', 202.774, 100.378, 118.631], ['C', ' HB ', 202.393, 102.071, 118.891], ['C', ' HG ', 200.494, 101.459, 120.27], ['C', ' HG ', 200.827, 99.764, 119.989]]
[['C', ' N ', 201.172, 98.919, 116.457], ['C', ' CA ', 200.568, 97.669, 116.032], ['C', ' C ', 201.536, 96.514, 115.855], ['C', ' O ', 202.728, 96.717, 115.602], ['C', ' CB ', 199.779, 97.926, 114.743], ['C', ' OG1', 199.085, 96.769, 114.389], ['C', ' CG2', 200.674, 98.324, 113.617], ['C', ' H ', 202.11, 99.162, 116.168], ['C', ' HA ', 199.859, 97.367, 116.789], ['C', ' HB ', 199.061, 98.725, 114.921], ['C', ' HG1', 198.471, 96.543, 115.118], ['C', ' HG2', 200.072, 98.502, 112.727], ['C', ' HG2', 201.208, 99.232, 113.881], ['C', ' HG2', 201.389, 97.529, 113.415]]
[['C', ' N ', 201.002, 95.303, 116.001], ['C', ' CA ', 201.75, 94.061, 115.853], ['C', ' C ', 200.996, 93.113, 114.906], ['C', ' O ', 199.772, 93.052, 114.952], ['C', ' CB ', 201.849, 93.36, 117.214], ['C', ' CG ', 202.479, 94.15, 118.354], ['C', ' CD ', 203.954, 94.344, 118.183], ['C', ' CE ', 204.552, 95.04, 119.392], ['C', ' NZ ', 206.017, 95.28, 119.224], ['C', ' H ', 199.997, 95.277, 116.2], ['C', ' HA ', 202.732, 94.298, 115.47], ['C', ' HB ', 200.857, 93.07, 117.532], ['C', ' HB ', 202.42, 92.434, 117.1], ['C', ' HG ', 202.006, 95.126, 118.415], ['C', ' HG ', 202.293, 93.631, 119.289], ['C', ' HD ', 204.44, 93.375, 118.043], ['C', ' HD ', 204.143, 94.959, 117.302], ['C', ' HE ', 204.049, 95.997, 119.539], ['C', ' HE ', 204.394, 94.419, 120.275], ['C', ' HZ ', 206.383, 95.743, 120.045], ['C', ' HZ ', 206.492, 94.395, 119.096], ['C', ' HZ ', 206.171, 95.865, 118.412]]
[['C', ' N ', 201.653, 92.279, 114.095], ['C', ' CA ', 200.987, 91.292, 113.265], ['C', ' C ', 200.183, 90.431, 114.202], ['C', ' O ', 200.701, 90.068, 115.252], ['C', ' CB ', 202.156, 90.514, 112.668], ['C', ' CG ', 203.31, 91.495, 112.692], ['C', ' CD ', 203.111, 92.306, 113.962], ['C', ' HA ', 200.356, 91.774, 112.506], ['C', ' HB ', 202.352, 89.61, 113.267], ['C', ' HB ', 201.895, 90.165, 111.654], ['C', ' HG ', 204.27, 90.939, 112.706], ['C', ' HG ', 203.313, 92.11, 111.783], ['C', ' HD ', 203.597, 91.819, 114.831], ['C', ' HD ', 203.496, 93.313, 113.768]]
[['C', ' N ', 198.988, 90.009, 113.825], ['C', ' CA ', 198.168, 89.217, 114.74], ['C', ' C ', 198.775, 87.869, 115.127], ['C', ' O ', 198.351, 87.241, 116.092], ['C', ' CB ', 196.761, 89.04, 114.181], ['C', ' CG1', 195.718, 88.652, 115.284], ['C', ' CG2', 196.754, 88.008, 113.06], ['C', ' CD1', 195.461, 89.743, 116.335], ['C', ' H ', 198.589, 90.284, 112.917], ['C', ' HA ', 198.098, 89.802, 115.657], ['C', ' HB ', 196.464, 89.978, 113.785], ['C', ' HG1', 194.782, 88.463, 114.799], ['C', ' HG1', 196.024, 87.748, 115.799], ['C', ' HG2', 195.758, 87.933, 112.653], ['C', ' HG2', 197.443, 88.315, 112.273], ['C', ' HG2', 197.054, 87.032, 113.43], ['C', ' HD1', 194.697, 89.4, 117.037], ['C', ' HD1', 196.36, 89.958, 116.896], ['C', ' HD1', 195.12, 90.653, 115.849]]
[['C', ' N ', 199.701, 87.369, 114.328], ['C', ' CA ', 200.373, 86.116, 114.616], ['C', ' C ', 201.298, 86.219, 115.835], ['C', ' O ', 201.688, 85.2, 116.418], ['C', ' CB ', 201.153, 85.667, 113.392], ['C', ' CG ', 200.259, 85.387, 112.198], ['C', ' CD ', 199.877, 86.635, 111.474], ['C', ' OE1', 200.441, 87.665, 111.785], ['C', ' OE2', 199.019, 86.582, 110.634], ['C', ' H ', 199.984, 87.909, 113.502], ['C', ' HA ', 199.609, 85.369, 114.832], ['C', ' HB ', 201.879, 86.434, 113.119], ['C', ' HB ', 201.705, 84.757, 113.624], ['C', ' HG ', 200.779, 84.721, 111.513], ['C', ' HG ', 199.356, 84.882, 112.543]]
[['C', ' N ', 201.687, 87.442, 116.19], ['C', ' CA ', 202.581, 87.701, 117.302], ['C', ' C ', 201.756, 88.168, 118.488], ['C', ' O ', 200.757, 88.848, 118.292], ['C', ' CB ', 203.591, 88.791, 116.934], ['C', ' CG ', 204.503, 88.456, 115.765], ['C', ' CD ', 205.502, 89.553, 115.486], ['C', ' OE1', 205.569, 90.475, 116.265], ['C', ' OE2', 206.182, 89.477, 114.49], ['C', ' H ', 201.308, 88.253, 115.694], ['C', ' HA ', 203.104, 86.783, 117.568], ['C', ' HB ', 203.05, 89.706, 116.679], ['C', ' HB ', 204.216, 89.011, 117.797], ['C', ' HG ', 205.034, 87.532, 115.98], ['C', ' HG ', 203.89, 88.297, 114.878]]
[['C', ' N ', 202.226, 87.877, 119.706], ['C', ' CA ', 201.605, 88.313, 120.968], ['C', ' C ', 200.319, 87.539, 121.246], ['C', ' O ', 199.256, 87.881, 120.747], ['C', ' CB ', 201.294, 89.833, 120.964], ['C', ' CG1', 200.665, 90.22, 122.267], ['C', ' CG2', 202.566, 90.637, 120.704], ['C', ' H ', 203.058, 87.307, 119.755], ['C', ' HA ', 202.306, 88.113, 121.779], ['C', ' HB ', 200.557, 90.059, 120.21], ['C', ' HG1', 200.433, 91.278, 122.233], ['C', ' HG1', 199.759, 89.655, 122.423], ['C', ' HG1', 201.355, 90.02, 123.085], ['C', ' HG2', 202.323, 91.694, 120.707], ['C', ' HG2', 203.294, 90.428, 121.484], ['C', ' HG2', 202.989, 90.373, 119.738]]
[['C', ' N ', 200.409, 86.508, 122.074], ['C', ' CA ', 199.287, 85.598, 122.226], ['C', ' C ', 198.21, 86.182, 123.162], ['C', ' O ', 198.548, 86.981, 124.037], ['C', ' CB ', 199.782, 84.251, 122.751], ['C', ' CG ', 200.85, 83.584, 121.875], ['C', ' CD ', 200.368, 83.267, 120.45], ['C', ' CE ', 201.437, 82.483, 119.687], ['C', ' NZ ', 201.081, 82.265, 118.253], ['C', ' H ', 201.287, 86.318, 122.531], ['C', ' HA ', 198.88, 85.465, 121.244], ['C', ' HB ', 200.206, 84.388, 123.745], ['C', ' HB ', 198.962, 83.557, 122.847], ['C', ' HG ', 201.72, 84.234, 121.812], ['C', ' HG ', 201.158, 82.653, 122.352], ['C', ' HD ', 199.445, 82.69, 120.488], ['C', ' HD ', 200.181, 84.192, 119.9], ['C', ' HE ', 202.377, 83.032, 119.736], ['C', ' HE ', 201.57, 81.513, 120.167], ['C', ' HZ ', 201.82, 81.745, 117.8], ['C', ' HZ ', 200.22, 81.745, 118.188], ['C', ' HZ ', 200.973, 83.17, 117.783]]
[['C', ' N ', 196.927, 85.746, 123.06], ['C', ' CA ', 196.305, 84.682, 122.255], ['C', ' C ', 196.48, 84.975, 120.796], ['C', ' O ', 196.539, 86.127, 120.425], ['C', ' CB ', 194.821, 84.802, 122.621], ['C', ' CG ', 194.809, 85.486, 123.957], ['C', ' CD ', 195.968, 86.459, 123.892], ['C', ' HA ', 196.707, 83.701, 122.521], ['C', ' HB ', 194.281, 85.37, 121.847], ['C', ' HB ', 194.369, 83.802, 122.648], ['C', ' HG ', 193.842, 86.008, 124.088], ['C', ' HG ', 194.897, 84.758, 124.773], ['C', ' HD ', 195.663, 87.395, 123.383], ['C', ' HD ', 196.383, 86.653, 124.89]]
[['C', ' N ', 196.609, 83.962, 119.965], ['C', ' CA ', 196.805, 84.283, 118.566], ['C', ' C ', 195.472, 84.424, 117.87], ['C', ' O ', 194.412, 84.298, 118.49], ['C', ' H ', 196.553, 83.003, 120.277], ['C', ' HA ', 197.373, 85.213, 118.471], ['C', ' HA ', 197.391, 83.501, 118.087]]
[['C', ' N ', 195.51, 84.563, 116.549], ['C', ' CA ', 194.294, 84.73, 115.769], ['C', ' C ', 193.355, 83.559, 115.964], ['C', ' O ', 192.136, 83.745, 116.008], ['C', ' CB ', 194.602, 84.873, 114.277], ['C', ' CG ', 193.376, 85.13, 113.333], ['C', ' CD1', 192.669, 86.426, 113.704], ['C', ' CD2', 193.855, 85.188, 111.895], ['C', ' H ', 196.407, 84.618, 116.083], ['C', ' HA ', 193.807, 85.634, 116.125], ['C', ' HB ', 195.291, 85.691, 114.153], ['C', ' HB ', 195.089, 83.96, 113.936], ['C', ' HG ', 192.667, 84.318, 113.431], ['C', ' HD1', 191.842, 86.572, 113.034], ['C', ' HD1', 192.295, 86.391, 114.718], ['C', ' HD1', 193.355, 87.237, 113.601], ['C', ' HD2', 193.0, 85.347, 111.235], ['C', ' HD2', 194.566, 86.001, 111.769], ['C', ' HD2', 194.335, 84.24, 111.639]]
[['C', ' N ', 193.92, 82.37, 116.166], ['C', ' CA ', 193.146, 81.157, 116.321], ['C', ' C ', 192.068, 81.28, 117.392], ['C', ' O ', 191.033, 80.626, 117.284], ['C', ' H ', 194.925, 82.289, 116.131], ['C', ' HA ', 192.693, 80.899, 115.365], ['C', ' HA ', 193.814, 80.336, 116.574]]
[['C', ' N ', 192.271, 82.091, 118.432], ['C', ' CA ', 191.218, 82.187, 119.422], ['C', ' C ', 189.996, 82.854, 118.817], ['C', ' O ', 188.864, 82.503, 119.146], ['C', ' CB ', 191.673, 82.945, 120.666], ['C', ' CG ', 190.618, 83.067, 121.81], ['C', ' CD1', 190.147, 81.688, 122.282], ['C', ' CD2', 191.241, 83.819, 122.96], ['C', ' H ', 193.121, 82.657, 118.529], ['C', ' HA ', 190.953, 81.174, 119.707], ['C', ' HB ', 192.551, 82.449, 121.069], ['C', ' HB ', 191.964, 83.958, 120.367], ['C', ' HG ', 189.757, 83.611, 121.452], ['C', ' HD1', 189.419, 81.818, 123.083], ['C', ' HD1', 189.67, 81.144, 121.473], ['C', ' HD1', 190.996, 81.117, 122.654], ['C', ' HD2', 190.512, 83.931, 123.759], ['C', ' HD2', 192.102, 83.273, 123.333], ['C', ' HD2', 191.554, 84.797, 122.619]]
[['C', ' N ', 190.21, 83.838, 117.955], ['C', ' CA ', 189.113, 84.546, 117.342], ['C', ' C ', 188.424, 83.622, 116.385], ['C', ' O ', 187.2, 83.66, 116.26], ['C', ' CB ', 189.596, 85.823, 116.66], ['C', ' CG ', 188.525, 86.707, 115.999], ['C', ' CD1', 187.469, 87.119, 116.997], ['C', ' CD2', 189.196, 87.946, 115.461], ['C', ' H ', 191.16, 84.06, 117.663], ['C', ' HA ', 188.402, 84.792, 118.11], ['C', ' HB ', 190.127, 86.425, 117.396], ['C', ' HB ', 190.304, 85.536, 115.883], ['C', ' HG ', 188.044, 86.159, 115.185], ['C', ' HD1', 186.751, 87.753, 116.502], ['C', ' HD1', 186.948, 86.254, 117.396], ['C', ' HD1', 187.922, 87.667, 117.802], ['C', ' HD2', 188.45, 88.579, 114.983], ['C', ' HD2', 189.66, 88.486, 116.281], ['C', ' HD2', 189.956, 87.672, 114.738]]
[['C', ' N ', 189.216, 82.796, 115.712], ['C', ' CA ', 188.682, 81.831, 114.77], ['C', ' C ', 187.781, 80.833, 115.504], ['C', ' O ', 186.802, 80.367, 114.932], ['C', ' CB ', 189.803, 81.093, 114.053], ['C', ' CG ', 190.617, 81.951, 113.092], ['C', ' CD ', 191.798, 81.205, 112.532], ['C', ' OE1', 192.049, 80.13, 113.022], ['C', ' OE2', 192.453, 81.692, 111.639], ['C', ' H ', 190.228, 82.882, 115.864], ['C', ' HA ', 188.083, 82.36, 114.03], ['C', ' HB ', 190.467, 80.659, 114.782], ['C', ' HB ', 189.378, 80.27, 113.479], ['C', ' HG ', 189.975, 82.266, 112.275], ['C', ' HG ', 190.951, 82.835, 113.62]]
[['C', ' N ', 188.138, 80.48, 116.755], ['C', ' CA ', 187.316, 79.602, 117.592], ['C', ' C ', 186.038, 80.275, 118.086], ['C', ' O ', 184.986, 79.643, 118.088], ['C', ' CB ', 188.076, 79.109, 118.82], ['C', ' CG ', 189.16, 78.11, 118.555], ['C', ' CD ', 189.86, 77.72, 119.852], ['C', ' CE ', 190.981, 76.725, 119.606], ['C', ' NZ ', 191.695, 76.368, 120.866], ['C', ' H ', 189.032, 80.827, 117.106], ['C', ' HA ', 187.021, 78.742, 116.991], ['C', ' HB ', 188.535, 79.962, 119.316], ['C', ' HB ', 187.371, 78.669, 119.525], ['C', ' HG ', 188.725, 77.223, 118.097], ['C', ' HG ', 189.881, 78.529, 117.863], ['C', ' HD ', 190.278, 78.616, 120.316], ['C', ' HD ', 189.138, 77.28, 120.538], ['C', ' HE ', 190.565, 75.82, 119.167], ['C', ' HE ', 191.695, 77.162, 118.906], ['C', ' HZ ', 192.433, 75.707, 120.66], ['C', ' HZ ', 192.096, 77.201, 121.276], ['C', ' HZ ', 191.046, 75.952, 121.519]]
[['C', ' N ', 186.101, 81.56, 118.493], ['C', ' CA ', 184.866, 82.21, 118.955], ['C', ' C ', 183.933, 82.365, 117.769], ['C', ' O ', 182.719, 82.13, 117.866], ['C', ' CB ', 185.141, 83.588, 119.553], ['C', ' CG ', 185.423, 83.646, 121.052], ['C', ' CD1', 186.676, 82.885, 121.4], ['C', ' CD2', 185.567, 85.08, 121.432], ['C', ' H ', 187.008, 82.035, 118.538], ['C', ' HA ', 184.385, 81.573, 119.695], ['C', ' HB ', 186.008, 84.01, 119.038], ['C', ' HB ', 184.283, 84.23, 119.346], ['C', ' HG ', 184.599, 83.191, 121.594], ['C', ' HD1', 186.855, 82.949, 122.472], ['C', ' HD1', 186.584, 81.84, 121.121], ['C', ' HD1', 187.501, 83.328, 120.88], ['C', ' HD2', 185.762, 85.165, 122.499], ['C', ' HD2', 186.389, 85.489, 120.882], ['C', ' HD2', 184.67, 85.622, 121.188]]
[['C', ' N ', 184.517, 82.739, 116.639], ['C', ' CA ', 183.821, 82.807, 115.388], ['C', ' C ', 183.648, 81.35, 115.111], ['C', ' O ', 184.212, 80.562, 115.834], ['C', ' CB ', 184.602, 83.546, 114.317], ['C', ' H ', 185.512, 82.973, 116.639], ['C', ' HA ', 182.842, 83.269, 115.526], ['C', ' HB ', 184.058, 83.514, 113.376], ['C', ' HB ', 184.746, 84.581, 114.623], ['C', ' HB ', 185.574, 83.068, 114.194]]
[['C', ' N ', 182.793, 80.933, 114.22], ['C', ' CA ', 182.616, 79.489, 113.985], ['C', ' C ', 181.814, 78.854, 115.119], ['C', ' O ', 180.732, 78.349, 114.852], ['C', ' CB ', 183.936, 78.739, 113.791], ['C', ' H ', 182.302, 81.605, 113.653], ['C', ' HA ', 182.051, 79.375, 113.064], ['C', ' HB ', 183.708, 77.701, 113.566], ['C', ' HB ', 184.472, 79.178, 112.954], ['C', ' HB ', 184.589, 78.741, 114.647]]
[['C', ' N ', 182.253, 78.911, 116.384], ['C', ' CA ', 181.377, 78.369, 117.413], ['C', ' C ', 180.097, 79.172, 117.459], ['C', ' O ', 179.009, 78.602, 117.558], ['C', ' CB ', 182.016, 78.417, 118.791], ['C', ' CG ', 183.138, 77.455, 119.026], ['C', ' CD ', 183.791, 77.72, 120.373], ['C', ' OE1', 183.446, 78.702, 121.045], ['C', ' NE2', 184.722, 76.863, 120.774], ['C', ' H ', 183.173, 79.314, 116.623], ['C', ' HA ', 181.133, 77.336, 117.162], ['C', ' HB ', 182.42, 79.422, 118.948], ['C', ' HB ', 181.258, 78.247, 119.55], ['C', ' HG ', 182.728, 76.448, 119.04], ['C', ' HG ', 183.876, 77.538, 118.238], ['C', ' HE2', 185.178, 76.995, 121.656], ['C', ' HE2', 184.969, 76.082, 120.2]]
[['C', ' N ', 180.202, 80.496, 117.332], ['C', ' CA ', 179.009, 81.312, 117.342], ['C', ' C ', 178.143, 80.974, 116.146], ['C', ' O ', 176.913, 80.952, 116.245], ['C', ' CB ', 179.355, 82.794, 117.352], ['C', ' CG ', 178.147, 83.707, 117.463], ['C', ' CD ', 178.577, 85.148, 117.603], ['C', ' CE ', 177.437, 86.099, 117.556], ['C', ' NZ ', 176.501, 85.93, 118.691], ['C', ' H ', 181.127, 80.944, 117.303], ['C', ' HA ', 178.441, 81.084, 118.243], ['C', ' HB ', 180.031, 83.008, 118.183], ['C', ' HB ', 179.884, 83.049, 116.429], ['C', ' HG ', 177.534, 83.611, 116.565], ['C', ' HG ', 177.552, 83.412, 118.323], ['C', ' HD ', 179.152, 85.298, 118.517], ['C', ' HD ', 179.175, 85.37, 116.758], ['C', ' HE ', 177.814, 87.111, 117.558], ['C', ' HE ', 176.916, 85.941, 116.635], ['C', ' HZ ', 175.756, 86.59, 118.586], ['C', ' HZ ', 176.119, 84.997, 118.685], ['C', ' HZ ', 176.942, 86.113, 119.605]]
[['C', ' N ', 178.782, 80.724, 115.007], ['C', ' CA ', 178.038, 80.432, 113.801], ['C', ' C ', 177.281, 79.133, 113.957], ['C', ' O ', 176.113, 79.063, 113.585], ['C', ' CB ', 178.967, 80.325, 112.601], ['C', ' CG ', 179.595, 81.627, 112.194], ['C', ' CD ', 180.536, 81.471, 111.017], ['C', ' CE ', 181.2, 82.802, 110.693], ['C', ' NZ ', 182.19, 82.697, 109.584], ['C', ' H ', 179.79, 80.752, 115.007], ['C', ' HA ', 177.316, 81.228, 113.632], ['C', ' HB ', 179.742, 79.606, 112.808], ['C', ' HB ', 178.402, 79.948, 111.746], ['C', ' HG ', 178.822, 82.324, 111.915], ['C', ' HG ', 180.132, 82.048, 113.04], ['C', ' HD ', 181.303, 80.735, 111.239], ['C', ' HD ', 179.976, 81.136, 110.146], ['C', ' HE ', 180.434, 83.528, 110.417], ['C', ' HE ', 181.717, 83.16, 111.584], ['C', ' HZ ', 182.615, 83.614, 109.444], ['C', ' HZ ', 182.936, 82.063, 109.827], ['C', ' HZ ', 181.753, 82.393, 108.732]]
[['C', ' N ', 177.914, 78.123, 114.556], ['C', ' CA ', 177.251, 76.845, 114.739], ['C', ' C ', 176.067, 76.976, 115.665], ['C', ' O ', 175.025, 76.364, 115.424], ['C', ' CB ', 178.206, 75.809, 115.322], ['C', ' CG ', 179.293, 75.331, 114.386], ['C', ' CD ', 180.24, 74.383, 115.063], ['C', ' OE1', 180.098, 74.186, 116.249], ['C', ' OE2', 181.105, 73.858, 114.403], ['C', ' H ', 178.898, 78.226, 114.814], ['C', ' HA ', 176.899, 76.496, 113.766], ['C', ' HB ', 178.697, 76.238, 116.198], ['C', ' HB ', 177.64, 74.941, 115.656], ['C', ' HG ', 178.826, 74.824, 113.542], ['C', ' HG ', 179.839, 76.183, 113.999]]
[['C', ' N ', 176.211, 77.775, 116.723], ['C', ' CA ', 175.114, 77.942, 117.651], ['C', ' C ', 173.954, 78.597, 116.938], ['C', ' O ', 172.804, 78.162, 117.082], ['C', ' CB ', 175.561, 78.795, 118.829], ['C', ' CG ', 176.542, 78.097, 119.751], ['C', ' CD ', 177.047, 79.029, 120.843], ['C', ' CE ', 178.121, 78.357, 121.686], ['C', ' NZ ', 178.69, 79.283, 122.705], ['C', ' H ', 177.122, 78.216, 116.898], ['C', ' HA ', 174.794, 76.963, 118.005], ['C', ' HB ', 176.046, 79.697, 118.453], ['C', ' HB ', 174.694, 79.104, 119.411], ['C', ' HG ', 176.042, 77.249, 120.217], ['C', ' HG ', 177.38, 77.719, 119.178], ['C', ' HD ', 177.466, 79.926, 120.384], ['C', ' HD ', 176.219, 79.322, 121.487], ['C', ' HE ', 177.691, 77.495, 122.192], ['C', ' HE ', 178.926, 78.018, 121.029], ['C', ' HZ ', 179.4, 78.801, 123.237], ['C', ' HZ ', 179.105, 80.081, 122.24], ['C', ' HZ ', 177.959, 79.598, 123.326]]
[['C', ' N ', 174.252, 79.608, 116.114], ['C', ' CA ', 173.196, 80.255, 115.382], ['C', ' C ', 172.565, 79.274, 114.422], ['C', ' O ', 171.354, 79.149, 114.385], ['C', ' CB ', 173.732, 81.455, 114.627], ['C', ' H ', 175.213, 79.959, 116.048], ['C', ' HA ', 172.438, 80.582, 116.09], ['C', ' HB ', 172.933, 81.946, 114.085], ['C', ' HB ', 174.172, 82.149, 115.339], ['C', ' HB ', 174.493, 81.124, 113.926]]
[['C', ' N ', 173.352, 78.45, 113.742], ['C', ' CA ', 172.757, 77.534, 112.782], ['C', ' C ', 171.81, 76.558, 113.44], ['C', ' O ', 170.76, 76.231, 112.876], ['C', ' CB ', 173.834, 76.777, 112.023], ['C', ' CG ', 174.608, 77.621, 111.028], ['C', ' CD ', 175.757, 76.879, 110.431], ['C', ' OE1', 176.012, 75.784, 110.875], ['C', ' OE2', 176.383, 77.396, 109.536], ['C', ' H ', 174.368, 78.53, 113.809], ['C', ' HA ', 172.192, 78.119, 112.061], ['C', ' HB ', 174.548, 76.365, 112.736], ['C', ' HB ', 173.387, 75.94, 111.488], ['C', ' HG ', 173.93, 77.914, 110.229], ['C', ' HG ', 174.958, 78.524, 111.505]]
[['C', ' N ', 172.159, 76.083, 114.627], ['C', ' CA ', 171.283, 75.158, 115.315], ['C', ' C ', 169.974, 75.839, 115.678], ['C', ' O ', 168.9, 75.236, 115.552], ['C', ' CB ', 171.977, 74.611, 116.552], ['C', ' CG ', 173.111, 73.662, 116.219], ['C', ' CD ', 173.843, 73.185, 117.454], ['C', ' CE ', 175.006, 72.279, 117.073], ['C', ' NZ ', 175.787, 71.834, 118.261], ['C', ' H ', 173.076, 76.335, 115.015], ['C', ' HA ', 171.057, 74.331, 114.643], ['C', ' HB ', 172.392, 75.444, 117.128], ['C', ' HB ', 171.258, 74.094, 117.183], ['C', ' HG ', 172.703, 72.799, 115.695], ['C', ' HG ', 173.814, 74.158, 115.556], ['C', ' HD ', 174.228, 74.049, 118.0], ['C', ' HD ', 173.159, 72.638, 118.101], ['C', ' HE ', 174.619, 71.402, 116.556], ['C', ' HE ', 175.671, 72.823, 116.398], ['C', ' HZ ', 176.548, 71.239, 117.959], ['C', ' HZ ', 176.163, 72.641, 118.738], ['C', ' HZ ', 175.187, 71.319, 118.89]]
[['C', ' N ', 170.053, 77.096, 116.11], ['C', ' CA ', 168.859, 77.821, 116.488], ['C', ' C ', 168.036, 78.231, 115.281], ['C', ' O ', 166.807, 78.212, 115.336], ['C', ' CB ', 169.248, 79.021, 117.299], ['C', ' CG ', 169.738, 78.629, 118.647], ['C', ' OD1', 169.372, 77.577, 119.188], ['C', ' ND2', 170.579, 79.441, 119.207], ['C', ' H ', 170.98, 77.524, 116.248], ['C', ' HA ', 168.239, 77.166, 117.099], ['C', ' HB ', 170.046, 79.56, 116.782], ['C', ' HB ', 168.404, 79.699, 117.402], ['C', ' HD2', 170.956, 79.23, 120.105], ['C', ' HD2', 170.861, 80.291, 118.72]]
[['C', ' N ', 168.697, 78.545, 114.178], ['C', ' CA ', 168.022, 78.955, 112.965], ['C', ' C ', 167.252, 77.765, 112.44], ['C', ' O ', 166.097, 77.89, 112.022], ['C', ' CB ', 169.022, 79.473, 111.913], ['C', ' CG1', 169.664, 80.779, 112.392], ['C', ' CG2', 168.291, 79.754, 110.651], ['C', ' CD1', 170.905, 81.233, 111.649], ['C', ' H ', 169.712, 78.548, 114.22], ['C', ' HA ', 167.319, 79.753, 113.201], ['C', ' HB ', 169.803, 78.736, 111.748], ['C', ' HG1', 168.916, 81.567, 112.293], ['C', ' HG1', 169.915, 80.682, 113.412], ['C', ' HG2', 168.971, 80.127, 109.924], ['C', ' HG2', 167.82, 78.858, 110.267], ['C', ' HG2', 167.537, 80.507, 110.842], ['C', ' HD1', 171.251, 82.175, 112.084], ['C', ' HD1', 171.686, 80.484, 111.753], ['C', ' HD1', 170.702, 81.389, 110.604]]
[['C', ' N ', 167.899, 76.608, 112.417], ['C', ' CA ', 167.225, 75.422, 111.959], ['C', ' C ', 166.042, 75.097, 112.854], ['C', ' O ', 164.977, 74.742, 112.346], ['C', ' CB ', 168.185, 74.263, 111.938], ['C', ' H ', 168.876, 76.56, 112.714], ['C', ' HA ', 166.853, 75.608, 110.951], ['C', ' HB ', 167.673, 73.373, 111.577], ['C', ' HB ', 169.024, 74.499, 111.284], ['C', ' HB ', 168.555, 74.089, 112.951]]
[['C', ' N ', 166.19, 75.274, 114.176], ['C', ' CA ', 165.086, 74.99, 115.071], ['C', ' C ', 163.911, 75.899, 114.78], ['C', ' O ', 162.759, 75.464, 114.838], ['C', ' CB ', 165.516, 75.162, 116.506], ['C', ' H ', 167.099, 75.531, 114.573], ['C', ' HA ', 164.777, 73.957, 114.91], ['C', ' HB ', 164.688, 74.921, 117.166], ['C', ' HB ', 166.354, 74.497, 116.71], ['C', ' HB ', 165.824, 76.192, 116.669]]
[['C', ' N ', 164.183, 77.161, 114.456], ['C', ' CA ', 163.087, 78.057, 114.166], ['C', ' C ', 162.306, 77.562, 112.978], ['C', ' O ', 161.069, 77.563, 113.0], ['C', ' CB ', 163.563, 79.443, 113.843], ['C', ' CG ', 164.131, 80.233, 114.965], ['C', ' CD ', 164.516, 81.555, 114.474], ['C', ' NE ', 163.343, 82.292, 114.119], ['C', ' CZ ', 162.631, 82.998, 114.978], ['C', ' NH1', 162.969, 83.115, 116.236], ['C', ' NH2', 161.57, 83.592, 114.562], ['C', ' H ', 165.151, 77.499, 114.489], ['C', ' HA ', 162.432, 78.095, 115.023], ['C', ' HB ', 164.341, 79.366, 113.104], ['C', ' HB ', 162.755, 80.006, 113.391], ['C', ' HG ', 163.381, 80.342, 115.74], ['C', ' HG ', 164.996, 79.749, 115.37], ['C', ' HD ', 165.073, 82.102, 115.229], ['C', ' HD ', 165.134, 81.447, 113.579], ['C', ' HE ', 162.98, 82.273, 113.15], ['C', ' HH1', 163.791, 82.674, 116.602], ['C', ' HH1', 162.371, 83.697, 116.831], ['C', ' HH2', 161.31, 83.497, 113.566], ['C', ' HH2', 161.038, 84.14, 115.246]]
[['C', ' N ', 163.018, 77.089, 111.952], ['C', ' CA ', 162.33, 76.583, 110.778], ['C', ' C ', 161.483, 75.367, 111.129], ['C', ' O ', 160.322, 75.269, 110.725], ['C', ' CB ', 163.313, 76.24, 109.661], ['C', ' CG ', 162.642, 75.762, 108.378], ['C', ' CD ', 163.647, 75.562, 107.256], ['C', ' CE ', 162.968, 75.035, 105.997], ['C', ' NZ ', 163.938, 74.831, 104.882], ['C', ' H ', 164.044, 77.163, 111.979], ['C', ' HA ', 161.664, 77.365, 110.413], ['C', ' HB ', 163.906, 77.109, 109.423], ['C', ' HB ', 163.997, 75.463, 110.006], ['C', ' HG ', 162.131, 74.816, 108.564], ['C', ' HG ', 161.899, 76.499, 108.07], ['C', ' HD ', 164.109, 76.517, 107.021], ['C', ' HD ', 164.422, 74.864, 107.573], ['C', ' HE ', 162.486, 74.085, 106.224], ['C', ' HE ', 162.209, 75.749, 105.677], ['C', ' HZ ', 163.447, 74.482, 104.069], ['C', ' HZ ', 164.383, 75.709, 104.653], ['C', ' HZ ', 164.641, 74.161, 105.161]]
[['C', ' N ', 162.027, 74.474, 111.952], ['C', ' CA ', 161.334, 73.25, 112.348], ['C', ' C ', 160.037, 73.557, 113.081], ['C', ' O ', 159.037, 72.854, 112.926], ['C', ' CB ', 162.229, 72.402, 113.244], ['C', ' CG ', 163.412, 71.765, 112.544], ['C', ' CD ', 164.345, 71.107, 113.506], ['C', ' OE1', 164.178, 71.323, 114.683], ['C', ' OE2', 165.215, 70.385, 113.079], ['C', ' H ', 162.999, 74.617, 112.253], ['C', ' HA ', 161.096, 72.685, 111.449], ['C', ' HB ', 162.611, 73.018, 114.051], ['C', ' HB ', 161.639, 71.606, 113.696], ['C', ' HG ', 163.044, 71.018, 111.843], ['C', ' HG ', 163.945, 72.517, 111.976]]
[['C', ' N ', 160.042, 74.638, 113.848], ['C', ' CA ', 158.892, 75.067, 114.621], ['C', ' C ', 157.888, 75.9, 113.821], ['C', ' O ', 156.871, 76.323, 114.373], ['C', ' CB ', 159.373, 75.863, 115.82], ['C', ' CG ', 160.105, 75.032, 116.848], ['C', ' SD ', 160.52, 75.947, 118.339], ['C', ' CE ', 161.894, 76.959, 117.792], ['C', ' H ', 160.931, 75.141, 113.957], ['C', ' HA ', 158.373, 74.178, 114.972], ['C', ' HB ', 160.052, 76.635, 115.464], ['C', ' HB ', 158.531, 76.358, 116.302], ['C', ' HG ', 159.479, 74.188, 117.127], ['C', ' HG ', 161.022, 74.636, 116.416], ['C', ' HE ', 162.251, 77.567, 118.622], ['C', ' HE ', 162.696, 76.323, 117.436], ['C', ' HE ', 161.566, 77.601, 117.003]]
[['C', ' N ', 158.163, 76.156, 112.539], ['C', ' CA ', 157.262, 76.935, 111.704], ['C', ' C ', 157.343, 78.443, 111.912], ['C', ' O ', 156.372, 79.158, 111.661], ['C', ' H ', 159.01, 75.777, 112.106], ['C', ' HA ', 157.485, 76.709, 110.661], ['C', ' HA ', 156.242, 76.601, 111.881]]
[['C', ' N ', 158.472, 78.938, 112.389], ['C', ' CA ', 158.615, 80.356, 112.642], ['C', ' C ', 159.264, 81.049, 111.465], ['C', ' O ', 159.89, 80.39, 110.625], ['C', ' CB ', 159.485, 80.554, 113.87], ['C', ' CG ', 158.995, 79.929, 115.154], ['C', ' CD1', 160.057, 80.126, 116.199], ['C', ' CD2', 157.686, 80.576, 115.591], ['C', ' H ', 159.279, 78.33, 112.567], ['C', ' HA ', 157.63, 80.762, 112.808], ['C', ' HB ', 160.455, 80.129, 113.655], ['C', ' HB ', 159.617, 81.611, 114.046], ['C', ' HG ', 158.845, 78.857, 115.011], ['C', ' HD1', 159.736, 79.67, 117.136], ['C', ' HD1', 160.97, 79.663, 115.871], ['C', ' HD1', 160.226, 81.192, 116.35], ['C', ' HD2', 157.357, 80.124, 116.525], ['C', ' HD2', 157.835, 81.65, 115.739], ['C', ' HD2', 156.915, 80.42, 114.843]]
[['C', ' N ', 159.073, 82.362, 111.288], ['C', ' CA ', 159.806, 83.103, 110.307], ['C', ' C ', 161.23, 82.796, 110.658], ['C', ' O ', 161.615, 82.915, 111.83], ['C', ' CB ', 159.391, 84.541, 110.592], ['C', ' CG ', 158.0, 84.399, 111.187], ['C', ' CD ', 158.071, 83.136, 112.029], ['C', ' HA ', 159.542, 82.764, 109.294], ['C', ' HB ', 160.103, 85.016, 111.281], ['C', ' HB ', 159.403, 85.13, 109.664], ['C', ' HG ', 157.75, 85.288, 111.775], ['C', ' HG ', 157.249, 84.331, 110.388], ['C', ' HD ', 158.422, 83.365, 113.044], ['C', ' HD ', 157.081, 82.663, 112.019]]
[['C', ' N ', 162.013, 82.445, 109.663], ['C', ' CA ', 163.375, 82.041, 109.912], ['C', ' C ', 164.407, 82.704, 109.031], ['C', ' O ', 164.645, 82.235, 107.92], ['C', ' CB ', 163.481, 80.522, 109.778], ['C', ' OG1', 162.545, 79.91, 110.676], ['C', ' CG2', 164.868, 80.073, 110.14], ['C', ' H ', 161.64, 82.398, 108.723], ['C', ' HA ', 163.614, 82.265, 110.948], ['C', ' HB ', 163.25, 80.22, 108.757], ['C', ' HG1', 161.611, 80.127, 110.419], ['C', ' HG2', 164.935, 79.005, 110.059], ['C', ' HG2', 165.6, 80.518, 109.478], ['C', ' HG2', 165.09, 80.369, 111.157]]
[['C', ' N ', 164.918, 83.869, 109.412], ['C', ' CA ', 165.975, 84.564, 108.735], ['C', ' C ', 167.193, 83.674, 108.915], ['C', ' O ', 167.263, 82.992, 109.943], ['C', ' CB ', 166.088, 85.865, 109.516], ['C', ' CG ', 164.783, 85.963, 110.255], ['C', ' CD ', 164.406, 84.574, 110.573], ['C', ' HA ', 165.706, 84.724, 107.677], ['C', ' HB ', 166.964, 85.83, 110.18], ['C', ' HB ', 166.247, 86.707, 108.822], ['C', ' HG ', 164.896, 86.613, 111.122], ['C', ' HG ', 164.021, 86.423, 109.62], ['C', ' HD ', 164.907, 84.23, 111.491], ['C', ' HD ', 163.327, 84.546, 110.65]]
[['C', ' N ', 168.138, 83.708, 107.967], ['C', ' CA ', 169.415, 82.963, 108.005], ['C', ' C ', 170.624, 83.917, 108.036], ['C', ' O ', 170.507, 85.065, 108.469], ['C', ' OXT', 171.756, 83.423, 107.972], ['C', ' CB ', 169.493, 81.94, 106.813], ['C', ' CG ', 168.547, 80.685, 106.952], ['C', ' CD1', 167.09, 80.762, 106.676], ['C', ' CD2', 169.112, 79.364, 107.354], ['C', ' CE1', 166.232, 79.576, 106.823], ['C', ' CE2', 168.252, 78.182, 107.496], ['C', ' CZ ', 166.814, 78.292, 107.236], ['C', ' H ', 167.984, 84.304, 107.167], ['C', ' HA ', 169.462, 82.389, 108.929], ['C', ' HB ', 169.253, 82.442, 105.874], ['C', ' HB ', 170.524, 81.58, 106.704], ['C', ' HD1', 166.646, 81.712, 106.379], ['C', ' HD2', 170.181, 79.285, 107.556], ['C', ' HE1', 165.161, 79.662, 106.633], ['C', ' HE2', 168.68, 77.225, 107.802], ['C', ' HZ ', 166.184, 77.422, 107.351]]
[['C', ' N ', 188.805, 82.886, 106.132], ['C', ' CA ', 187.697, 83.853, 106.255], ['C', ' C ', 187.024, 83.727, 107.649], ['C', ' O ', 186.525, 82.648, 107.989], ['C', ' CB ', 186.627, 83.616, 105.076], ['C', ' CG1', 185.336, 84.586, 105.185], ['C', ' CG2', 187.304, 83.874, 103.626], ['C', ' H ', 189.212, 82.966, 105.211], ['C', ' H ', 189.52, 83.045, 106.827], ['C', ' H ', 188.432, 81.952, 106.25], ['C', ' HA ', 188.121, 84.857, 106.126], ['C', ' HB ', 186.256, 82.574, 105.14], ['C', ' HG1', 184.635, 84.37, 104.374], ['C', ' HG1', 184.81, 84.446, 106.132], ['C', ' HG1', 185.631, 85.601, 105.1], ['C', ' HG2', 186.568, 83.689, 102.835], ['C', ' HG2', 187.65, 84.912, 103.545], ['C', ' HG2', 188.151, 83.209, 103.46]] AA_SCO= 1.4180000000000001 CA_SCO= 1.0162
[['C', ' N ', 187.033, 84.828, 108.434], ['C', ' CA ', 186.382, 84.957, 109.731], ['C', ' C ', 184.891, 85.245, 109.466], ['C', ' O ', 184.063, 84.432, 109.882], ['C', ' CB ', 187.089, 86.018, 110.583], ['C', ' CG ', 188.247, 85.51, 111.477], ['C', ' CD1', 189.333, 84.853, 110.651], ['C', ' CD2', 188.841, 86.657, 112.193], ['C', ' H ', 187.479, 85.651, 108.065], ['C', ' HA ', 186.446, 84.012, 110.276], ['C', ' HB ', 187.531, 86.751, 109.919], ['C', ' HB ', 186.354, 86.507, 111.215], ['C', ' HG ', 187.86, 84.784, 112.196], ['C', ' HD1', 190.138, 84.518, 111.312], ['C', ' HD1', 188.937, 83.993, 110.121], ['C', ' HD1', 189.732, 85.568, 109.938], ['C', ' HD2', 189.637, 86.288, 112.822], ['C', ' HD2', 189.241, 87.368, 111.474], ['C', ' HD2', 188.107, 87.142, 112.8]] AA_SCO= 1.5272727272727273 CA_SCO= 1.0323636363636366
[['C', ' N ', 184.497, 86.314, 108.718], ['C', ' CA ', 185.232, 87.51, 108.259], ['C', ' C ', 186.08, 87.469, 106.989], ['C', ' O ', 187.196, 86.961, 106.992], ['C', ' H ', 183.509, 86.321, 108.477], ['C', ' HA ', 184.488, 88.282, 108.1], ['C', ' HA ', 185.828, 87.895, 109.073]] AA_SCO= 1.625 CA_SCO= 1.1103333333333334
[['C', ' N ', 185.643, 88.147, 105.95], ['C', ' CA ', 186.5, 88.338, 104.791], ['C', ' C ', 187.461, 89.41, 105.212], ['C', ' O ', 187.041, 90.354, 105.877], ['C', ' CB ', 185.717, 88.793, 103.545], ['C', ' OG1', 184.731, 87.811, 103.202], ['C', ' CG2', 186.671, 88.946, 102.371], ['C', ' H ', 184.709, 88.53, 105.936], ['C', ' HA ', 187.059, 87.428, 104.572], ['C', ' HB ', 185.223, 89.743, 103.748], ['C', ' HG1', 184.139, 88.174, 102.536], ['C', ' HG2', 186.106, 89.257, 101.494], ['C', ' HG2', 187.428, 89.696, 102.586], ['C', ' HG2', 187.154, 87.991, 102.171]] AA_SCO= 1.576153846153846 CA_SCO= 1.1763846153846154
[['C', ' N ', 188.74, 89.28, 104.912], ['C', ' CA ', 189.633, 90.341, 105.335], ['C', ' C ', 190.808, 90.552, 104.439], ['C', ' O ', 191.173, 89.682, 103.648], ['C', ' CB ', 190.137, 90.099, 106.745], ['C', ' CG ', 190.996, 88.904, 106.909], ['C', ' CD1', 192.354, 89.011, 106.742], ['C', ' CD2', 190.438, 87.701, 107.253], ['C', ' CE1', 193.153, 87.923, 106.909], ['C', ' CE2', 191.235, 86.601, 107.425], ['C', ' CZ ', 192.591, 86.71, 107.253], ['C', ' OH ', 193.405, 85.619, 107.434], ['C', ' H ', 189.08, 88.486, 104.386], ['C', ' HA ', 189.079, 91.27, 105.326], ['C', ' HB ', 190.712, 90.969, 107.061], ['C', ' HB ', 189.288, 89.998, 107.412], ['C', ' HD1', 192.795, 89.954, 106.484], ['C', ' HD2', 189.376, 87.626, 107.394], ['C', ' HE1', 194.23, 88.015, 106.776], ['C', ' HE2', 190.79, 85.646, 107.703], ['C', ' HH ', 192.892, 84.886, 107.786]] AA_SCO= 1.5707142857142855 CA_SCO= 1.2307857142857144
[['C', ' N ', 191.412, 91.727, 104.584], ['C', ' CA ', 192.612, 92.066, 103.866], ['C', ' C ', 193.823, 91.944, 104.791], ['C', ' O ', 194.859, 91.415, 104.386], ['C', ' CB ', 192.474, 93.475, 103.3], ['C', ' CG ', 193.592, 93.93, 102.41], ['C', ' CD ', 193.237, 95.277, 101.77], ['C', ' CE ', 194.296, 95.741, 100.785], ['C', ' NZ ', 193.934, 97.052, 100.171], ['C', ' H ', 191.04, 92.416, 105.235], ['C', ' HA ', 192.743, 91.363, 103.044], ['C', ' HB ', 191.547, 93.546, 102.738], ['C', ' HB ', 192.408, 94.185, 104.129], ['C', ' HG ', 194.505, 94.042, 103.003], ['C', ' HG ', 193.77, 93.185, 101.633], ['C', ' HD ', 192.284, 95.204, 101.239], ['C', ' HD ', 193.133, 96.036, 102.546], ['C', ' HE ', 195.25, 95.842, 101.299], ['C', ' HE ', 194.394, 94.998, 99.996], ['C', ' HZ ', 194.633, 97.349, 99.522], ['C', ' HZ ', 193.025, 97.002, 99.683], ['C', ' HZ ', 193.838, 97.758, 100.903]] AA_SCO= 1.5793333333333333 CA_SCO= 1.2348000000000001
[['C', ' N ', 193.693, 92.424, 106.034], ['C', ' CA ', 194.82, 92.351, 106.972], ['C', ' C ', 194.417, 92.315, 108.448], ['C', ' O ', 193.541, 93.067, 108.884], ['C', ' CB ', 195.771, 93.517, 106.737], ['C', ' CG ', 197.03, 93.462, 107.571], ['C', ' CD ', 197.999, 94.533, 107.233], ['C', ' OE1', 197.659, 95.42, 106.483], ['C', ' OE2', 199.094, 94.482, 107.722], ['C', ' H ', 192.804, 92.851, 106.305], ['C', ' HA ', 195.366, 91.43, 106.763], ['C', ' HB ', 196.06, 93.551, 105.686], ['C', ' HB ', 195.26, 94.449, 106.966], ['C', ' HG ', 196.763, 93.575, 108.615], ['C', ' HG ', 197.502, 92.49, 107.445]] AA_SCO= 1.5731249999999999 CA_SCO= 1.2259375000000001
[['C', ' N ', 195.078, 91.465, 109.253], ['C', ' CA ', 194.74, 91.46, 110.673], ['C', ' C ', 195.948, 91.729, 111.554], ['C', ' O ', 196.975, 91.037, 111.461], ['C', ' CB ', 194.142, 90.131, 111.126], ['C', ' CG1', 192.973, 89.816, 110.261], ['C', ' CG2', 193.676, 90.301, 112.606], ['C', ' CD1', 192.293, 88.499, 110.517], ['C', ' H ', 195.799, 90.859, 108.881], ['C', ' HA ', 194.016, 92.249, 110.868], ['C', ' HB ', 194.868, 89.333, 111.031], ['C', ' HG1', 192.316, 90.6, 110.332], ['C', ' HG1', 193.32, 89.784, 109.249], ['C', ' HG2', 193.227, 89.406, 112.974], ['C', ' HG2', 194.482, 90.546, 113.24], ['C', ' HG2', 192.962, 91.107, 112.668], ['C', ' HD1', 191.482, 88.381, 109.817], ['C', ' HD1', 193.007, 87.692, 110.386], ['C', ' HD1', 191.886, 88.464, 111.512]] AA_SCO= 1.566470588235294 CA_SCO= 1.2574117647058825
[['C', ' N ', 195.806, 92.738, 112.4], ['C', ' CA ', 196.841, 93.133, 113.346], ['C', ' C ', 196.256, 93.35, 114.717], ['C', ' O ', 195.047, 93.503, 114.844], ['C', ' CB ', 197.518, 94.426, 112.902], ['C', ' CG1', 198.153, 94.242, 111.545], ['C', ' CG2', 196.504, 95.574, 112.9], ['C', ' H ', 194.9, 93.229, 112.386], ['C', ' HA ', 197.589, 92.348, 113.41], ['C', ' HB ', 198.316, 94.646, 113.595], ['C', ' HG1', 198.662, 95.159, 111.253], ['C', ' HG1', 198.87, 93.43, 111.591], ['C', ' HG1', 197.395, 94.011, 110.813], ['C', ' HG2', 197.008, 96.479, 112.601], ['C', ' HG2', 195.696, 95.355, 112.199], ['C', ' HG2', 196.091, 95.714, 113.896]] AA_SCO= 1.5955555555555554 CA_SCO= 1.295388888888889
[['C', ' N ', 197.089, 93.4, 115.738], ['C', ' CA ', 196.605, 93.861, 117.023], ['C', ' C ', 197.104, 95.284, 117.113], ['C', ' O ', 198.147, 95.627, 116.548], ['C', ' CB ', 197.103, 93.008, 118.171], ['C', ' OG ', 198.487, 93.043, 118.271], ['C', ' H ', 198.079, 93.194, 115.595], ['C', ' HA ', 195.522, 93.875, 117.034], ['C', ' HB ', 196.664, 93.369, 119.098], ['C', ' HB ', 196.771, 91.985, 118.033], ['C', ' HG ', 198.718, 92.362, 118.916]] AA_SCO= 1.53 CA_SCO= 1.3303157894736841
[['C', ' N ', 196.401, 96.137, 117.814], ['C', ' CA ', 196.851, 97.505, 117.903], ['C', ' C ', 196.262, 98.221, 119.08], ['C', ' O ', 195.266, 97.802, 119.671], ['C', ' CB ', 196.499, 98.247, 116.631], ['C', ' H ', 195.536, 95.835, 118.256], ['C', ' HA ', 197.923, 97.504, 118.023], ['C', ' HB ', 196.866, 99.271, 116.696], ['C', ' HB ', 196.947, 97.76, 115.781], ['C', ' HB ', 195.435, 98.255, 116.51]] AA_SCO= 1.7063157894736842 CA_SCO= 1.6213684210526313
[['C', ' N ', 196.893, 99.307, 119.448], ['C', ' CA ', 196.292, 100.159, 120.442], ['C', ' C ', 196.59, 101.604, 120.178], ['C', ' O ', 197.603, 101.948, 119.565], ['C', ' CB ', 196.73, 99.823, 121.845], ['C', ' CG ', 198.148, 100.03, 122.166], ['C', ' CD ', 198.379, 99.719, 123.566], ['C', ' NE ', 199.744, 99.896, 123.901], ['C', ' CZ ', 200.294, 99.692, 125.096], ['C', ' NH1', 199.571, 99.299, 126.127], ['C', ' NH2', 201.589, 99.895, 125.205], ['C', ' H ', 197.755, 99.558, 118.953], ['C', ' HA ', 195.211, 100.031, 120.389], ['C', ' HB ', 196.148, 100.397, 122.563], ['C', ' HB ', 196.541, 98.796, 122.029], ['C', ' HG ', 198.767, 99.371, 121.561], ['C', ' HG ', 198.441, 101.067, 121.993], ['C', ' HD ', 197.784, 100.396, 124.178], ['C', ' HD ', 198.092, 98.696, 123.769], ['C', ' HE ', 200.38, 100.193, 123.152], ['C', ' HH1', 198.579, 99.143, 126.019], ['C', ' HH1', 200.006, 99.149, 127.026], ['C', ' HH2', 202.099, 100.198, 124.355], ['C', ' HH2', 202.066, 99.756, 126.081]] AA_SCO= 1.5315789473684212 CA_SCO= 1.5272105263157894
[['C', ' N ', 195.715, 102.46, 120.676], ['C', ' CA ', 195.936, 103.889, 120.617], ['C', ' C ', 197.124, 104.216, 121.475], ['C', ' O ', 197.274, 103.637, 122.553], ['C', ' CB ', 194.727, 104.657, 121.089], ['C', ' OG ', 195.005, 106.033, 121.138], ['C', ' H ', 194.887, 102.11, 121.131], ['C', ' HA ', 196.149, 104.173, 119.598], ['C', ' HB ', 193.892, 104.477, 120.409], ['C', ' HB ', 194.427, 104.309, 122.078], ['C', ' HG ', 194.141, 106.451, 121.274]] AA_SCO= 1.4578947368421054 CA_SCO= 1.5732105263157894
[['C', ' N ', 197.931, 105.165, 121.028], ['C', ' CA ', 199.112, 105.628, 121.737], ['C', ' C ', 198.808, 106.843, 122.592], ['C', ' O ', 199.673, 107.333, 123.323], ['C', ' CB ', 200.218, 105.982, 120.74], ['C', ' OG1', 199.752, 107.051, 119.9], ['C', ' CG2', 200.521, 104.76, 119.903], ['C', ' H ', 197.716, 105.572, 120.117], ['C', ' HA ', 199.466, 104.828, 122.382], ['C', ' HB ', 201.115, 106.304, 121.265], ['C', ' HG1', 200.437, 107.305, 119.226], ['C', ' HG2', 201.292, 104.992, 119.168], ['C', ' HG2', 200.865, 103.954, 120.547], ['C', ' HG2', 199.636, 104.456, 119.408]] AA_SCO= 1.704736842105263 CA_SCO= 1.6571052631578944
[['C', ' N ', 197.582, 107.342, 122.496], ['C', ' CA ', 197.169, 108.503, 123.256], ['C', ' C ', 196.66, 108.077, 124.615], ['C', ' O ', 195.625, 107.411, 124.717], ['C', ' CB ', 196.092, 109.313, 122.554], ['C', ' CG ', 195.759, 110.595, 123.346], ['C', ' OD1', 196.282, 110.718, 124.462], ['C', ' OD2', 195.043, 111.44, 122.842], ['C', ' H ', 196.909, 106.895, 121.875], ['C', ' HA ', 198.036, 109.148, 123.402], ['C', ' HB ', 196.417, 109.575, 121.545], ['C', ' HB ', 195.205, 108.709, 122.469]] AA_SCO= 1.5394736842105263 CA_SCO= 1.6610526315789471
[['C', ' N ', 197.371, 108.441, 125.661], ['C', ' CA ', 197.034, 107.997, 127.001], ['C', ' C ', 195.628, 108.413, 127.416], ['C', ' O ', 194.995, 107.716, 128.221], ['C', ' CB ', 198.037, 108.507, 128.007], ['C', ' CG ', 199.382, 107.831, 127.908], ['C', ' CD ', 200.247, 108.121, 129.073], ['C', ' NE ', 200.58, 109.54, 129.171], ['C', ' CZ ', 201.606, 110.151, 128.532], ['C', ' NH1', 202.398, 109.473, 127.722], ['C', ' NH2', 201.811, 111.444, 128.718], ['C', ' H ', 198.182, 109.025, 125.5], ['C', ' HA ', 197.089, 106.913, 127.015], ['C', ' HB ', 198.183, 109.576, 127.864], ['C', ' HB ', 197.656, 108.356, 129.016], ['C', ' HG ', 199.233, 106.752, 127.858], ['C', ' HG ', 199.883, 108.163, 127.0], ['C', ' HD ', 199.716, 107.837, 129.982], ['C', ' HD ', 201.166, 107.544, 129.007], ['C', ' HE ', 200.009, 110.109, 129.784], ['C', ' HH1', 202.249, 108.487, 127.567], ['C', ' HH1', 203.16, 109.942, 127.25], ['C', ' HH2', 201.207, 111.969, 129.336], ['C', ' HH2', 202.572, 111.911, 128.246]] AA_SCO= 1.5794736842105264 CA_SCO= 1.6650526315789471
[['C', ' N ', 195.133, 109.544, 126.894], ['C', ' CA ', 193.803, 110.0, 127.262], ['C', ' C ', 192.723, 109.088, 126.708], ['C', ' O ', 191.583, 109.141, 127.15], ['C', ' CB ', 193.527, 111.423, 126.797], ['C', ' CG ', 194.339, 112.477, 127.507], ['C', ' CD ', 193.961, 113.887, 127.116], ['C', ' OE1', 193.054, 114.067, 126.312], ['C', ' OE2', 194.578, 114.793, 127.62], ['C', ' H ', 195.681, 110.105, 126.216], ['C', ' HA ', 193.736, 109.981, 128.345], ['C', ' HB ', 193.748, 111.497, 125.728], ['C', ' HB ', 192.471, 111.653, 126.931], ['C', ' HG ', 194.204, 112.358, 128.58], ['C', ' HG ', 195.393, 112.312, 127.28]] AA_SCO= 1.6310526315789473 CA_SCO= 1.6653157894736839
[['C', ' N ', 193.058, 108.311, 125.694], ['C', ' CA ', 192.126, 107.398, 125.088], ['C', ' C ', 192.331, 106.036, 125.715], ['C', ' O ', 191.377, 105.339, 126.068], ['C', ' CB ', 192.286, 107.345, 123.567], ['C', ' CG1', 191.947, 108.732, 122.998], ['C', ' CG2', 191.387, 106.268, 122.992], ['C', ' CD1', 192.243, 108.935, 121.528], ['C', ' H ', 194.026, 108.301, 125.372], ['C', ' HA ', 191.112, 107.728, 125.312], ['C', ' HB ', 193.325, 107.129, 123.319], ['C', ' HG1', 190.891, 108.924, 123.167], ['C', ' HG1', 192.53, 109.468, 123.548], ['C', ' HG2', 191.493, 106.22, 121.915], ['C', ' HG2', 191.658, 105.312, 123.408], ['C', ' HG2', 190.35, 106.492, 123.246], ['C', ' HD1', 191.975, 109.953, 121.248], ['C', ' HD1', 193.291, 108.781, 121.329], ['C', ' HD1', 191.665, 108.249, 120.93]] AA_SCO= 1.6384210526315788 CA_SCO= 1.657736842105263
[['C', ' N ', 193.59, 105.659, 125.916], ['C', ' CA ', 193.912, 104.344, 126.451], ['C', ' C ', 193.25, 104.127, 127.798], ['C', ' O ', 192.786, 103.03, 128.098], ['C', ' CB ', 195.412, 104.217, 126.688], ['C', ' CG ', 196.285, 104.17, 125.473], ['C', ' CD ', 197.746, 104.228, 125.863], ['C', ' OE1', 198.059, 104.481, 127.036], ['C', ' NE2', 198.624, 104.015, 124.913], ['C', ' H ', 194.346, 106.28, 125.623], ['C', ' HA ', 193.562, 103.581, 125.758], ['C', ' HB ', 195.733, 105.048, 127.306], ['C', ' HB ', 195.602, 103.31, 127.257], ['C', ' HG ', 196.114, 103.232, 124.945], ['C', ' HG ', 196.068, 105.001, 124.816], ['C', ' HE2', 199.603, 104.046, 125.107], ['C', ' HE2', 198.288, 103.829, 123.972]] AA_SCO= 1.6521052631578945 CA_SCO= 1.6583157894736842
[['C', ' N ', 193.173, 105.18, 128.605], ['C', ' CA ', 192.568, 105.071, 129.918], ['C', ' C ', 191.034, 104.959, 129.882], ['C', ' O ', 190.423, 104.642, 130.911], ['C', ' CB ', 192.945, 106.267, 130.793], ['C', ' CG ', 192.26, 107.565, 130.421], ['C', ' CD ', 192.731, 108.709, 131.289], ['C', ' CE ', 191.943, 109.986, 131.004], ['C', ' NZ ', 192.426, 111.131, 131.833], ['C', ' H ', 193.61, 106.061, 128.317], ['C', ' HA ', 192.956, 104.168, 130.388], ['C', ' HB ', 192.711, 106.046, 131.832], ['C', ' HB ', 194.021, 106.435, 130.723], ['C', ' HG ', 192.445, 107.795, 129.374], ['C', ' HG ', 191.194, 107.462, 130.571], ['C', ' HD ', 192.618, 108.44, 132.338], ['C', ' HD ', 193.788, 108.895, 131.087], ['C', ' HE ', 192.039, 110.242, 129.952], ['C', ' HE ', 190.891, 109.81, 131.225], ['C', ' HZ ', 191.881, 111.955, 131.62], ['C', ' HZ ', 192.327, 110.908, 132.816], ['C', ' HZ ', 193.399, 111.307, 131.625]] AA_SCO= 1.761578947368421 CA_SCO= 1.6596315789473683
[['C', ' N ', 190.395, 105.304, 128.757], ['C', ' CA ', 188.936, 105.317, 128.685], ['C', ' C ', 188.328, 104.139, 127.934], ['C', ' O ', 187.305, 103.586, 128.346], ['C', ' CB ', 188.487, 106.574, 127.956], ['C', ' CG ', 188.878, 107.911, 128.553], ['C', ' CD1', 188.408, 109.014, 127.609], ['C', ' CD2', 188.274, 108.078, 129.935], ['C', ' H ', 190.934, 105.503, 127.919], ['C', ' HA ', 188.539, 105.295, 129.694], ['C', ' HB ', 188.878, 106.539, 126.937], ['C', ' HB ', 187.413, 106.551, 127.916], ['C', ' HG ', 189.955, 107.973, 128.62], ['C', ' HD1', 188.703, 109.982, 128.01], ['C', ' HD1', 188.871, 108.877, 126.63], ['C', ' HD1', 187.321, 108.978, 127.505], ['C', ' HD2', 188.564, 109.047, 130.333], ['C', ' HD2', 187.186, 108.024, 129.865], ['C', ' HD2', 188.633, 107.303, 130.603]] AA_SCO= 1.7842105263157895 CA_SCO= 1.691315789473684
[['C', ' N ', 188.938, 103.761, 126.824], ['C', ' CA ', 188.406, 102.677, 126.014], ['C', ' C ', 188.61, 101.394, 126.77], ['C', ' O ', 189.548, 101.297, 127.553], ['C', ' CB ', 189.074, 102.62, 124.674], ['C', ' H ', 189.79, 104.251, 126.538], ['C', ' HA ', 187.337, 102.834, 125.879], ['C', ' HB ', 188.657, 101.795, 124.1], ['C', ' HB ', 188.906, 103.563, 124.148], ['C', ' HB ', 190.142, 102.463, 124.823]] AA_SCO= 1.7515789473684207 CA_SCO= 1.686157894736842
[['C', ' N ', 187.781, 100.381, 126.548], ['C', ' CA ', 188.026, 99.179, 127.325], ['C', ' C ', 189.342, 98.496, 126.965], ['C', ' O ', 190.062, 98.051, 127.855], ['C', ' CB ', 186.849, 98.211, 127.172], ['C', ' CG ', 186.947, 96.942, 128.011], ['C', ' CD ', 187.026, 97.223, 129.493], ['C', ' OE1', 186.362, 98.126, 130.012], ['C', ' NE2', 187.847, 96.444, 130.185], ['C', ' H ', 187.013, 100.449, 125.897], ['C', ' HA ', 188.084, 99.469, 128.375], ['C', ' HB ', 185.918, 98.716, 127.432], ['C', ' HB ', 186.773, 97.903, 126.133], ['C', ' HG ', 186.057, 96.335, 127.843], ['C', ' HG ', 187.84, 96.375, 127.721], ['C', ' HE2', 187.954, 96.569, 131.169], ['C', ' HE2', 188.363, 95.71, 129.711]] AA_SCO= 1.8321052631578945 CA_SCO= 1.1714736842105264
[['C', ' N ', 189.662, 98.436, 125.679], ['C', ' CA ', 190.907, 97.866, 125.175], ['C', ' C ', 191.171, 98.502, 123.847], ['C', ' O ', 190.22, 98.643, 123.083], ['C', ' CB ', 190.827, 96.348, 124.977], ['C', ' CG ', 190.786, 95.529, 126.259], ['C', ' OD1', 191.824, 95.389, 126.928], ['C', ' OD2', 189.735, 94.995, 126.547], ['C', ' H ', 189.017, 98.828, 125.013], ['C', ' HA ', 191.724, 98.111, 125.854], ['C', ' HB ', 189.945, 96.123, 124.396], ['C', ' HB ', 191.685, 96.02, 124.393]] AA_SCO= 1.8863157894736844 CA_SCO= 1.1378947368421053
[['C', ' N ', 192.418, 98.861, 123.543], ['C', ' CA ', 192.765, 99.371, 122.235], ['C', ' C ', 191.722, 100.337, 121.746], ['C', ' O ', 190.901, 99.988, 120.896], ['C', ' H ', 193.182, 98.752, 124.198], ['C', ' HA ', 193.731, 99.862, 122.295], ['C', ' HA ', 192.872, 98.546, 121.536]] AA_SCO= 1.9752631578947366 CA_SCO= 1.173315789473684
[['C', ' N ', 191.754, 101.575, 122.238], ['C', ' CA ', 190.746, 102.575, 121.881], ['C', ' C ', 190.86, 103.109, 120.47], ['C', ' O ', 191.044, 104.305, 120.249], ['C', ' H ', 192.46, 101.805, 122.921], ['C', ' HA ', 189.759, 102.131, 121.999], ['C', ' HA ', 190.802, 103.398, 122.582]] AA_SCO= 2.041052631578947 CA_SCO= 1.2193684210526314
[['C', ' N ', 190.673, 102.206, 119.531], ['C', ' CA ', 190.746, 102.386, 118.107], ['C', ' C ', 189.402, 102.899, 117.66], ['C', ' O ', 189.302, 103.865, 116.909], ['C', ' CB ', 191.159, 101.076, 117.442], ['C', ' CG1', 192.57, 100.781, 117.946], ['C', ' CG2', 191.103, 101.184, 115.899], ['C', ' CD1', 193.07, 99.511, 117.645], ['C', ' H ', 190.491, 101.272, 119.871], ['C', ' HA ', 191.496, 103.137, 117.881], ['C', ' HB ', 190.503, 100.272, 117.783], ['C', ' HG1', 193.242, 101.471, 117.529], ['C', ' HG1', 192.588, 100.881, 119.021], ['C', ' HG2', 191.409, 100.251, 115.436], ['C', ' HG2', 190.088, 101.412, 115.573], ['C', ' HG2', 191.772, 101.973, 115.576], ['C', ' HD1', 194.049, 99.434, 118.055], ['C', ' HD1', 192.442, 98.743, 118.066], ['C', ' HD1', 193.118, 99.408, 116.6]] AA_SCO= 2.096842105263158 CA_SCO= 1.2303684210526316
[['C', ' N ', 188.347, 102.362, 118.225], ['C', ' CA ', 187.022, 102.826, 117.863], ['C', ' C ', 186.888, 104.316, 118.251], ['C', ' O ', 186.218, 105.08, 117.574], ['C', ' CB ', 185.965, 101.934, 118.552], ['C', ' CG1', 186.111, 100.505, 118.061], ['C', ' CG2', 186.121, 101.965, 120.07], ['C', ' H ', 188.477, 101.594, 118.861], ['C', ' HA ', 186.901, 102.738, 116.783], ['C', ' HB ', 184.984, 102.277, 118.291], ['C', ' HG1', 185.361, 99.887, 118.536], ['C', ' HG1', 185.976, 100.467, 117.001], ['C', ' HG1', 187.094, 100.114, 118.306], ['C', ' HG2', 185.359, 101.325, 120.515], ['C', ' HG2', 187.105, 101.61, 120.369], ['C', ' HG2', 185.977, 102.952, 120.413]] AA_SCO= 2.065263157894737 CA_SCO= 1.231736842105263
[['C', ' N ', 187.634, 104.724, 119.28], ['C', ' CA ', 187.781, 106.08, 119.802], ['C', ' C ', 189.077, 106.763, 119.378], ['C', ' O ', 189.414, 107.838, 119.87], ['C', ' CB ', 187.848, 106.017, 121.317], ['C', ' OG1', 188.884, 105.065, 121.671], ['C', ' CG2', 186.57, 105.632, 121.939], ['C', ' H ', 188.118, 104.01, 119.814], ['C', ' HA ', 186.935, 106.681, 119.468], ['C', ' HB ', 188.133, 106.998, 121.698], ['C', ' HG1', 189.744, 105.225, 121.165], ['C', ' HG2', 186.708, 105.604, 122.998], ['C', ' HG2', 185.8, 106.363, 121.685], ['C', ' HG2', 186.269, 104.678, 121.605]] AA_SCO= 2.1521052631578947 CA_SCO= 1.2165263157894735
[['C', ' N ', 189.839, 106.097, 118.542], ['C', ' CA ', 191.154, 106.514, 118.089], ['C', ' C ', 191.111, 106.833, 116.623], ['C', ' O ', 191.465, 107.927, 116.195], ['C', ' H ', 189.467, 105.241, 118.156], ['C', ' HA ', 191.483, 107.385, 118.651], ['C', ' HA ', 191.872, 105.716, 118.276]] AA_SCO= 2.2005263157894737 CA_SCO= 1.2128947368421055
[['C', ' N ', 190.783, 105.813, 115.852], ['C', ' CA ', 190.729, 105.82, 114.421], ['C', ' C ', 189.594, 106.668, 114.008], ['C', ' O ', 189.695, 107.434, 113.06], ['C', ' CB ', 190.487, 104.405, 113.911], ['C', ' CG ', 190.497, 104.173, 112.425], ['C', ' CD1', 191.869, 104.562, 111.861], ['C', ' CD2', 190.168, 102.702, 112.18], ['C', ' H ', 190.511, 104.959, 116.306], ['C', ' HA ', 191.658, 106.231, 114.045], ['C', ' HB ', 191.242, 103.772, 114.33], ['C', ' HB ', 189.52, 104.068, 114.288], ['C', ' HG ', 189.744, 104.793, 111.93], ['C', ' HD1', 191.88, 104.375, 110.818], ['C', ' HD1', 192.079, 105.612, 112.018], ['C', ' HD1', 192.638, 103.972, 112.335], ['C', ' HD2', 190.166, 102.495, 111.113], ['C', ' HD2', 190.902, 102.07, 112.665], ['C', ' HD2', 189.181, 102.482, 112.592]] AA_SCO= 2.4147368421052633 CA_SCO= 1.2667368421052634
[['C', ' N ', 188.505, 106.551, 114.739], ['C', ' CA ', 187.356, 107.34, 114.376], ['C', ' C ', 187.667, 108.8, 114.663], ['C', ' O ', 187.318, 109.676, 113.874], ['C', ' CB ', 186.134, 106.855, 115.13], ['C', ' CG ', 184.779, 107.461, 114.8], ['C', ' CD1', 184.446, 107.272, 113.311], ['C', ' CD2', 183.757, 106.728, 115.651], ['C', ' H ', 188.507, 105.868, 115.503], ['C', ' HA ', 187.194, 107.219, 113.309], ['C', ' HB ', 186.061, 105.772, 115.018], ['C', ' HB ', 186.307, 107.07, 116.183], ['C', ' HG ', 184.768, 108.527, 115.033], ['C', ' HD1', 183.48, 107.673, 113.125], ['C', ' HD1', 185.165, 107.789, 112.682], ['C', ' HD1', 184.446, 106.208, 113.065], ['C', ' HD2', 182.762, 107.101, 115.476], ['C', ' HD2', 183.794, 105.673, 115.398], ['C', ' HD2', 184.006, 106.852, 116.704]] AA_SCO= 2.3036842105263164 CA_SCO= 1.2675789473684211
[['C', ' N ', 188.332, 109.066, 115.788], ['C', ' CA ', 188.703, 110.429, 116.132], ['C', ' C ', 189.726, 110.953, 115.134], ['C', ' O ', 189.683, 112.12, 114.752], ['C', ' CB ', 189.237, 110.489, 117.538], ['C', ' H ', 188.586, 108.298, 116.393], ['C', ' HA ', 187.821, 111.056, 116.053], ['C', ' HB ', 189.495, 111.516, 117.783], ['C', ' HB ', 188.486, 110.125, 118.237], ['C', ' HB ', 190.128, 109.863, 117.615]] AA_SCO= 2.1300000000000003 CA_SCO= 1.2684210526315791
[['C', ' N ', 190.628, 110.081, 114.689], ['C', ' CA ', 191.615, 110.432, 113.693], ['C', ' C ', 190.963, 110.819, 112.409], ['C', ' O ', 191.348, 111.798, 111.796], ['C', ' CB ', 192.586, 109.301, 113.436], ['C', ' CG ', 193.503, 109.567, 112.286], ['C', ' CD1', 194.419, 110.575, 112.373], ['C', ' CD2', 193.459, 108.768, 111.158], ['C', ' CE1', 195.284, 110.809, 111.361], ['C', ' CE2', 194.351, 108.997, 110.127], ['C', ' CZ ', 195.259, 110.029, 110.239], ['C', ' OH ', 196.185, 110.286, 109.263], ['C', ' H ', 190.663, 109.145, 115.085], ['C', ' HA ', 192.171, 111.296, 114.057], ['C', ' HB ', 193.176, 109.11, 114.325], ['C', ' HB ', 192.036, 108.403, 113.219], ['C', ' HD1', 194.454, 111.2, 113.258], ['C', ' HD2', 192.736, 107.953, 111.087], ['C', ' HE1', 196.011, 111.615, 111.444], ['C', ' HE2', 194.337, 108.364, 109.238], ['C', ' HH ', 196.496, 109.449, 108.862]] AA_SCO= 2.2815789473684216 CA_SCO= 1.2657368421052635
[['C', ' N ', 190.019, 110.01, 111.96], ['C', ' CA ', 189.301, 110.271, 110.741], ['C', ' C ', 188.511, 111.573, 110.844], ['C', ' O ', 188.4, 112.337, 109.877], ['C', ' CB ', 188.39, 109.104, 110.459], ['C', ' H ', 189.799, 109.167, 112.488], ['C', ' HA ', 190.028, 110.375, 109.939], ['C', ' HB ', 187.894, 109.25, 109.55], ['C', ' HB ', 188.982, 108.203, 110.4], ['C', ' HB ', 187.669, 109.004, 111.267]] AA_SCO= 2.251052631578948 CA_SCO= 1.3092105263157898
[['C', ' N ', 187.988, 111.86, 112.038], ['C', ' CA ', 187.25, 113.09, 112.247], ['C', ' C ', 188.223, 114.258, 112.047], ['C', ' O ', 187.936, 115.252, 111.358], ['C', ' CB ', 186.643, 113.071, 113.66], ['C', ' CG ', 185.772, 114.238, 114.119], ['C', ' CD1', 184.57, 114.371, 113.232], ['C', ' CD2', 185.329, 113.969, 115.544], ['C', ' H ', 188.044, 111.169, 112.79], ['C', ' HA ', 186.47, 113.139, 111.522], ['C', ' HB ', 186.065, 112.154, 113.766], ['C', ' HB ', 187.46, 113.022, 114.36], ['C', ' HG ', 186.341, 115.17, 114.077], ['C', ' HD1', 183.942, 115.197, 113.576], ['C', ' HD1', 184.879, 114.575, 112.22], ['C', ' HD1', 184.005, 113.447, 113.261], ['C', ' HD2', 184.716, 114.786, 115.873], ['C', ' HD2', 184.754, 113.048, 115.586], ['C', ' HD2', 186.206, 113.879, 116.184]] AA_SCO= 2.2221052631578946 CA_SCO= 1.3130000000000002
[['C', ' N ', 189.411, 114.127, 112.615], ['C', ' CA ', 190.423, 115.12, 112.381], ['C', ' C ', 190.8, 115.031, 110.915], ['C', ' O ', 190.71, 113.984, 110.291], ['C', ' CB ', 191.642, 114.918, 113.268], ['C', ' CG ', 191.412, 115.309, 114.723], ['C', ' OD1', 190.44, 115.972, 115.026], ['C', ' OD2', 192.236, 114.952, 115.528], ['C', ' H ', 189.601, 113.333, 113.234], ['C', ' HA ', 190.008, 116.107, 112.577], ['C', ' HB ', 191.931, 113.867, 113.232], ['C', ' HB ', 192.477, 115.496, 112.873]] AA_SCO= 2.228947368421052 CA_SCO= 1.3190526315789475
[['C', ' N ', 191.166, 116.14, 110.33], ['C', ' CA ', 191.566, 116.189, 108.927], ['C', ' C ', 190.422, 115.917, 107.927], ['C', ' O ', 190.668, 115.912, 106.72], ['C', ' CB ', 192.725, 115.219, 108.638], ['C', ' CG ', 193.918, 115.349, 109.586], ['C', ' CD ', 194.551, 116.704, 109.554], ['C', ' OE1', 194.453, 117.366, 108.551], ['C', ' OE2', 195.123, 117.088, 110.545], ['C', ' H ', 191.202, 116.989, 110.876], ['C', ' HA ', 191.933, 117.198, 108.728], ['C', ' HB ', 192.387, 114.187, 108.636], ['C', ' HB ', 193.101, 115.419, 107.636], ['C', ' HG ', 193.612, 115.123, 110.601], ['C', ' HG ', 194.66, 114.606, 109.298]] AA_SCO= 2.2410526315789467 CA_SCO= 1.3190526315789475
[['C', ' N ', 189.172, 115.784, 108.395], ['C', ' CA ', 188.029, 115.729, 107.491], ['C', ' C ', 187.682, 114.438, 106.747], ['C', ' O ', 187.07, 114.515, 105.676], ['C', ' H ', 188.981, 115.737, 109.404], ['C', ' HA ', 187.151, 116.006, 108.078], ['C', ' HA ', 188.145, 116.524, 106.758]] AA_SCO= 2.282631578947368 CA_SCO= 1.2978947368421054
[['C', ' N ', 188.071, 113.267, 107.234], ['C', ' CA ', 187.67, 112.059, 106.518], ['C', ' C ', 186.216, 111.855, 106.899], ['C', ' O ', 185.366, 111.497, 106.085], ['C', ' CB ', 188.5, 110.838, 106.916], ['C', ' CG1', 190.012, 111.083, 106.612], ['C', ' CG2', 187.947, 109.569, 106.24], ['C', ' CD1', 190.373, 111.389, 105.177], ['C', ' H ', 188.584, 113.205, 108.12], ['C', ' HA ', 187.721, 112.218, 105.446], ['C', ' HB ', 188.431, 110.721, 107.964], ['C', ' HG1', 190.348, 111.919, 107.229], ['C', ' HG1', 190.566, 110.208, 106.905], ['C', ' HG2', 188.513, 108.707, 106.551], ['C', ' HG2', 186.907, 109.417, 106.514], ['C', ' HG2', 188.007, 109.667, 105.16], ['C', ' HD1', 191.451, 111.537, 105.108], ['C', ' HD1', 190.087, 110.563, 104.532], ['C', ' HD1', 189.873, 112.298, 104.848]] AA_SCO= 2.1536842105263156 CA_SCO= 1.264526315789474
[['C', ' N ', 185.991, 112.043, 108.182], ['C', ' CA ', 184.724, 111.955, 108.859], ['C', ' C ', 184.383, 113.342, 109.37], ['C', ' O ', 185.232, 114.057, 109.869], ['C', ' CB ', 184.825, 110.86, 109.942], ['C', ' CG1', 185.13, 109.509, 109.254], ['C', ' CG2', 183.665, 110.795, 110.835], ['C', ' CD1', 184.098, 108.985, 108.306], ['C', ' H ', 186.807, 112.301, 108.742], ['C', ' HA ', 183.95, 111.695, 108.147], ['C', ' HB ', 185.683, 111.074, 110.552], ['C', ' HG1', 186.007, 109.625, 108.679], ['C', ' HG1', 185.299, 108.754, 110.019], ['C', ' HG2', 183.819, 110.02, 111.579], ['C', ' HG2', 183.552, 111.741, 111.337], ['C', ' HG2', 182.776, 110.577, 110.261], ['C', ' HD1', 184.449, 108.066, 107.881], ['C', ' HD1', 183.185, 108.807, 108.817], ['C', ' HD1', 183.924, 109.675, 107.499]] AA_SCO= 2.1978947368421053 CA_SCO= 1.2572631578947369
[['C', ' N ', 183.168, 113.775, 109.149], ['C', ' CA ', 182.722, 115.088, 109.604], ['C', ' C ', 181.976, 115.018, 110.934], ['C', ' O ', 181.636, 116.04, 111.525], ['C', ' CB ', 181.898, 115.736, 108.51], ['C', ' CG ', 182.679, 116.112, 107.299], ['C', ' CD ', 181.8, 116.567, 106.183], ['C', ' OE1', 180.589, 116.585, 106.363], ['C', ' OE2', 182.332, 116.936, 105.159], ['C', ' H ', 182.519, 113.138, 108.687], ['C', ' HA ', 183.603, 115.71, 109.758], ['C', ' HB ', 181.174, 115.017, 108.148], ['C', ' HB ', 181.366, 116.61, 108.89], ['C', ' HG ', 183.351, 116.924, 107.566], ['C', ' HG ', 183.291, 115.28, 106.986]] AA_SCO= 2.115263157894737 CA_SCO= 1.7584736842105264
[['C', ' N ', 181.751, 113.802, 111.393], ['C', ' CA ', 181.066, 113.491, 112.638], ['C', ' C ', 180.801, 111.998, 112.659], ['C', ' O ', 180.844, 111.343, 111.616], ['C', ' H ', 182.084, 113.034, 110.831], ['C', ' HA ', 181.689, 113.771, 113.484], ['C', ' HA ', 180.14, 114.048, 112.719]] AA_SCO= 2.107894736842106 CA_SCO= 1.781947368421053
[['C', ' N ', 180.427, 111.465, 113.8], ['C', ' CA ', 180.177, 110.034, 113.86], ['C', ' C ', 179.119, 109.674, 114.86], ['C', ' O ', 178.953, 110.341, 115.874], ['C', ' CB ', 181.45, 109.322, 114.201], ['C', ' H ', 180.372, 112.077, 114.619], ['C', ' HA ', 179.825, 109.716, 112.885], ['C', ' HB ', 181.26, 108.256, 114.211], ['C', ' HB ', 182.203, 109.558, 113.458], ['C', ' HB ', 181.793, 109.637, 115.174]] AA_SCO= 1.9831578947368425 CA_SCO= 1.7812631578947369
[['C', ' N ', 178.421, 108.587, 114.599], ['C', ' CA ', 177.4, 108.131, 115.514], ['C', ' C ', 177.88, 107.022, 116.398], ['C', ' O ', 178.205, 105.909, 115.961], ['C', ' CB ', 176.147, 107.729, 114.752], ['C', ' CG1', 175.136, 107.18, 115.681], ['C', ' CG2', 175.558, 108.985, 114.087], ['C', ' H ', 178.637, 108.062, 113.748], ['C', ' HA ', 177.127, 108.961, 116.157], ['C', ' HB ', 176.389, 106.968, 114.01], ['C', ' HG1', 174.284, 106.923, 115.085], ['C', ' HG1', 175.501, 106.284, 116.183], ['C', ' HG1', 174.873, 107.929, 116.431], ['C', ' HG2', 174.65, 108.726, 113.557], ['C', ' HG2', 175.326, 109.711, 114.857], ['C', ' HG2', 176.279, 109.41, 113.394]] AA_SCO= 1.912105263157895 CA_SCO= 1.759368421052632
[['C', ' N ', 177.873, 107.356, 117.673], ['C', ' CA ', 178.376, 106.523, 118.732], ['C', ' C ', 177.369, 106.387, 119.848], ['C', ' O ', 176.417, 107.162, 119.932], ['C', ' CB ', 179.688, 107.117, 119.272], ['C', ' CG1', 180.718, 107.189, 118.162], ['C', ' CG2', 179.44, 108.519, 119.831], ['C', ' H ', 177.48, 108.277, 117.897], ['C', ' HA ', 178.559, 105.541, 118.329], ['C', ' HB ', 180.079, 106.465, 120.053], ['C', ' HG1', 181.63, 107.574, 118.567], ['C', ' HG1', 180.901, 106.205, 117.762], ['C', ' HG1', 180.373, 107.842, 117.363], ['C', ' HG2', 180.368, 108.937, 120.214], ['C', ' HG2', 179.057, 109.17, 119.041], ['C', ' HG2', 178.711, 108.473, 120.642]] AA_SCO= 1.9073684210526316 CA_SCO= 1.736842105263158
[['C', ' N ', 177.574, 105.404, 120.709], ['C', ' CA ', 176.706, 105.242, 121.862], ['C', ' C ', 177.26, 106.033, 123.024], ['C', ' O ', 178.273, 105.641, 123.611], ['C', ' CB ', 176.605, 103.781, 122.244], ['C', ' H ', 178.359, 104.783, 120.578], ['C', ' HA ', 175.717, 105.628, 121.618], ['C', ' HB ', 175.965, 103.688, 123.092], ['C', ' HB ', 176.207, 103.211, 121.422], ['C', ' HB ', 177.592, 103.406, 122.494]] AA_SCO= 2.005789473684211 CA_SCO= 1.734421052631579
[['C', ' N ', 176.671, 107.176, 123.311], ['C', ' CA ', 177.206, 108.052, 124.325], ['C', ' C ', 176.522, 107.798, 125.645], ['C', ' O ', 175.783, 106.822, 125.785], ['C', ' H ', 175.812, 107.461, 122.827], ['C', ' HA ', 178.273, 107.879, 124.41], ['C', ' HA ', 177.058, 109.084, 124.015]] AA_SCO= 2.0352631578947373 CA_SCO= 1.749
[['C', ' N ', 176.784, 108.627, 126.656], ['C', ' CA ', 176.197, 108.556, 127.976], ['C', ' C ', 174.694, 108.724, 127.87], ['C', ' O ', 174.235, 109.527, 127.061], ['C', ' CB ', 176.835, 109.749, 128.69], ['C', ' CG ', 178.114, 110.024, 127.916], ['C', ' CD ', 177.767, 109.709, 126.488], ['C', ' HA ', 176.457, 107.599, 128.453], ['C', ' HB ', 176.137, 110.602, 128.69], ['C', ' HB ', 177.023, 109.495, 129.742], ['C', ' HG ', 178.423, 111.073, 128.054], ['C', ' HG ', 178.944, 109.402, 128.294], ['C', ' HD ', 177.301, 110.579, 126.0], ['C', ' HD ', 178.68, 109.384, 125.98]] AA_SCO= 2.0447368421052636 CA_SCO= 1.7526315789473683
[['C', ' N ', 173.94, 108.006, 128.694], ['C', ' CA ', 172.485, 108.122, 128.692], ['C', ' C ', 171.957, 108.879, 129.909], ['C', ' O ', 172.701, 109.564, 130.614], ['C', ' H ', 174.366, 107.349, 129.338], ['C', ' HA ', 172.162, 108.635, 127.791], ['C', ' HA ', 172.047, 107.122, 128.661]] AA_SCO= 2.083157894736842 CA_SCO= 1.7972105263157894
[['C', ' N ', 170.651, 108.73, 130.163], ['C', ' CA ', 169.944, 109.382, 131.274], ['C', ' C ', 170.092, 108.602, 132.577], ['C', ' O ', 169.679, 109.052, 133.647], ['C', ' CB ', 168.455, 109.527, 130.942], ['C', ' CG ', 167.624, 108.221, 131.032], ['C', ' CD ', 167.72, 107.353, 129.819], ['C', ' OE1', 168.604, 107.567, 129.026], ['C', ' OE2', 166.923, 106.451, 129.684], ['C', ' H ', 170.095, 108.152, 129.525], ['C', ' HA ', 170.374, 110.373, 131.42], ['C', ' HB ', 168.006, 110.247, 131.626], ['C', ' HB ', 168.346, 109.926, 129.934], ['C', ' HG ', 167.9, 107.64, 131.904], ['C', ' HG ', 166.582, 108.508, 131.162]] AA_SCO= 2.2321052631578944 CA_SCO= 1.798315789473684
[['C', ' N ', 170.639, 107.415, 132.445], ['C', ' CA ', 170.825, 106.43, 133.49], ['C', ' C ', 172.232, 105.892, 133.362], ['C', ' O ', 172.826, 105.981, 132.291], ['C', ' CB ', 169.765, 105.328, 133.364], ['C', ' CG ', 169.844, 104.196, 134.385], ['C', ' CD ', 169.739, 104.649, 135.814], ['C', ' OE1', 168.684, 104.54, 136.384], ['C', ' OE2', 170.735, 105.122, 136.334], ['C', ' H ', 170.944, 107.182, 131.512], ['C', ' HA ', 170.728, 106.912, 134.464], ['C', ' HB ', 168.775, 105.774, 133.443], ['C', ' HB ', 169.834, 104.879, 132.378], ['C', ' HG ', 169.019, 103.512, 134.186], ['C', ' HG ', 170.757, 103.633, 134.237]] AA_SCO= 2.3894736842105258 CA_SCO= 1.798
[['C', ' N ', 172.771, 105.362, 134.439], ['C', ' CA ', 174.112, 104.823, 134.403], ['C', ' C ', 174.173, 103.613, 133.513], ['C', ' O ', 173.265, 102.781, 133.523], ['C', ' CB ', 174.545, 104.433, 135.805], ['C', ' CG ', 174.822, 105.582, 136.633], ['C', ' CD1', 173.855, 106.09, 137.465], ['C', ' CD2', 176.06, 106.178, 136.597], ['C', ' CE1', 174.119, 107.184, 138.246], ['C', ' CE2', 176.329, 107.269, 137.377], ['C', ' CZ ', 175.355, 107.775, 138.202], ['C', ' H ', 172.205, 105.325, 135.293], ['C', ' HA ', 174.784, 105.585, 134.011], ['C', ' HB ', 173.762, 103.842, 136.284], ['C', ' HB ', 175.435, 103.828, 135.76], ['C', ' HD1', 172.866, 105.619, 137.503], ['C', ' HD2', 176.834, 105.773, 135.942], ['C', ' HE1', 173.344, 107.581, 138.901], ['C', ' HE2', 177.315, 107.737, 137.344], ['C', ' HZ ', 175.567, 108.643, 138.825]] AA_SCO= 2.2942105263157893 CA_SCO= 1.7997894736842104
[['C', ' N ', 175.25, 103.518, 132.731], ['C', ' CA ', 175.542, 102.406, 131.818], ['C', ' C ', 174.626, 102.265, 130.611], ['C', ' O ', 175.101, 101.962, 129.521], ['C', ' CB ', 175.695, 101.142, 132.633], ['C', ' CG ', 176.967, 101.261, 133.303], ['C', ' CD1', 177.227, 101.652, 134.565], ['C', ' CD2', 178.22, 100.996, 132.705], ['C', ' NE1', 178.565, 101.683, 134.764], ['C', ' CE2', 179.183, 101.28, 133.642], ['C', ' CE3', 178.599, 100.548, 131.459], ['C', ' CZ2', 180.504, 101.14, 133.378], ['C', ' CZ3', 179.931, 100.398, 131.189], ['C', ' CH2', 180.862, 100.691, 132.128], ['C', ' H ', 175.923, 104.271, 132.774], ['C', ' HA ', 176.531, 102.605, 131.411], ['C', ' HB ', 174.91, 101.036, 133.362], ['C', ' HB ', 175.694, 100.264, 131.993], ['C', ' HD1', 176.486, 101.927, 135.301], ['C', ' HE1', 179.081, 101.967, 135.628], ['C', ' HE3', 177.85, 100.313, 130.713], ['C', ' HZ2', 181.252, 101.371, 134.119], ['C', ' HZ3', 180.221, 100.04, 130.204], ['C', ' HH2', 181.905, 100.57, 131.885]] AA_SCO= 2.2784210526315785 CA_SCO= 1.8114736842105263
[['C', ' N ', 173.347, 102.48, 130.783], ['C', ' CA ', 172.434, 102.467, 129.669], ['C', ' C ', 172.94, 103.532, 128.669], ['C', ' O ', 173.082, 104.687, 129.048], ['C', ' CB ', 171.042, 102.804, 130.18], ['C', ' CG ', 169.942, 102.746, 129.182], ['C', ' CD ', 168.603, 102.982, 129.891], ['C', ' CE ', 167.415, 102.921, 128.938], ['C', ' NZ ', 167.337, 104.128, 128.046], ['C', ' H ', 173.048, 102.669, 131.733], ['C', ' HA ', 172.424, 101.467, 129.259], ['C', ' HB ', 170.785, 102.148, 131.001], ['C', ' HB ', 171.061, 103.816, 130.585], ['C', ' HG ', 170.105, 103.51, 128.417], ['C', ' HG ', 169.934, 101.764, 128.704], ['C', ' HD ', 168.469, 102.23, 130.672], ['C', ' HD ', 168.612, 103.97, 130.362], ['C', ' HE ', 167.504, 102.03, 128.318], ['C', ' HE ', 166.495, 102.856, 129.519], ['C', ' HZ ', 166.545, 104.056, 127.44], ['C', ' HZ ', 167.231, 104.982, 128.626], ['C', ' HZ ', 168.171, 104.213, 127.489]] AA_SCO= 2.2873684210526313 CA_SCO= 1.812421052631579
[['C', ' N ', 173.268, 103.172, 127.427], ['C', ' CA ', 173.781, 104.016, 126.367], ['C', ' C ', 172.728, 104.865, 125.71], ['C', ' O ', 171.555, 104.487, 125.689], ['C', ' CB ', 174.305, 102.998, 125.389], ['C', ' CG ', 173.417, 101.825, 125.595], ['C', ' CD ', 173.104, 101.811, 127.028], ['C', ' HA ', 174.595, 104.646, 126.762], ['C', ' HB ', 174.207, 103.41, 124.385], ['C', ' HB ', 175.366, 102.797, 125.572], ['C', ' HG ', 172.497, 101.924, 124.993], ['C', ' HG ', 173.91, 100.895, 125.271], ['C', ' HD ', 172.056, 101.49, 127.132], ['C', ' HD ', 173.826, 101.172, 127.547]] AA_SCO= 2.201052631578947 CA_SCO= 1.8073157894736842
[['C', ' N ', 173.164, 105.934, 125.078], ['C', ' CA ', 172.308, 106.742, 124.235], ['C', ' C ', 172.989, 107.174, 122.942], ['C', ' O ', 173.927, 107.973, 122.98], ['C', ' CB ', 171.863, 107.978, 124.986], ['C', ' CG ', 171.121, 109.011, 124.16], ['C', ' CD ', 169.823, 108.543, 123.576], ['C', ' OE1', 168.946, 108.036, 124.275], ['C', ' NE2', 169.687, 108.704, 122.262], ['C', ' H ', 174.145, 106.203, 125.206], ['C', ' HA ', 171.418, 106.165, 124.027], ['C', ' HB ', 171.22, 107.68, 125.812], ['C', ' HB ', 172.737, 108.464, 125.403], ['C', ' HG ', 170.898, 109.851, 124.812], ['C', ' HG ', 171.754, 109.36, 123.341], ['C', ' HE2', 168.847, 108.421, 121.803], ['C', ' HE2', 170.467, 109.09, 121.707]] AA_SCO= 2.1710526315789465 CA_SCO= 1.804157894736842
[['C', ' N ', 172.508, 106.753, 121.772], ['C', ' CA ', 173.051, 107.152, 120.498], ['C', ' C ', 173.1, 108.662, 120.379], ['C', ' O ', 172.117, 109.356, 120.657], ['C', ' CB ', 172.019, 106.595, 119.533], ['C', ' CG ', 171.467, 105.383, 120.238], ['C', ' CD ', 171.423, 105.755, 121.689], ['C', ' HA ', 174.033, 106.697, 120.337], ['C', ' HB ', 171.246, 107.352, 119.343], ['C', ' HB ', 172.492, 106.409, 118.577], ['C', ' HG ', 170.475, 105.139, 119.829], ['C', ' HG ', 172.1, 104.51, 120.049], ['C', ' HD ', 170.449, 106.172, 121.943], ['C', ' HD ', 171.667, 104.851, 122.284]] AA_SCO= 2.1294736842105255 CA_SCO= 1.825263157894737
[['C', ' N ', 174.224, 109.156, 119.909], ['C', ' CA ', 174.426, 110.576, 119.712], ['C', ' C ', 175.401, 110.777, 118.585], ['C', ' O ', 176.124, 109.841, 118.23], ['C', ' CB ', 174.896, 111.232, 121.004], ['C', ' CG ', 176.232, 110.725, 121.571], ['C', ' SD ', 177.714, 111.415, 120.77], ['C', ' CE ', 177.69, 113.163, 121.14], ['C', ' H ', 174.994, 108.507, 119.721], ['C', ' HA ', 173.48, 111.029, 119.416], ['C', ' HB ', 174.95, 112.3, 120.863], ['C', ' HB ', 174.143, 111.048, 121.776], ['C', ' HG ', 176.272, 110.961, 122.629], ['C', ' HG ', 176.266, 109.635, 121.467], ['C', ' HE ', 178.547, 113.642, 120.691], ['C', ' HE ', 176.795, 113.619, 120.731], ['C', ' HE ', 177.721, 113.314, 122.217]] AA_SCO= 2.2205263157894732 CA_SCO= 1.861210526315789
[['C', ' N ', 175.442, 111.968, 118.004], ['C', ' CA ', 176.445, 112.146, 116.981], ['C', ' C ', 177.495, 113.078, 117.507], ['C', ' O ', 177.193, 114.162, 118.001], ['C', ' CB ', 175.857, 112.687, 115.658], ['C', ' CG1', 175.258, 114.091, 115.798], ['C', ' CG2', 176.929, 112.671, 114.601], ['C', ' H ', 174.832, 112.72, 118.296], ['C', ' HA ', 176.913, 111.194, 116.769], ['C', ' HB ', 175.046, 112.033, 115.359], ['C', ' HG1', 174.843, 114.383, 114.841], ['C', ' HG1', 174.479, 114.101, 116.544], ['C', ' HG1', 176.016, 114.817, 116.072], ['C', ' HG2', 176.51, 112.996, 113.689], ['C', ' HG2', 177.755, 113.327, 114.87], ['C', ' HG2', 177.294, 111.672, 114.478]] AA_SCO= 2.194736842105263 CA_SCO= 1.8716315789473683
[['C', ' N ', 178.722, 112.638, 117.403], ['C', ' CA ', 179.848, 113.402, 117.83], ['C', ' C ', 180.326, 114.23, 116.676], ['C', ' O ', 180.443, 113.73, 115.558], ['C', ' CB ', 180.946, 112.479, 118.308], ['C', ' H ', 178.857, 111.722, 116.991], ['C', ' HA ', 179.539, 114.068, 118.628], ['C', ' HB ', 181.808, 113.056, 118.615], ['C', ' HB ', 180.588, 111.883, 119.148], ['C', ' HB ', 181.223, 111.828, 117.492]] AA_SCO= 2.248421052631579 CA_SCO= 1.853894736842105
[['C', ' N ', 180.653, 115.481, 116.934], ['C', ' CA ', 181.225, 116.348, 115.909], ['C', ' C ', 182.542, 116.903, 116.408], ['C', ' O ', 183.062, 117.898, 115.904], ['C', ' CB ', 180.252, 117.447, 115.531], ['C', ' CG ', 178.997, 116.927, 114.849], ['C', ' SD ', 177.914, 118.233, 114.233], ['C', ' CE ', 177.231, 118.874, 115.74], ['C', ' H ', 180.486, 115.839, 117.891], ['C', ' HA ', 181.438, 115.758, 115.02], ['C', ' HB ', 179.972, 117.989, 116.428], ['C', ' HB ', 180.741, 118.15, 114.853], ['C', ' HG ', 179.295, 116.297, 114.009], ['C', ' HG ', 178.43, 116.309, 115.549], ['C', ' HE ', 176.541, 119.683, 115.51], ['C', ' HE ', 176.702, 118.077, 116.268], ['C', ' HE ', 178.025, 119.258, 116.374]] AA_SCO= 2.2305263157894735 CA_SCO= 1.8476315789473683
[['C', ' N ', 183.043, 116.259, 117.437], ['C', ' CA ', 184.278, 116.597, 118.115], ['C', ' C ', 184.906, 115.372, 118.702], ['C', ' O ', 184.222, 114.476, 119.194], ['C', ' CB ', 184.072, 117.593, 119.222], ['C', ' OG ', 185.292, 117.785, 119.919], ['C', ' H ', 182.527, 115.448, 117.748], ['C', ' HA ', 184.97, 117.022, 117.386], ['C', ' HB ', 183.73, 118.539, 118.803], ['C', ' HB ', 183.302, 117.235, 119.907], ['C', ' HG ', 185.136, 118.518, 120.535]] AA_SCO= 2.3389473684210524 CA_SCO= 1.8306842105263155
[['C', ' N ', 186.225, 115.326, 118.708], ['C', ' CA ', 186.889, 114.179, 119.289], ['C', ' C ', 186.597, 114.076, 120.783], ['C', ' O ', 186.509, 112.972, 121.324], ['C', ' CB ', 188.372, 114.278, 119.041], ['C', ' OG ', 188.91, 115.37, 119.722], ['C', ' H ', 186.772, 116.083, 118.315], ['C', ' HA ', 186.513, 113.281, 118.801], ['C', ' HB ', 188.859, 113.363, 119.37], ['C', ' HB ', 188.557, 114.384, 117.969], ['C', ' HG ', 189.846, 115.39, 119.493]] AA_SCO= 2.27578947368421 CA_SCO= 1.8447894736842103
[['C', ' N ', 186.269, 115.196, 121.43], ['C', ' CA ', 185.98, 115.196, 122.86], ['C', ' C ', 184.755, 114.356, 123.179], ['C', ' O ', 184.598, 113.839, 124.289], ['C', ' CB ', 185.69, 116.613, 123.342], ['C', ' CG ', 186.898, 117.536, 123.373], ['C', ' OD1', 188.009, 117.078, 123.291], ['C', ' OD2', 186.681, 118.717, 123.463], ['C', ' H ', 186.308, 116.092, 120.941], ['C', ' HA ', 186.839, 114.788, 123.392], ['C', ' HB ', 184.935, 117.057, 122.694], ['C', ' HB ', 185.265, 116.57, 124.344]] AA_SCO= 2.2621052631578946 CA_SCO= 1.8272105263157894
[['C', ' N ', 183.854, 114.258, 122.216], ['C', ' CA ', 182.61, 113.553, 122.375], ['C', ' C ', 182.809, 112.07, 122.128], ['C', ' O ', 182.013, 111.246, 122.583], ['C', ' CB ', 181.582, 114.186, 121.464], ['C', ' CG ', 181.201, 115.611, 121.893], ['C', ' CD ', 180.37, 116.358, 120.884], ['C', ' OE1', 180.337, 115.928, 119.752], ['C', ' OE2', 179.778, 117.345, 121.237], ['C', ' H ', 184.051, 114.647, 121.291], ['C', ' HA ', 182.269, 113.689, 123.398], ['C', ' HB ', 181.988, 114.259, 120.472], ['C', ' HB ', 180.698, 113.566, 121.425], ['C', ' HG ', 180.647, 115.553, 122.83], ['C', ' HG ', 182.114, 116.174, 122.083]] AA_SCO= 2.2215789473684207 CA_SCO= 1.829736842105263
[['C', ' N ', 183.863, 111.714, 121.39], ['C', ' CA ', 184.115, 110.324, 121.116], ['C', ' C ', 184.794, 109.795, 122.358], ['C', ' O ', 184.65, 108.625, 122.71], ['C', ' CB ', 185.001, 110.161, 119.878], ['C', ' CG ', 184.395, 110.64, 118.523], ['C', ' CD1', 185.443, 110.534, 117.459], ['C', ' CD2', 183.22, 109.797, 118.139], ['C', ' H ', 184.53, 112.399, 121.044], ['C', ' HA ', 183.176, 109.796, 120.986], ['C', ' HB ', 185.921, 110.723, 120.043], ['C', ' HB ', 185.262, 109.106, 119.773], ['C', ' HG ', 184.088, 111.688, 118.607], ['C', ' HD1', 185.041, 110.873, 116.507], ['C', ' HD1', 186.278, 111.156, 117.741], ['C', ' HD1', 185.77, 109.499, 117.363], ['C', ' HD2', 182.831, 110.136, 117.189], ['C', ' HD2', 183.543, 108.766, 118.047], ['C', ' HD2', 182.439, 109.87, 118.886]] AA_SCO= 2.215789473684211 CA_SCO= 1.7772105263157894
[['C', ' N ', 185.549, 110.677, 123.023], ['C', ' CA ', 186.172, 110.305, 124.273], ['C', ' C ', 185.082, 110.171, 125.327], ['C', ' O ', 185.007, 109.171, 126.027], ['C', ' CB ', 187.221, 111.326, 124.707], ['C', ' CG ', 188.495, 111.322, 123.872], ['C', ' CD ', 189.488, 112.401, 124.346], ['C', ' CE ', 190.79, 112.362, 123.532], ['C', ' NZ ', 191.748, 113.482, 123.88], ['C', ' H ', 185.697, 111.604, 122.617], ['C', ' HA ', 186.657, 109.337, 124.154], ['C', ' HB ', 186.792, 112.327, 124.645], ['C', ' HB ', 187.491, 111.153, 125.744], ['C', ' HG ', 188.968, 110.341, 123.945], ['C', ' HG ', 188.236, 111.503, 122.826], ['C', ' HD ', 189.033, 113.389, 124.241], ['C', ' HD ', 189.733, 112.237, 125.398], ['C', ' HE ', 191.286, 111.425, 123.726], ['C', ' HE ', 190.546, 112.423, 122.471], ['C', ' HZ ', 192.588, 113.393, 123.316], ['C', ' HZ ', 191.319, 114.374, 123.694], ['C', ' HZ ', 192.043, 113.467, 124.872]] AA_SCO= 2.1594736842105267 CA_SCO= 1.7737894736842108
[['C', ' N ', 184.124, 111.097, 125.353], ['C', ' CA ', 183.033, 111.001, 126.316], ['C', ' C ', 182.234, 109.711, 126.135], ['C', ' O ', 181.776, 109.107, 127.104], ['C', ' CB ', 182.109, 112.185, 126.167], ['C', ' H ', 184.208, 111.941, 124.781], ['C', ' HA ', 183.467, 111.002, 127.315], ['C', ' HB ', 181.314, 112.119, 126.907], ['C', ' HB ', 182.673, 113.107, 126.311], ['C', ' HB ', 181.677, 112.176, 125.171]] AA_SCO= 2.127368421052632 CA_SCO= 1.7709473684210528
[['C', ' N ', 182.094, 109.276, 124.889], ['C', ' CA ', 181.369, 108.069, 124.528], ['C', ' C ', 182.226, 106.795, 124.65], ['C', ' O ', 181.745, 105.704, 124.33], ['C', ' CB ', 180.85, 108.205, 123.106], ['C', ' H ', 182.449, 109.865, 124.132], ['C', ' HA ', 180.532, 107.969, 125.212], ['C', ' HB ', 180.272, 107.32, 122.836], ['C', ' HB ', 180.22, 109.091, 123.029], ['C', ' HB ', 181.699, 108.306, 122.432]] AA_SCO= 2.143157894736842 CA_SCO= 1.7560526315789478
[['C', ' N ', 183.493, 106.933, 125.043], ['C', ' CA ', 184.439, 105.828, 125.153], ['C', ' C ', 184.029, 104.834, 126.213], ['C', ' O ', 183.5, 105.197, 127.262], ['C', ' CB ', 185.816, 106.347, 125.498], ['C', ' H ', 183.836, 107.857, 125.308], ['C', ' HA ', 184.468, 105.314, 124.193], ['C', ' HB ', 186.522, 105.523, 125.56], ['C', ' HB ', 186.137, 107.051, 124.739], ['C', ' HB ', 185.754, 106.851, 126.451]] AA_SCO= 2.15578947368421 CA_SCO= 1.7545789473684212
[['C', ' N ', 184.322, 103.572, 125.955], ['C', ' CA ', 184.037, 102.504, 126.895], ['C', ' C ', 183.052, 101.568, 126.236], ['C', ' O ', 182.382, 101.946, 125.275], ['C', ' H ', 184.734, 103.334, 125.067], ['C', ' HA ', 184.956, 101.977, 127.157], ['C', ' HA ', 183.615, 102.913, 127.812]] AA_SCO= 2.2042105263157894 CA_SCO= 1.7581578947368421
[['C', ' N ', 182.948, 100.351, 126.729], ['C', ' CA ', 182.033, 99.414, 126.109], ['C', ' C ', 180.852, 99.182, 127.002], ['C', ' O ', 180.997, 98.901, 128.187], ['C', ' CB ', 182.721, 98.076, 125.785], ['C', ' OG1', 183.804, 98.296, 124.868], ['C', ' CG2', 181.724, 97.132, 125.124], ['C', ' H ', 183.492, 100.072, 127.532], ['C', ' HA ', 181.667, 99.835, 125.174], ['C', ' HB ', 183.107, 97.628, 126.701], ['C', ' HG1', 184.371, 97.523, 124.862], ['C', ' HG2', 182.222, 96.195, 124.888], ['C', ' HG2', 180.888, 96.93, 125.786], ['C', ' HG2', 181.35, 97.581, 124.207]] AA_SCO= 2.1647368421052633 CA_SCO= 1.7577894736842108
[['C', ' N ', 179.683, 99.341, 126.428], ['C', ' CA ', 178.44, 99.121, 127.118], ['C', ' C ', 177.978, 97.79, 126.578], ['C', ' O ', 178.199, 97.508, 125.403], ['C', ' CB ', 177.468, 100.281, 126.862], ['C', ' CG ', 177.752, 101.553, 127.736], ['C', ' CD ', 178.898, 102.478, 127.228], ['C', ' CE ', 178.447, 103.405, 126.113], ['C', ' NZ ', 179.559, 104.306, 125.645], ['C', ' H ', 179.669, 99.594, 125.449], ['C', ' HA ', 178.615, 99.021, 128.19], ['C', ' HB ', 177.497, 100.56, 125.812], ['C', ' HB ', 176.45, 99.96, 127.084], ['C', ' HG ', 176.841, 102.151, 127.776], ['C', ' HG ', 177.989, 101.249, 128.732], ['C', ' HD ', 179.238, 103.091, 128.061], ['C', ' HD ', 179.746, 101.915, 126.875], ['C', ' HE ', 178.091, 102.827, 125.265], ['C', ' HE ', 177.629, 104.029, 126.483], ['C', ' HZ ', 179.19, 104.915, 124.908], ['C', ' HZ ', 179.912, 104.881, 126.391], ['C', ' HZ ', 180.326, 103.754, 125.26]] AA_SCO= 2.048947368421053 CA_SCO= 1.7578421052631579
[['C', ' N ', 177.353, 96.977, 127.412], ['C', ' CA ', 176.947, 95.632, 126.999], ['C', ' C ', 175.466, 95.439, 126.821], ['C', ' O ', 174.98, 94.303, 126.851], ['C', ' CB ', 177.548, 94.619, 127.96], ['C', ' CG ', 179.024, 94.653, 127.84], ['C', ' CD1', 179.735, 95.454, 128.665], ['C', ' CD2', 179.673, 93.914, 126.871], ['C', ' CE1', 181.07, 95.539, 128.531], ['C', ' CE2', 181.042, 94.004, 126.755], ['C', ' CZ ', 181.73, 94.828, 127.602], ['C', ' OH ', 183.097, 94.981, 127.512], ['C', ' H ', 177.206, 97.286, 128.364], ['C', ' HA ', 177.393, 95.441, 126.021], ['C', ' HB ', 177.273, 94.86, 128.988], ['C', ' HB ', 177.195, 93.613, 127.732], ['C', ' HD1', 179.231, 96.055, 129.421], ['C', ' HD2', 179.106, 93.271, 126.195], ['C', ' HE1', 181.623, 96.195, 129.157], ['C', ' HE2', 181.569, 93.434, 125.991], ['C', ' HH ', 183.434, 95.432, 128.344]] AA_SCO= 2.139473684210527 CA_SCO= 1.7628947368421055
[['C', ' N ', 174.764, 96.544, 126.664], ['C', ' CA ', 173.342, 96.521, 126.413], ['C', ' C ', 173.042, 97.134, 125.068], ['C', ' O ', 173.938, 97.393, 124.265], ['C', ' CB ', 172.498, 97.163, 127.521], ['C', ' OG1', 171.125, 96.868, 127.262], ['C', ' CG2', 172.706, 98.613, 127.602], ['C', ' H ', 175.255, 97.425, 126.672], ['C', ' HA ', 173.039, 95.487, 126.336], ['C', ' HB ', 172.757, 96.714, 128.455], ['C', ' HG1', 171.023, 95.901, 127.431], ['C', ' HG2', 172.092, 99.018, 128.395], ['C', ' HG2', 173.754, 98.807, 127.816], ['C', ' HG2', 172.432, 99.083, 126.668]] AA_SCO= 2.1394736842105266 CA_SCO= 1.765736842105263
[['C', ' N ', 171.776, 97.306, 124.797], ['C', ' CA ', 171.334, 97.784, 123.516], ['C', ' C ', 171.34, 99.27, 123.353], ['C', ' O ', 170.789, 100.014, 124.161], ['C', ' CB ', 169.943, 97.255, 123.264], ['C', ' CG ', 170.031, 95.848, 123.039], ['C', ' CD1', 169.979, 94.968, 124.083], ['C', ' CD2', 170.222, 95.379, 121.782], ['C', ' CE1', 170.128, 93.651, 123.858], ['C', ' CE2', 170.369, 94.076, 121.56], ['C', ' CZ ', 170.329, 93.213, 122.585], ['C', ' H ', 171.12, 97.104, 125.535], ['C', ' HA ', 172.002, 97.366, 122.761], ['C', ' HB ', 169.298, 97.441, 124.124], ['C', ' HB ', 169.509, 97.733, 122.387], ['C', ' HD1', 169.841, 95.336, 125.081], ['C', ' HD2', 170.276, 96.073, 120.938], ['C', ' HE1', 170.104, 92.945, 124.677], ['C', ' HE2', 170.535, 93.722, 120.552], ['C', ' HZ ', 170.478, 92.176, 122.39]] AA_SCO= 1.928421052631579 CA_SCO= 1.7630526315789476
[['C', ' N ', 171.908, 99.675, 122.236], ['C', ' CA ', 172.001, 101.053, 121.826], ['C', ' C ', 171.702, 101.083, 120.346], ['C', ' O ', 172.545, 100.668, 119.549], ['C', ' CB ', 173.385, 101.598, 121.982], ['C', ' OG ', 173.393, 102.926, 121.591], ['C', ' H ', 172.332, 98.97, 121.65], ['C', ' HA ', 171.312, 101.649, 122.411], ['C', ' HB ', 173.725, 101.498, 122.974], ['C', ' HB ', 174.07, 101.032, 121.352], ['C', ' HG ', 174.311, 103.202, 121.575]] AA_SCO= 1.9494736842105262 CA_SCO= 1.7696315789473682
[['C', ' N ', 170.535, 101.535, 119.904], ['C', ' CA ', 170.121, 101.535, 118.521], ['C', ' C ', 170.825, 102.679, 117.823], ['C', ' O ', 170.221, 103.669, 117.443], ['C', ' CB ', 168.615, 101.725, 118.64], ['C', ' CG ', 168.452, 102.559, 119.881], ['C', ' CD ', 169.545, 102.087, 120.827], ['C', ' HA ', 170.367, 100.568, 118.055], ['C', ' HB ', 168.223, 102.224, 117.742], ['C', ' HB ', 168.123, 100.742, 118.705], ['C', ' HG ', 168.561, 103.61, 119.624], ['C', ' HG ', 167.441, 102.443, 120.299], ['C', ' HD ', 169.944, 102.965, 121.359], ['C', ' HD ', 169.166, 101.306, 121.51]] AA_SCO= 1.951052631578947 CA_SCO= 1.7514736842105263
[['C', ' N ', 172.133, 102.548, 117.667], ['C', ' CA ', 172.966, 103.614, 117.136], ['C', ' C ', 172.624, 103.984, 115.719], ['C', ' O ', 172.673, 105.147, 115.339], ['C', ' CB ', 174.42, 103.211, 117.174], ['C', ' CG ', 175.024, 103.217, 118.53], ['C', ' OD1', 174.619, 103.925, 119.461], ['C', ' ND2', 176.018, 102.387, 118.665], ['C', ' H ', 172.556, 101.689, 118.016], ['C', ' HA ', 172.826, 104.489, 117.742], ['C', ' HB ', 174.523, 102.205, 116.757], ['C', ' HB ', 174.997, 103.88, 116.539], ['C', ' HD2', 176.49, 102.294, 119.535], ['C', ' HD2', 176.308, 101.828, 117.886]] AA_SCO= 1.993684210526316 CA_SCO= 1.7772631578947369
[['C', ' N ', 172.178, 103.027, 114.948], ['C', ' CA ', 171.894, 103.27, 113.553], ['C', ' C ', 170.84, 104.327, 113.338], ['C', ' O ', 170.97, 105.153, 112.447], ['C', ' CB ', 171.491, 101.97, 112.871], ['C', ' CG1', 170.992, 102.205, 111.502], ['C', ' CG2', 172.672, 101.066, 112.841], ['C', ' H ', 172.121, 102.09, 115.325], ['C', ' HA ', 172.814, 103.617, 113.082], ['C', ' HB ', 170.713, 101.522, 113.412], ['C', ' HG1', 170.735, 101.269, 111.079], ['C', ' HG1', 170.113, 102.835, 111.525], ['C', ' HG1', 171.759, 102.664, 110.905], ['C', ' HG2', 172.4, 100.113, 112.372], ['C', ' HG2', 173.463, 101.532, 112.277], ['C', ' HG2', 173.005, 100.887, 113.852]] AA_SCO= 2.034736842105263 CA_SCO= 1.7935789473684212
[['C', ' N ', 169.808, 104.366, 114.152], ['C', ' CA ', 168.729, 105.302, 113.895], ['C', ' C ', 169.161, 106.742, 113.979], ['C', ' O ', 168.543, 107.613, 113.373], ['C', ' CB ', 167.563, 105.047, 114.831], ['C', ' CG ', 167.711, 105.546, 116.227], ['C', ' SD ', 166.334, 105.027, 117.214], ['C', ' CE ', 166.633, 105.877, 118.739], ['C', ' H ', 169.755, 103.719, 114.926], ['C', ' HA ', 168.39, 105.154, 112.897], ['C', ' HB ', 166.662, 105.48, 114.406], ['C', ' HB ', 167.395, 103.98, 114.903], ['C', ' HG ', 168.617, 105.186, 116.668], ['C', ' HG ', 167.741, 106.634, 116.234], ['C', ' HE ', 165.837, 105.633, 119.457], ['C', ' HE ', 167.589, 105.585, 119.146], ['C', ' HE ', 166.631, 106.951, 118.564]] AA_SCO= 2.048421052631579 CA_SCO= 1.809578947368421
[['C', ' N ', 170.246, 107.017, 114.675], ['C', ' CA ', 170.75, 108.359, 114.832], ['C', ' C ', 171.361, 108.891, 113.538], ['C', ' O ', 171.478, 110.108, 113.354], ['C', ' CB ', 171.704, 108.392, 116.007], ['C', ' CG ', 172.321, 109.706, 116.29], ['C', ' SD ', 171.145, 110.905, 116.773], ['C', ' CE ', 172.011, 112.33, 116.196], ['C', ' H ', 170.787, 106.261, 115.1], ['C', ' HA ', 169.908, 109.003, 115.075], ['C', ' HB ', 171.155, 108.11, 116.899], ['C', ' HB ', 172.445, 107.657, 115.875], ['C', ' HG ', 173.03, 109.579, 117.102], ['C', ' HG ', 172.871, 110.075, 115.429], ['C', ' HE ', 171.427, 113.202, 116.417], ['C', ' HE ', 172.955, 112.39, 116.702], ['C', ' HE ', 172.173, 112.258, 115.116]] AA_SCO= 2.1794736842105262 CA_SCO= 1.7824736842105267
[['C', ' N ', 171.714, 107.999, 112.614], ['C', ' CA ', 172.343, 108.395, 111.369], ['C', ' C ', 171.39, 109.275, 110.561], ['C', ' O ', 171.829, 110.117, 109.776], ['C', ' CB ', 172.707, 107.16, 110.537], ['C', ' CG ', 173.835, 106.204, 111.057], ['C', ' CD1', 173.849, 104.956, 110.201], ['C', ' CD2', 175.196, 106.849, 110.974], ['C', ' H ', 171.525, 107.004, 112.764], ['C', ' HA ', 173.239, 108.957, 111.594], ['C', ' HB ', 171.821, 106.562, 110.488], ['C', ' HB ', 172.967, 107.478, 109.527], ['C', ' HG ', 173.618, 105.924, 112.091], ['C', ' HD1', 174.613, 104.273, 110.564], ['C', ' HD1', 172.882, 104.481, 110.264], ['C', ' HD1', 174.058, 105.216, 109.165], ['C', ' HD2', 175.953, 106.151, 111.338], ['C', ' HD2', 175.417, 107.111, 109.938], ['C', ' HD2', 175.22, 107.73, 111.576]] AA_SCO= 2.1289473684210534 CA_SCO= 1.8129473684210529
[['C', ' N ', 170.066, 109.095, 110.706], ['C', ' CA ', 169.169, 109.896, 109.885], ['C', ' C ', 169.288, 111.382, 110.186], ['C', ' O ', 169.111, 112.218, 109.289], ['C', ' CB ', 167.702, 109.495, 110.113], ['C', ' CG ', 167.101, 109.934, 111.491], ['C', ' CD ', 165.69, 109.396, 111.704], ['C', ' CE ', 165.045, 109.887, 113.031], ['C', ' NZ ', 165.705, 109.342, 114.249], ['C', ' H ', 169.672, 108.421, 111.372], ['C', ' HA ', 169.423, 109.731, 108.851], ['C', ' HB ', 167.085, 109.936, 109.333], ['C', ' HB ', 167.596, 108.42, 110.027], ['C', ' HG ', 167.745, 109.626, 112.299], ['C', ' HG ', 167.01, 111.017, 111.516], ['C', ' HD ', 165.059, 109.705, 110.873], ['C', ' HD ', 165.718, 108.315, 111.721], ['C', ' HE ', 165.086, 110.973, 113.072], ['C', ' HE ', 164.006, 109.568, 113.04], ['C', ' HZ ', 165.223, 109.679, 115.073], ['C', ' HZ ', 165.648, 108.332, 114.213], ['C', ' HZ ', 166.671, 109.64, 114.29]] AA_SCO= 2.0394736842105265 CA_SCO= 1.806526315789474
[['C', ' N ', 169.571, 111.713, 111.457], ['C', ' CA ', 169.619, 113.084, 111.921], ['C', ' C ', 171.03, 113.586, 111.756], ['C', ' O ', 171.306, 114.761, 111.49], ['C', ' CB ', 169.182, 113.14, 113.379], ['C', ' CG ', 169.005, 114.518, 113.926], ['C', ' CD ', 168.43, 114.49, 115.34], ['C', ' CE ', 168.169, 115.899, 115.828], ['C', ' NZ ', 167.514, 115.94, 117.174], ['C', ' H ', 169.758, 110.991, 112.151], ['C', ' HA ', 168.946, 113.684, 111.319], ['C', ' HB ', 168.238, 112.612, 113.488], ['C', ' HB ', 169.916, 112.618, 113.993], ['C', ' HG ', 169.942, 115.03, 113.929], ['C', ' HG ', 168.326, 115.07, 113.273], ['C', ' HD ', 167.493, 113.934, 115.35], ['C', ' HD ', 169.13, 114.003, 116.016], ['C', ' HE ', 169.104, 116.454, 115.873], ['C', ' HE ', 167.514, 116.376, 115.109], ['C', ' HZ ', 167.319, 116.927, 117.415], ['C', ' HZ ', 166.631, 115.454, 117.125], ['C', ' HZ ', 168.096, 115.521, 117.874]] AA_SCO= 2.0500000000000003 CA_SCO= 1.8437894736842104
[['C', ' N ', 171.96, 112.673, 111.928], ['C', ' CA ', 173.331, 113.045, 111.816], ['C', ' C ', 173.589, 113.581, 110.41], ['C', ' O ', 174.341, 114.545, 110.249], ['C', ' CB ', 174.191, 111.866, 112.156], ['C', ' H ', 171.709, 111.716, 112.181], ['C', ' HA ', 173.537, 113.833, 112.532], ['C', ' HB ', 175.205, 112.145, 112.098], ['C', ' HB ', 173.96, 111.532, 113.164], ['C', ' HB ', 173.99, 111.075, 111.464]] AA_SCO= 2.0473684210526315 CA_SCO= 1.8451052631578948
[['C', ' N ', 172.943, 112.998, 109.393], ['C', ' CA ', 173.171, 113.559, 108.079], ['C', ' C ', 172.255, 114.764, 107.885], ['C', ' O ', 172.718, 115.828, 107.489], ['C', ' CB ', 172.895, 112.568, 106.941], ['C', ' CG1', 173.089, 113.269, 105.584], ['C', ' CG2', 173.788, 111.409, 107.05], ['C', ' H ', 172.369, 112.161, 109.549], ['C', ' HA ', 174.209, 113.882, 108.01], ['C', ' HB ', 171.87, 112.236, 107.004], ['C', ' HG1', 172.882, 112.56, 104.782], ['C', ' HG1', 172.441, 114.127, 105.471], ['C', ' HG1', 174.129, 113.608, 105.51], ['C', ' HG2', 173.589, 110.706, 106.24], ['C', ' HG2', 174.829, 111.744, 106.995], ['C', ' HG2', 173.602, 110.925, 107.994]] AA_SCO= 2.0789473684210527 CA_SCO= 1.827
[['C', ' N ', 170.955, 114.616, 108.137], ['C', ' CA ', 170.049, 115.734, 107.948], ['C', ' C ', 169.746, 116.361, 109.27], ['C', ' O ', 169.246, 115.682, 110.151], ['C', ' CB ', 168.766, 115.318, 107.288], ['C', ' CG ', 168.879, 115.034, 105.798], ['C', ' CD ', 169.373, 113.677, 105.558], ['C', ' NE ', 168.569, 112.723, 106.232], ['C', ' CZ ', 167.469, 112.188, 105.747], ['C', ' NH1', 167.09, 112.493, 104.538], ['C', ' NH2', 166.777, 111.352, 106.499], ['C', ' H ', 170.573, 113.729, 108.471], ['C', ' HA ', 170.524, 116.463, 107.319], ['C', ' HB ', 168.36, 114.457, 107.806], ['C', ' HB ', 168.041, 116.123, 107.402], ['C', ' HG ', 167.9, 115.148, 105.338], ['C', ' HG ', 169.578, 115.74, 105.351], ['C', ' HD ', 169.372, 113.461, 104.496], ['C', ' HD ', 170.343, 113.57, 105.9], ['C', ' HE ', 168.842, 112.464, 107.192], ['C', ' HH1', 167.624, 113.134, 103.978], ['C', ' HH1', 166.264, 112.065, 104.157], ['C', ' HH2', 167.103, 111.136, 107.432], ['C', ' HH2', 165.897, 110.926, 106.16]] AA_SCO= 1.946315789473684 CA_SCO= 1.7549473684210526
[['C', ' N ', 169.916, 117.676, 109.349], ['C', ' CA ', 169.754, 118.51, 110.539], ['C', ' C ', 171.139, 118.849, 111.087], ['C', ' O ', 171.48, 120.032, 111.248], ['C', ' CB ', 168.975, 117.796, 111.645], ['C', ' CG ', 168.496, 118.679, 112.67], ['C', ' CD ', 167.388, 119.466, 112.067], ['C', ' OE1', 166.451, 118.844, 111.565], ['C', ' NE2', 167.467, 120.763, 112.093], ['C', ' H ', 170.255, 118.143, 108.521], ['C', ' HA ', 169.26, 119.437, 110.263], ['C', ' HB ', 168.086, 117.319, 111.248], ['C', ' HB ', 169.6, 117.044, 112.129], ['C', ' HG ', 168.116, 118.101, 113.502], ['C', ' HG ', 169.284, 119.361, 112.995], ['C', ' HE2', 166.725, 121.326, 111.707], ['C', ' HE2', 168.261, 121.198, 112.541]] AA_SCO= 1.9015789473684208 CA_SCO= 1.752157894736842
[['C', ' N ', 171.961, 117.838, 111.345], ['C', ' CA ', 173.326, 118.141, 111.739], ['C', ' C ', 174.196, 118.548, 110.547], ['C', ' O ', 175.144, 119.307, 110.707], ['C', ' CB ', 173.958, 117.009, 112.508], ['C', ' CG ', 173.503, 116.94, 113.893], ['C', ' CD1', 172.574, 116.042, 114.283], ['C', ' CD2', 174.034, 117.798, 114.788], ['C', ' CE1', 172.169, 116.003, 115.575], ['C', ' CE2', 173.641, 117.766, 116.088], ['C', ' CZ ', 172.708, 116.865, 116.481], ['C', ' OH ', 172.3, 116.819, 117.786], ['C', ' H ', 171.64, 116.862, 111.272], ['C', ' HA ', 173.282, 118.983, 112.419], ['C', ' HB ', 173.717, 116.087, 112.03], ['C', ' HB ', 175.032, 117.123, 112.507], ['C', ' HD1', 172.155, 115.365, 113.578], ['C', ' HD2', 174.774, 118.512, 114.462], ['C', ' HE1', 171.425, 115.294, 115.886], ['C', ' HE2', 174.074, 118.461, 116.81], ['C', ' HH ', 172.759, 117.499, 118.289]] AA_SCO= 1.9136842105263154 CA_SCO= 1.731684210526316
[['C', ' N ', 173.867, 118.079, 109.345], ['C', ' CA ', 174.633, 118.437, 108.154], ['C', ' C ', 175.951, 117.728, 108.003], ['C', ' O ', 176.902, 118.301, 107.468], ['C', ' H ', 173.084, 117.445, 109.242], ['C', ' HA ', 174.034, 118.205, 107.282], ['C', ' HA ', 174.815, 119.502, 108.131]] AA_SCO= 1.8447368421052626 CA_SCO= 1.7296315789473689
[['C', ' N ', 176.044, 116.502, 108.471], ['C', ' CA ', 177.298, 115.818, 108.359], ['C', ' C ', 177.247, 114.956, 107.106], ['C', ' O ', 176.467, 114.018, 107.021], ['C', ' CB ', 177.465, 114.956, 109.6], ['C', ' CG1', 177.382, 115.849, 110.85], ['C', ' CG2', 178.792, 114.33, 109.55], ['C', ' CD1', 177.168, 115.099, 112.105], ['C', ' H ', 175.257, 116.022, 108.923], ['C', ' HA ', 178.113, 116.538, 108.275], ['C', ' HB ', 176.692, 114.203, 109.649], ['C', ' HG1', 178.306, 116.412, 110.946], ['C', ' HG1', 176.564, 116.548, 110.744], ['C', ' HG2', 178.977, 113.755, 110.411], ['C', ' HG2', 178.891, 113.698, 108.676], ['C', ' HG2', 179.488, 115.121, 109.516], ['C', ' HD1', 177.106, 115.779, 112.932], ['C', ' HD1', 176.229, 114.56, 112.021], ['C', ' HD1', 177.962, 114.408, 112.282]] AA_SCO= 1.9273684210526314 CA_SCO= 1.7248421052631582
[['C', ' N ', 178.089, 115.254, 106.124], ['C', ' CA ', 178.036, 114.559, 104.842], ['C', ' C ', 179.001, 113.379, 104.77], ['C', ' O ', 179.159, 112.744, 103.726], ['C', ' CB ', 178.313, 115.541, 103.703], ['C', ' CG ', 177.263, 116.666, 103.572], ['C', ' CD ', 177.501, 117.589, 102.373], ['C', ' OE1', 178.271, 117.227, 101.515], ['C', ' OE2', 176.899, 118.645, 102.315], ['C', ' H ', 178.777, 116.012, 106.233], ['C', ' HA ', 177.026, 114.172, 104.71], ['C', ' HB ', 179.284, 116.014, 103.87], ['C', ' HB ', 178.367, 115.009, 102.758], ['C', ' HG ', 176.276, 116.213, 103.482], ['C', ' HG ', 177.274, 117.262, 104.489]] AA_SCO= 1.995263157894737 CA_SCO= 1.6461578947368423
[['C', ' N ', 179.715, 113.144, 105.849], ['C', ' CA ', 180.686, 112.066, 105.918], ['C', ' C ', 180.678, 111.393, 107.283], ['C', ' O ', 181.469, 111.743, 108.158], ['C', ' CB ', 182.081, 112.598, 105.652], ['C', ' CG ', 182.296, 113.214, 104.289], ['C', ' CD ', 183.717, 113.686, 104.149], ['C', ' CE ', 183.967, 114.335, 102.828], ['C', ' NZ ', 185.339, 114.902, 102.762], ['C', ' H ', 179.533, 113.725, 106.654], ['C', ' HA ', 180.426, 111.315, 105.173], ['C', ' HB ', 182.319, 113.34, 106.386], ['C', ' HB ', 182.803, 111.79, 105.768], ['C', ' HG ', 182.057, 112.493, 103.511], ['C', ' HG ', 181.646, 114.081, 104.176], ['C', ' HD ', 183.963, 114.39, 104.941], ['C', ' HD ', 184.383, 112.835, 104.237], ['C', ' HE ', 183.851, 113.593, 102.041], ['C', ' HE ', 183.242, 115.136, 102.672], ['C', ' HZ ', 185.487, 115.331, 101.865], ['C', ' HZ ', 185.437, 115.604, 103.49], ['C', ' HZ ', 186.023, 114.169, 102.905]] AA_SCO= 1.9489473684210528 CA_SCO= 1.6460526315789472
[['C', ' N ', 179.761, 110.485, 107.515], ['C', ' CA ', 179.657, 109.878, 108.823], ['C', ' C ', 180.461, 108.649, 109.062], ['C', ' O ', 180.671, 107.795, 108.179], ['C', ' CB ', 178.21, 109.516, 109.157], ['C', ' CG ', 177.274, 110.648, 109.324], ['C', ' CD1', 175.905, 110.149, 109.393], ['C', ' CD2', 177.567, 111.328, 110.641], ['C', ' H ', 179.107, 110.224, 106.79], ['C', ' HA ', 180.01, 110.607, 109.532], ['C', ' HB ', 177.824, 108.887, 108.358], ['C', ' HB ', 178.207, 108.932, 110.082], ['C', ' HG ', 177.379, 111.347, 108.487], ['C', ' HD1', 175.247, 110.99, 109.529], ['C', ' HD1', 175.66, 109.628, 108.465], ['C', ' HD1', 175.809, 109.48, 110.223], ['C', ' HD2', 176.894, 112.153, 110.767], ['C', ' HD2', 177.443, 110.623, 111.461], ['C', ' HD2', 178.556, 111.686, 110.659]] AA_SCO= 2.1763157894736844 CA_SCO= 1.6479473684210526
[['C', ' N ', 180.861, 108.541, 110.311], ['C', ' CA ', 181.463, 107.333, 110.777], ['C', ' C ', 180.573, 106.74, 111.857], ['C', ' O ', 179.611, 107.373, 112.307], ['C', ' H ', 180.735, 109.34, 110.943], ['C', ' HA ', 181.561, 106.633, 109.955], ['C', ' HA ', 182.459, 107.531, 111.156]] AA_SCO= 2.0736842105263156 CA_SCO= 1.469
[['C', ' N ', 180.882, 105.52, 112.234], ['C', ' CA ', 180.188, 104.799, 113.305], ['C', ' C ', 181.016, 103.586, 113.679], ['C', ' O ', 181.808, 103.182, 112.851], ['C', ' CB ', 178.762, 104.412, 112.919], ['C', ' OG1', 178.131, 103.864, 114.07], ['C', ' CG2', 178.756, 103.397, 111.782], ['C', ' H ', 181.649, 105.077, 111.72], ['C', ' HA ', 180.126, 105.442, 114.186], ['C', ' HB ', 178.214, 105.3, 112.612], ['C', ' HG1', 178.1, 104.578, 114.783], ['C', ' HG2', 177.733, 103.147, 111.543], ['C', ' HG2', 179.242, 103.829, 110.905], ['C', ' HG2', 179.286, 102.498, 112.08]] AA_SCO= 2.0868421052631576 CA_SCO= 1.4777368421052632
[['C', ' N ', 180.807, 102.981, 114.856], ['C', ' CA ', 181.037, 101.979, 115.896], ['C', ' C ', 179.926, 100.94, 116.042], ['C', ' O ', 179.689, 100.434, 117.132], ['C', ' CB ', 181.239, 102.652, 117.249], ['C', ' CG1', 182.478, 103.493, 117.203], ['C', ' CG2', 180.047, 103.468, 117.585], ['C', ' H ', 181.459, 102.321, 114.421], ['C', ' HA ', 181.961, 101.458, 115.664], ['C', ' HB ', 181.385, 101.899, 118.002], ['C', ' HG1', 182.649, 103.964, 118.172], ['C', ' HG1', 183.325, 102.873, 116.947], ['C', ' HG1', 182.35, 104.255, 116.45], ['C', ' HG2', 180.211, 103.932, 118.55], ['C', ' HG2', 179.909, 104.23, 116.82], ['C', ' HG2', 179.154, 102.849, 117.635]] AA_SCO= 2.0663157894736845 CA_SCO= 1.4822105263157896
[['C', ' N ', 179.231, 100.654, 114.964], ['C', ' CA ', 178.15, 99.676, 114.979], ['C', ' C ', 178.605, 98.257, 115.363], ['C', ' O ', 179.678, 97.791, 114.995], ['C', ' CB ', 177.493, 99.631, 113.615], ['C', ' H ', 179.462, 101.14, 114.11], ['C', ' HA ', 177.417, 99.998, 115.719], ['C', ' HB ', 176.678, 98.943, 113.621], ['C', ' HB ', 177.13, 100.621, 113.351], ['C', ' HB ', 178.212, 99.311, 112.901]] AA_SCO= 2.055263157894737 CA_SCO= 1.4838421052631579
[['C', ' N ', 177.751, 97.568, 116.084], ['C', ' CA ', 177.973, 96.174, 116.469], ['C', ' C ', 177.569, 95.387, 115.195], ['C', ' O ', 176.814, 95.955, 114.416], ['C', ' CB ', 177.092, 95.928, 117.718], ['C', ' CG1', 177.466, 94.721, 118.469], ['C', ' CG2', 175.714, 95.804, 117.266], ['C', ' CD1', 176.907, 94.611, 119.843], ['C', ' H ', 176.884, 98.054, 116.376], ['C', ' HA ', 179.027, 96.008, 116.7], ['C', ' HB ', 177.177, 96.788, 118.386], ['C', ' HG1', 177.092, 93.872, 117.929], ['C', ' HG1', 178.56, 94.678, 118.548], ['C', ' HG2', 175.028, 95.684, 118.09], ['C', ' HG2', 175.466, 96.656, 116.744], ['C', ' HG2', 175.634, 94.97, 116.63], ['C', ' HD1', 177.246, 93.687, 120.301], ['C', ' HD1', 177.253, 95.451, 120.445], ['C', ' HD1', 175.837, 94.607, 119.81]] AA_SCO= 2.008947368421053 CA_SCO= 1.243157894736842
[['C', ' N ', 177.984, 94.141, 114.869], ['C', ' CA ', 177.569, 93.452, 113.655], ['C', ' C ', 176.061, 93.381, 113.467], ['C', ' O ', 175.551, 93.601, 112.366], ['C', ' CB ', 178.145, 92.059, 113.871], ['C', ' CG ', 178.447, 91.999, 115.295], ['C', ' CD ', 178.881, 93.385, 115.634], ['C', ' HA ', 178.07, 93.901, 112.804], ['C', ' HB ', 177.404, 91.299, 113.586], ['C', ' HB ', 179.005, 91.885, 113.25], ['C', ' HG ', 177.556, 91.668, 115.835], ['C', ' HG ', 179.234, 91.231, 115.461], ['C', ' HD ', 178.838, 93.558, 116.643], ['C', ' HD ', 179.886, 93.535, 115.262]] AA_SCO= 1.8147368421052634 CA_SCO= 1.2768421052631578
[['C', ' N ', 175.337, 93.313, 114.57], ['C', ' CA ', 173.884, 93.259, 114.587], ['C', ' C ', 173.273, 94.511, 113.93], ['C', ' O ', 172.103, 94.53, 113.552], ['C', ' CB ', 173.417, 93.247, 116.038], ['C', ' SG ', 174.192, 91.988, 117.078], ['C', ' H ', 175.826, 93.134, 115.436], ['C', ' HA ', 173.551, 92.363, 114.054], ['C', ' HB ', 173.561, 94.212, 116.484], ['C', ' HB ', 172.367, 93.067, 116.06], ['C', ' HG ', 173.387, 90.963, 116.724]] AA_SCO= 1.7763157894736843 CA_SCO= 1.283421052631579
[['C', ' N ', 174.072, 95.578, 113.88], ['C', ' CA ', 173.763, 96.89, 113.342], ['C', ' C ', 174.515, 97.166, 112.055], ['C', ' O ', 173.968, 97.751, 111.117], ['C', ' CB ', 174.123, 97.936, 114.374], ['C', ' CG ', 173.296, 97.88, 115.573], ['C', ' CD ', 173.793, 98.731, 116.666], ['C', ' OE1', 175.013, 99.046, 116.76], ['C', ' NE2', 172.876, 99.082, 117.554], ['C', ' H ', 175.025, 95.453, 114.214], ['C', ' HA ', 172.693, 96.943, 113.14], ['C', ' HB ', 175.131, 97.768, 114.692], ['C', ' HB ', 174.081, 98.911, 113.944], ['C', ' HG ', 172.334, 98.269, 115.298], ['C', ' HG ', 173.193, 96.858, 115.928], ['C', ' HE2', 173.131, 99.639, 118.365], ['C', ' HE2', 171.886, 98.773, 117.472]] AA_SCO= 1.844736842105263 CA_SCO= 1.2894736842105263
[['C', ' N ', 175.74, 96.654, 111.968], ['C', ' CA ', 176.615, 96.856, 110.818], ['C', ' C ', 175.902, 96.345, 109.613], ['C', ' O ', 175.883, 96.988, 108.558], ['C', ' CB ', 177.901, 96.048, 110.967], ['C', ' OG1', 178.632, 96.497, 112.115], ['C', ' CG2', 178.765, 96.137, 109.75], ['C', ' H ', 176.11, 96.17, 112.774], ['C', ' HA ', 176.827, 97.918, 110.7], ['C', ' HB ', 177.634, 95.022, 111.083], ['C', ' HG1', 178.102, 96.369, 112.922], ['C', ' HG2', 179.64, 95.524, 109.908], ['C', ' HG2', 178.236, 95.783, 108.885], ['C', ' HG2', 179.058, 97.134, 109.581]] AA_SCO= 1.8852631578947372 CA_SCO= 1.305842105263158
[['C', ' N ', 175.304, 95.174, 109.77], ['C', ' CA ', 174.575, 94.608, 108.678], ['C', ' C ', 173.379, 95.456, 108.367], ['C', ' O ', 173.014, 95.552, 107.213], ['C', ' CB ', 174.161, 93.183, 109.007], ['C', ' CG ', 173.108, 93.027, 110.106], ['C', ' SD ', 172.65, 91.304, 110.404], ['C', ' CE ', 174.13, 90.622, 111.158], ['C', ' H ', 175.402, 94.676, 110.661], ['C', ' HA ', 175.214, 94.608, 107.801], ['C', ' HB ', 173.812, 92.693, 108.12], ['C', ' HB ', 175.045, 92.655, 109.342], ['C', ' HG ', 173.473, 93.448, 111.036], ['C', ' HG ', 172.203, 93.557, 109.838], ['C', ' HE ', 173.974, 89.572, 111.407], ['C', ' HE ', 174.968, 90.694, 110.472], ['C', ' HE ', 174.372, 91.169, 112.065]] AA_SCO= 1.9405263157894743 CA_SCO= 1.3053157894736842
[['C', ' N ', 172.801, 96.123, 109.352], ['C', ' CA ', 171.638, 96.944, 109.125], ['C', ' C ', 171.986, 98.089, 108.204], ['C', ' O ', 171.188, 98.483, 107.353], ['C', ' H ', 173.156, 96.053, 110.296], ['C', ' HA ', 170.832, 96.349, 108.705], ['C', ' HA ', 171.309, 97.333, 110.087]] AA_SCO= 1.9326315789473687 CA_SCO= 1.3136842105263158
[['C', ' N ', 173.181, 98.618, 108.373], ['C', ' CA ', 173.615, 99.722, 107.557], ['C', ' C ', 173.826, 99.263, 106.142], ['C', ' O ', 173.363, 99.92, 105.215], ['C', ' CB ', 174.897, 100.348, 108.098], ['C', ' CG1', 174.583, 101.008, 109.447], ['C', ' CG2', 175.46, 101.358, 107.069], ['C', ' CD1', 175.797, 101.403, 110.245], ['C', ' H ', 173.761, 98.242, 109.13], ['C', ' HA ', 172.837, 100.484, 107.559], ['C', ' HB ', 175.632, 99.564, 108.281], ['C', ' HG1', 173.98, 101.895, 109.267], ['C', ' HG1', 173.997, 100.311, 110.047], ['C', ' HG2', 176.367, 101.809, 107.443], ['C', ' HG2', 175.691, 100.868, 106.126], ['C', ' HG2', 174.716, 102.134, 106.891], ['C', ' HD1', 175.485, 101.857, 111.182], ['C', ' HD1', 176.394, 100.519, 110.461], ['C', ' HD1', 176.397, 102.117, 109.695]] AA_SCO= 2.095263157894737 CA_SCO= 1.3768947368421054
[['C', ' N ', 174.506, 98.132, 105.969], ['C', ' CA ', 174.767, 97.644, 104.625], ['C', ' C ', 173.487, 97.214, 103.948], ['C', ' O ', 173.391, 97.199, 102.724], ['C', ' CB ', 175.718, 96.492, 104.614], ['C', ' CG ', 177.065, 96.772, 105.134], ['C', ' CD ', 177.669, 97.963, 104.597], ['C', ' NE ', 178.993, 98.066, 105.041], ['C', ' CZ ', 179.766, 99.144, 104.974], ['C', ' NH1', 179.353, 100.277, 104.444], ['C', ' NH2', 180.954, 99.018, 105.48], ['C', ' H ', 174.87, 97.639, 106.792], ['C', ' HA ', 175.185, 98.456, 104.038], ['C', ' HB ', 175.295, 95.668, 105.185], ['C', ' HB ', 175.842, 96.171, 103.602], ['C', ' HG ', 177.066, 96.825, 106.223], ['C', ' HG ', 177.696, 95.978, 104.802], ['C', ' HD ', 177.653, 97.962, 103.507], ['C', ' HD ', 177.144, 98.82, 104.993], ['C', ' HE ', 179.413, 97.236, 105.477], ['C', ' HH1', 178.403, 100.359, 104.053], ['C', ' HH1', 179.978, 101.074, 104.424], ['C', ' HH2', 181.179, 98.093, 105.879], ['C', ' HH2', 181.631, 99.808, 105.499]] AA_SCO= 2.114736842105263 CA_SCO= 1.3804210526315792
[['C', ' N ', 172.541, 96.764, 104.747], ['C', ' CA ', 171.222, 96.378, 104.312], ['C', ' C ', 170.379, 97.59, 103.857], ['C', ' O ', 169.538, 97.445, 102.965], ['C', ' CB ', 170.613, 95.497, 105.403], ['C', ' CG ', 171.264, 94.052, 105.409], ['C', ' CD ', 170.752, 93.101, 106.46], ['C', ' CE ', 171.434, 91.728, 106.301], ['C', ' NZ ', 170.919, 90.694, 107.259], ['C', ' H ', 172.743, 96.654, 105.743], ['C', ' HA ', 171.337, 95.749, 103.436], ['C', ' HB ', 170.82, 95.949, 106.352], ['C', ' HB ', 169.585, 95.46, 105.352], ['C', ' HG ', 171.046, 93.6, 104.482], ['C', ' HG ', 172.34, 94.118, 105.474], ['C', ' HD ', 171.026, 93.497, 107.433], ['C', ' HD ', 169.676, 93.001, 106.41], ['C', ' HE ', 171.297, 91.371, 105.286], ['C', ' HE ', 172.493, 91.86, 106.476], ['C', ' HZ ', 171.451, 89.81, 107.114], ['C', ' HZ ', 171.053, 91.007, 108.208], ['C', ' HZ ', 169.944, 90.517, 107.112]] AA_SCO= 2.1073684210526316 CA_SCO= 1.3994210526315793
[['C', ' N ', 170.578, 98.778, 104.479], ['C', ' CA ', 169.9, 100.008, 104.03], ['C', ' C ', 170.597, 100.54, 102.789], ['C', ' O ', 169.997, 101.178, 101.929], ['C', ' CB ', 169.878, 101.065, 105.111], ['C', ' CG ', 168.995, 100.705, 106.264], ['C', ' SD ', 168.993, 101.887, 107.573], ['C', ' CE ', 168.047, 103.157, 106.814], ['C', ' H ', 171.209, 98.815, 105.281], ['C', ' HA ', 168.876, 99.763, 103.756], ['C', ' HB ', 170.892, 101.199, 105.5], ['C', ' HB ', 169.564, 102.0, 104.675], ['C', ' HG ', 167.979, 100.618, 105.902], ['C', ' HG ', 169.272, 99.742, 106.663], ['C', ' HE ', 167.878, 103.956, 107.483], ['C', ' HE ', 168.565, 103.539, 105.947], ['C', ' HE ', 167.11, 102.743, 106.53]] AA_SCO= 2.1700000000000004 CA_SCO= 1.3318947368421052
[['C', ' N ', 171.881, 100.265, 102.694], ['C', ' CA ', 172.646, 100.593, 101.524], ['C', ' C ', 172.274, 99.441, 100.632], ['C', ' O ', 171.503, 98.595, 101.061], ['C', ' CB ', 174.146, 100.627, 101.805], ['C', ' CG ', 174.577, 101.702, 102.747], ['C', ' CD ', 176.055, 101.667, 103.075], ['C', ' OE1', 176.635, 100.626, 103.418], ['C', ' NE2', 176.677, 102.819, 102.96], ['C', ' H ', 172.346, 99.819, 103.488], ['C', ' HA ', 172.303, 101.523, 101.082], ['C', ' HB ', 174.45, 99.674, 102.213], ['C', ' HB ', 174.688, 100.767, 100.876], ['C', ' HG ', 174.391, 102.638, 102.262], ['C', ' HG ', 174.009, 101.654, 103.663], ['C', ' HE2', 177.655, 102.912, 103.143], ['C', ' HE2', 176.152, 103.644, 102.666]] AA_SCO= 2.1389473684210527 CA_SCO= 1.3332105263157894
[['C', ' N ', 172.732, 99.407, 99.396], ['C', ' CA ', 172.413, 98.324, 98.446], ['C', ' C ', 170.943, 98.435, 97.994], ['C', ' O ', 170.694, 98.68, 96.816], ['C', ' CB ', 172.68, 96.911, 99.033], ['C', ' OG1', 174.031, 96.828, 99.491], ['C', ' CG2', 172.539, 95.881, 97.897], ['C', ' H ', 173.35, 100.14, 99.091], ['C', ' HA ', 173.044, 98.437, 97.563], ['C', ' HB ', 171.989, 96.656, 99.829], ['C', ' HG1', 174.088, 97.265, 100.359], ['C', ' HG2', 172.749, 94.885, 98.278], ['C', ' HG2', 171.545, 95.908, 97.492], ['C', ' HG2', 173.246, 96.119, 97.106]] AA_SCO= 2.07 CA_SCO= 1.389421052631579
[['C', ' N ', 169.998, 98.36, 98.935], ['C', ' CA ', 168.567, 98.515, 98.707], ['C', ' C ', 167.937, 99.63, 99.532], ['C', ' O ', 167.128, 99.358, 100.426], ['C', ' CB ', 167.826, 97.257, 99.076], ['C', ' CG ', 168.159, 96.143, 98.294], ['C', ' CD1', 169.091, 95.264, 98.722], ['C', ' CD2', 167.509, 95.972, 97.118], ['C', ' CE1', 169.387, 94.208, 97.95], ['C', ' CE2', 167.792, 94.919, 96.357], ['C', ' CZ ', 168.733, 94.038, 96.762], ['C', ' OH ', 169.031, 92.987, 95.986], ['C', ' H ', 170.319, 98.144, 99.873], ['C', ' HA ', 168.402, 98.708, 97.652], ['C', ' HB ', 168.023, 97.013, 100.123], ['C', ' HB ', 166.774, 97.428, 98.98], ['C', ' HD1', 169.603, 95.418, 99.674], ['C', ' HD2', 166.758, 96.693, 96.795], ['C', ' HE1', 170.143, 93.507, 98.266], ['C', ' HE2', 167.273, 94.781, 95.411], ['C', ' HH ', 168.471, 93.019, 95.185]] AA_SCO= 2.1205263157894736 CA_SCO= 1.3641578947368422
[['C', ' N ', 168.196, 100.898, 99.212], ['C', ' CA ', 167.748, 102.054, 99.947], ['C', ' C ', 166.291, 102.432, 99.726], ['C', ' O ', 165.98, 103.571, 99.346], ['C', ' CB ', 168.694, 103.121, 99.394], ['C', ' CG ', 168.969, 102.702, 98.001], ['C', ' CD ', 169.079, 101.223, 98.087], ['C', ' HA ', 167.924, 101.886, 101.018], ['C', ' HB ', 168.25, 104.12, 99.44], ['C', ' HB ', 169.594, 103.144, 100.004], ['C', ' HG ', 168.167, 103.035, 97.334], ['C', ' HG ', 169.895, 103.181, 97.642], ['C', ' HD ', 168.778, 100.772, 97.146], ['C', ' HD ', 170.111, 100.993, 98.347]] AA_SCO= 2.1331578947368426 CA_SCO= 1.3571578947368423
[['C', ' N ', 165.385, 101.526, 100.065], ['C', ' CA ', 163.984, 101.827, 99.859], ['C', ' C ', 163.547, 102.719, 100.976], ['C', ' O ', 163.641, 102.344, 102.143], ['C', ' CB ', 163.078, 100.596, 99.982], ['C', ' CG ', 163.176, 99.548, 98.989], ['C', ' CD1', 163.961, 98.453, 99.222], ['C', ' CD2', 162.459, 99.611, 97.823], ['C', ' CE1', 164.032, 97.451, 98.304], ['C', ' CE2', 162.553, 98.596, 96.899], ['C', ' CZ ', 163.339, 97.523, 97.15], ['C', ' H ', 165.706, 100.623, 100.408], ['C', ' HA ', 163.846, 102.329, 98.903], ['C', ' HB ', 163.21, 100.143, 100.962], ['C', ' HB ', 162.059, 100.951, 99.933], ['C', ' HD1', 164.532, 98.378, 100.157], ['C', ' HD2', 161.812, 100.48, 97.625], ['C', ' HE1', 164.642, 96.598, 98.489], ['C', ' HE2', 162.004, 98.643, 95.97], ['C', ' HZ ', 163.41, 96.722, 96.425]] AA_SCO= 2.2010526315789476 CA_SCO= 1.5321052631578949
[['C', ' N ', 163.118, 103.912, 100.62], ['C', ' CA ', 162.655, 104.892, 101.585], ['C', ' C ', 163.73, 105.509, 102.487], ['C', ' O ', 163.4, 105.958, 103.579], ['C', ' H ', 163.066, 104.1, 99.635], ['C', ' HA ', 162.135, 105.691, 101.051], ['C', ' HA ', 161.908, 104.421, 102.213]] AA_SCO= 2.191052631578948 CA_SCO= 1.5173157894736842
[['C', ' N ', 165.002, 105.55, 102.085], ['C', ' CA ', 165.99, 106.103, 103.027], ['C', ' C ', 166.666, 107.351, 102.478], ['C', ' O ', 167.763, 107.707, 102.91], ['C', ' CB ', 167.048, 105.055, 103.37], ['C', ' CG1', 166.343, 103.864, 103.992], ['C', ' CG2', 167.823, 104.69, 102.197], ['C', ' H ', 165.289, 105.177, 101.173], ['C', ' HA ', 165.484, 106.379, 103.952], ['C', ' HB ', 167.722, 105.456, 104.124], ['C', ' HG1', 167.065, 103.11, 104.249], ['C', ' HG1', 165.799, 104.187, 104.874], ['C', ' HG1', 165.646, 103.434, 103.279], ['C', ' HG2', 168.563, 103.936, 102.467], ['C', ' HG2', 167.147, 104.301, 101.49], ['C', ' HG2', 168.338, 105.55, 101.772]] AA_SCO= 2.1431578947368424 CA_SCO= 1.517157894736842
[['C', ' N ', 166.049, 107.963, 101.485], ['C', ' CA ', 166.586, 109.147, 100.829], ['C', ' C ', 168.033, 108.953, 100.417], ['C', ' O ', 168.335, 108.042, 99.66], ['C', ' CB ', 166.441, 110.356, 101.722], ['C', ' CG ', 165.009, 110.73, 102.069], ['C', ' CD ', 164.269, 111.233, 100.921], ['C', ' NE ', 164.884, 112.454, 100.41], ['C', ' CZ ', 164.78, 112.891, 99.158], ['C', ' NH1', 164.106, 112.224, 98.277], ['C', ' NH2', 165.352, 114.003, 98.77], ['C', ' H ', 165.139, 107.602, 101.234], ['C', ' HA ', 166.024, 109.32, 99.917], ['C', ' HB ', 166.962, 110.184, 102.664], ['C', ' HB ', 166.893, 111.223, 101.242], ['C', ' HG ', 164.481, 109.872, 102.491], ['C', ' HG ', 165.027, 111.518, 102.776], ['C', ' HD ', 164.209, 110.496, 100.135], ['C', ' HD ', 163.256, 111.478, 101.252], ['C', ' HE ', 165.423, 113.026, 101.052], ['C', ' HH1', 163.63, 111.374, 98.514], ['C', ' HH1', 164.064, 112.607, 97.323], ['C', ' HH2', 165.912, 114.598, 99.423], ['C', ' HH2', 165.212, 114.265, 97.788]] AA_SCO= 2.10421052631579 CA_SCO= 1.517157894736842
[['C', ' N ', 168.932, 109.799, 100.905], ['C', ' CA ', 170.326, 109.718, 100.504], ['C', ' C ', 171.22, 109.159, 101.59], ['C', ' O ', 172.44, 109.204, 101.461], ['C', ' CB ', 170.84, 111.097, 100.125], ['C', ' CG ', 170.102, 111.724, 98.992], ['C', ' CD1', 169.271, 112.81, 99.21], ['C', ' CD2', 170.228, 111.237, 97.706], ['C', ' CE1', 168.6, 113.396, 98.167], ['C', ' CE2', 169.552, 111.822, 96.66], ['C', ' CZ ', 168.739, 112.904, 96.889], ['C', ' H ', 168.654, 110.52, 101.548], ['C', ' HA ', 170.401, 109.06, 99.634], ['C', ' HB ', 170.777, 111.76, 100.986], ['C', ' HB ', 171.891, 111.023, 99.843], ['C', ' HD1', 169.156, 113.215, 100.218], ['C', ' HD2', 170.881, 110.375, 97.519], ['C', ' HE1', 167.964, 114.259, 98.36], ['C', ' HE2', 169.666, 111.431, 95.645], ['C', ' HZ ', 168.208, 113.37, 96.054]] AA_SCO= 2.100526315789474 CA_SCO= 1.7584736842105264
[['C', ' N ', 170.627, 108.563, 102.623], ['C', ' CA ', 171.35, 108.061, 103.798], ['C', ' C ', 172.205, 106.85, 103.528], ['C', ' O ', 172.953, 106.419, 104.398], ['C', ' CB ', 170.359, 107.678, 104.894], ['C', ' CG ', 169.55, 108.803, 105.531], ['C', ' CD1', 168.466, 108.192, 106.45], ['C', ' CD2', 170.496, 109.71, 106.328], ['C', ' H ', 169.604, 108.472, 102.618], ['C', ' HA ', 172.02, 108.845, 104.14], ['C', ' HB ', 169.659, 106.957, 104.48], ['C', ' HB ', 170.92, 107.195, 105.679], ['C', ' HG ', 169.046, 109.382, 104.757], ['C', ' HD1', 167.883, 108.972, 106.899], ['C', ' HD1', 167.807, 107.552, 105.855], ['C', ' HD1', 168.914, 107.62, 107.223], ['C', ' HD2', 169.936, 110.501, 106.787], ['C', ' HD2', 171.002, 109.133, 107.105], ['C', ' HD2', 171.234, 110.15, 105.679]] AA_SCO= 2.314736842105263 CA_SCO= 1.7427894736842104
[['C', ' N ', 172.031, 106.236, 102.365], ['C', ' CA ', 172.882, 105.135, 101.968], ['C', ' C ', 174.29, 105.691, 101.77], ['C', ' O ', 175.301, 105.025, 101.985], ['C', ' CB ', 172.365, 104.492, 100.702], ['C', ' H ', 171.346, 106.603, 101.72], ['C', ' HA ', 172.907, 104.404, 102.774], ['C', ' HB ', 173.017, 103.678, 100.409], ['C', ' HB ', 171.372, 104.118, 100.889], ['C', ' HB ', 172.332, 105.236, 99.898]] AA_SCO= 2.42 CA_SCO= 1.7455263157894736
[['C', ' N ', 174.369, 106.927, 101.305], ['C', ' CA ', 175.637, 107.578, 101.112], ['C', ' C ', 175.91, 108.34, 102.376], ['C', ' O ', 175.12, 108.328, 103.312], ['C', ' CB ', 175.63, 108.535, 99.909], ['C', ' CG ', 177.077, 109.017, 99.457], ['C', ' OD1', 178.077, 108.479, 99.966], ['C', ' OD2', 177.163, 109.948, 98.687], ['C', ' H ', 173.538, 107.494, 101.131], ['C', ' HA ', 176.417, 106.833, 100.973], ['C', ' HB ', 175.145, 108.041, 99.064], ['C', ' HB ', 175.024, 109.409, 100.155]] AA_SCO= 2.3799999999999994 CA_SCO= 1.7457894736842106
[['C', ' N ', 177.024, 109.01, 102.392], ['C', ' CA ', 177.465, 109.842, 103.477], ['C', ' C ', 177.854, 109.008, 104.676], ['C', ' O ', 177.918, 109.512, 105.784], ['C', ' CB ', 176.359, 110.842, 103.904], ['C', ' CG ', 175.607, 111.58, 102.741], ['C', ' CD ', 176.56, 112.241, 101.753], ['C', ' CE ', 175.838, 112.991, 100.656], ['C', ' NZ ', 176.777, 113.34, 99.53], ['C', ' H ', 177.624, 108.893, 101.581], ['C', ' HA ', 178.345, 110.396, 103.158], ['C', ' HB ', 175.62, 110.342, 104.524], ['C', ' HB ', 176.798, 111.606, 104.529], ['C', ' HG ', 174.942, 110.9, 102.217], ['C', ' HG ', 174.994, 112.359, 103.186], ['C', ' HD ', 177.182, 112.943, 102.277], ['C', ' HD ', 177.199, 111.501, 101.284], ['C', ' HE ', 175.023, 112.379, 100.266], ['C', ' HE ', 175.428, 113.912, 101.07], ['C', ' HZ ', 176.284, 113.843, 98.81], ['C', ' HZ ', 177.551, 113.905, 99.87], ['C', ' HZ ', 177.146, 112.461, 99.141]] AA_SCO= 2.402105263157894 CA_SCO= 1.745210526315789
[['C', ' N ', 178.112, 107.723, 104.469], ['C', ' CA ', 178.648, 106.875, 105.505], ['C', ' C ', 179.97, 106.482, 104.925], ['C', ' O ', 180.014, 105.801, 103.904], ['C', ' CB ', 177.773, 105.649, 105.787], ['C', ' CG1', 176.36, 106.134, 106.19], ['C', ' CG2', 178.441, 104.795, 106.913], ['C', ' CD1', 175.316, 105.052, 106.288], ['C', ' H ', 177.981, 107.334, 103.546], ['C', ' HA ', 178.807, 107.436, 106.424], ['C', ' HB ', 177.669, 105.055, 104.88], ['C', ' HG1', 176.425, 106.652, 107.145], ['C', ' HG1', 176.005, 106.844, 105.436], ['C', ' HG2', 177.844, 103.918, 107.128], ['C', ' HG2', 179.434, 104.47, 106.59], ['C', ' HG2', 178.54, 105.4, 107.821], ['C', ' HD1', 174.358, 105.504, 106.555], ['C', ' HD1', 175.216, 104.551, 105.319], ['C', ' HD1', 175.592, 104.337, 107.043]] AA_SCO= 2.228947368421052 CA_SCO= 1.7342105263157892
[['C', ' N ', 181.044, 106.952, 105.511], ['C', ' CA ', 182.325, 106.706, 104.886], ['C', ' C ', 183.15, 105.709, 105.669], ['C', ' O ', 184.023, 105.059, 105.105], ['C', ' CB ', 183.079, 108.012, 104.668], ['C', ' CG ', 182.323, 109.08, 103.81], ['C', ' CD ', 181.948, 108.629, 102.363], ['C', ' CE ', 181.396, 109.845, 101.547], ['C', ' NZ ', 180.859, 109.49, 100.129], ['C', ' H ', 180.944, 107.463, 106.388], ['C', ' HA ', 182.161, 106.259, 103.909], ['C', ' HB ', 183.287, 108.462, 105.622], ['C', ' HB ', 184.035, 107.807, 104.189], ['C', ' HG ', 181.401, 109.333, 104.326], ['C', ' HG ', 182.935, 109.981, 103.753], ['C', ' HD ', 182.823, 108.217, 101.86], ['C', ' HD ', 181.173, 107.862, 102.403], ['C', ' HE ', 180.6, 110.328, 102.115], ['C', ' HE ', 182.218, 110.55, 101.431], ['C', ' HZ ', 180.558, 110.34, 99.677], ['C', ' HZ ', 181.588, 109.065, 99.581], ['C', ' HZ ', 180.03, 108.855, 100.137]] AA_SCO= 2.0194736842105265 CA_SCO= 1.7394210526315785
[['C', ' N ', 182.921, 105.615, 106.977], ['C', ' CA ', 183.71, 104.653, 107.73], ['C', ' C ', 182.923, 103.928, 108.776], ['C', ' O ', 182.584, 104.484, 109.831], ['C', ' CB ', 184.883, 105.352, 108.413], ['C', ' CG ', 185.78, 104.497, 109.299], ['C', ' CD1', 186.452, 103.387, 108.47], ['C', ' CD2', 186.812, 105.421, 109.971], ['C', ' H ', 182.204, 106.189, 107.417], ['C', ' HA ', 184.087, 103.911, 107.029], ['C', ' HB ', 185.505, 105.817, 107.647], ['C', ' HB ', 184.477, 106.13, 109.053], ['C', ' HG ', 185.192, 104.018, 110.056], ['C', ' HD1', 187.09, 102.794, 109.12], ['C', ' HD1', 185.711, 102.737, 108.026], ['C', ' HD1', 187.051, 103.832, 107.679], ['C', ' HD2', 187.463, 104.837, 110.625], ['C', ' HD2', 187.406, 105.911, 109.205], ['C', ' HD2', 186.293, 106.177, 110.562]] AA_SCO= 1.8084210526315794 CA_SCO= 1.7593157894736842
[['C', ' N ', 182.72, 102.64, 108.535], ['C', ' CA ', 181.972, 101.844, 109.469], ['C', ' C ', 182.985, 100.983, 110.213], ['C', ' O ', 183.604, 100.066, 109.642], ['C', ' CB ', 180.96, 100.973, 108.718], ['C', ' CG ', 179.754, 100.398, 109.506], ['C', ' CD1', 178.82, 99.747, 108.493], ['C', ' CD2', 180.191, 99.429, 110.585], ['C', ' H ', 183.023, 102.213, 107.646], ['C', ' HA ', 181.461, 102.485, 110.183], ['C', ' HB ', 180.564, 101.565, 107.894], ['C', ' HB ', 181.498, 100.132, 108.28], ['C', ' HG ', 179.199, 101.205, 109.966], ['C', ' HD1', 177.942, 99.353, 108.996], ['C', ' HD1', 178.51, 100.481, 107.752], ['C', ' HD1', 179.339, 98.933, 107.996], ['C', ' HD2', 179.324, 99.043, 111.077], ['C', ' HD2', 180.738, 98.619, 110.157], ['C', ' HD2', 180.805, 99.915, 111.32]] AA_SCO= 1.8505263157894736 CA_SCO= 1.760315789473684
[['C', ' N ', 183.161, 101.299, 111.48], ['C', ' CA ', 184.071, 100.602, 112.342], ['C', ' C ', 183.174, 99.673, 113.117], ['C', ' O ', 182.262, 100.127, 113.8], ['C', ' CB ', 184.761, 101.558, 113.338], ['C', ' CG1', 185.72, 100.772, 114.207], ['C', ' CG2', 185.438, 102.692, 112.606], ['C', ' H ', 182.638, 102.06, 111.871], ['C', ' HA ', 184.789, 100.056, 111.762], ['C', ' HB ', 184.014, 101.983, 114.002], ['C', ' HG1', 186.182, 101.444, 114.916], ['C', ' HG1', 185.182, 99.989, 114.745], ['C', ' HG1', 186.492, 100.318, 113.598], ['C', ' HG2', 185.907, 103.367, 113.323], ['C', ' HG2', 186.192, 102.303, 111.932], ['C', ' HG2', 184.685, 103.231, 112.045]] AA_SCO= 1.8763157894736842 CA_SCO= 1.760526315789474
[['C', ' N ', 183.381, 98.379, 112.959], ['C', ' CA ', 182.526, 97.405, 113.603], ['C', ' C ', 183.09, 96.957, 114.941], ['C', ' O ', 184.307, 96.963, 115.136], ['C', ' H ', 184.163, 98.102, 112.381], ['C', ' HA ', 181.546, 97.838, 113.727], ['C', ' HA ', 182.404, 96.55, 112.949]] AA_SCO= 1.980526315789474 CA_SCO= 1.8277894736842102
[['C', ' N ', 182.228, 96.503, 115.835], ['C', ' CA ', 182.669, 95.973, 117.13], ['C', ' C ', 182.222, 94.534, 117.327], ['C', ' O ', 181.049, 94.235, 117.214], ['C', ' CB ', 182.18, 96.868, 118.279], ['C', ' CG1', 182.784, 98.273, 118.075], ['C', ' CG2', 182.571, 96.266, 119.638], ['C', ' CD1', 182.303, 99.34, 119.016], ['C', ' H ', 181.231, 96.597, 115.608], ['C', ' HA ', 183.757, 95.977, 117.155], ['C', ' HB ', 181.097, 96.965, 118.225], ['C', ' HG1', 183.862, 98.187, 118.143], ['C', ' HG1', 182.528, 98.619, 117.077], ['C', ' HG2', 182.22, 96.896, 120.446], ['C', ' HG2', 182.118, 95.277, 119.756], ['C', ' HG2', 183.658, 96.172, 119.697], ['C', ' HD1', 182.79, 100.275, 118.758], ['C', ' HD1', 181.22, 99.452, 118.918], ['C', ' HD1', 182.548, 99.091, 120.041]] AA_SCO= 2.004736842105263 CA_SCO= 1.8315263157894741
[['C', ' N ', 183.125, 93.639, 117.69], ['C', ' CA ', 182.753, 92.222, 117.819], ['C', ' C ', 181.637, 92.008, 118.843], ['C', ' O ', 181.645, 92.593, 119.931], ['C', ' CB ', 183.945, 91.379, 118.243], ['C', ' CG ', 185.129, 91.344, 117.286], ['C', ' CD1', 185.08, 91.899, 116.021], ['C', ' CD2', 186.295, 90.78, 117.723], ['C', ' CE1', 186.195, 91.891, 115.25], ['C', ' CE2', 187.398, 90.788, 116.941], ['C', ' CZ ', 187.344, 91.343, 115.718], ['C', ' OH ', 188.44, 91.385, 114.948], ['C', ' H ', 184.099, 93.935, 117.802], ['C', ' HA ', 182.377, 91.874, 116.86], ['C', ' HB ', 184.302, 91.722, 119.211], ['C', ' HB ', 183.593, 90.379, 118.37], ['C', ' HD1', 184.18, 92.359, 115.635], ['C', ' HD2', 186.344, 90.344, 118.721], ['C', ' HE1', 186.177, 92.338, 114.269], ['C', ' HE2', 188.329, 90.355, 117.308], ['C', ' HH ', 189.203, 91.133, 115.467]] AA_SCO= 2.01 CA_SCO= 1.8544210526315787
[['C', ' N ', 180.675, 91.152, 118.489], ['C', ' CA ', 179.515, 90.886, 119.346], ['C', ' C ', 179.354, 89.483, 119.798], ['C', ' O ', 179.074, 88.602, 118.997], ['C', ' CB ', 178.224, 91.158, 118.596], ['C', ' SG ', 176.647, 90.884, 119.513], ['C', ' H ', 180.782, 90.677, 117.584], ['C', ' HA ', 179.582, 91.533, 120.218], ['C', ' HB ', 178.251, 92.131, 118.259], ['C', ' HB ', 178.2, 90.514, 117.729], ['C', ' HG ', 175.831, 91.176, 118.493]] AA_SCO= 2.0247368421052636 CA_SCO= 1.8800526315789476
[['C', ' N ', 179.449, 89.265, 121.084], ['C', ' CA ', 179.184, 87.919, 121.523], ['C', ' C ', 177.692, 87.795, 121.719], ['C', ' O ', 177.055, 86.864, 121.215], ['C', ' CB ', 179.902, 87.575, 122.818], ['C', ' CG ', 179.712, 86.125, 123.21], ['C', ' SD ', 180.36, 84.982, 121.966], ['C', ' CE ', 182.096, 84.986, 122.307], ['C', ' H ', 179.691, 90.028, 121.7], ['C', ' HA ', 179.481, 87.218, 120.748], ['C', ' HB ', 180.955, 87.799, 122.753], ['C', ' HB ', 179.49, 88.178, 123.628], ['C', ' HG ', 180.216, 85.934, 124.156], ['C', ' HG ', 178.646, 85.914, 123.35], ['C', ' HE ', 182.587, 84.335, 121.599], ['C', ' HE ', 182.494, 85.985, 122.218], ['C', ' HE ', 182.272, 84.621, 123.32]] AA_SCO= 1.9900000000000002 CA_SCO= 1.88621052631579
[['C', ' N ', 177.14, 88.773, 122.44], ['C', ' CA ', 175.732, 88.84, 122.781], ['C', ' C ', 175.454, 90.09, 123.609], ['C', ' O ', 176.199, 90.372, 124.545], ['C', ' CB ', 175.342, 87.577, 123.56], ['C', ' CG ', 176.096, 87.371, 124.901], ['C', ' CD ', 175.835, 86.009, 125.515], ['C', ' OE1', 175.195, 85.236, 124.86], ['C', ' OE2', 176.342, 85.716, 126.586], ['C', ' H ', 177.737, 89.508, 122.78], ['C', ' HA ', 175.148, 88.896, 121.86], ['C', ' HB ', 174.298, 87.641, 123.799], ['C', ' HB ', 175.46, 86.689, 122.958], ['C', ' HG ', 177.164, 87.504, 124.754], ['C', ' HG ', 175.758, 88.126, 125.596]] AA_SCO= 1.8647368421052632 CA_SCO= 1.8730526315789475
[['C', ' N ', 174.389, 90.835, 123.301], ['C', ' CA ', 174.016, 91.949, 124.18], ['C', ' C ', 172.936, 91.559, 125.145], ['C', ' O ', 172.074, 90.719, 124.848], ['C', ' CB ', 173.584, 93.197, 123.463], ['C', ' CG ', 174.626, 93.985, 122.924], ['C', ' OD1', 175.762, 93.959, 123.409], ['C', ' ND2', 174.284, 94.759, 121.943], ['C', ' H ', 173.821, 90.597, 122.501], ['C', ' HA ', 174.882, 92.215, 124.791], ['C', ' HB ', 172.966, 92.908, 122.638], ['C', ' HB ', 172.993, 93.822, 124.135], ['C', ' HD2', 174.957, 95.378, 121.544], ['C', ' HD2', 173.34, 94.756, 121.604]] AA_SCO= 1.8994736842105264 CA_SCO= 1.8993684210526316
[['C', ' N ', 172.938, 92.235, 126.279], ['C', ' CA ', 171.984, 91.99, 127.325], ['C', ' C ', 171.047, 93.159, 127.46], ['C', ' O ', 171.508, 94.285, 127.514], ['C', ' CB ', 172.749, 91.83, 128.613], ['C', ' CG ', 173.583, 90.673, 128.583], ['C', ' CD1', 174.896, 90.774, 128.205], ['C', ' CD2', 173.07, 89.461, 128.892], ['C', ' CE1', 175.673, 89.666, 128.15], ['C', ' CE2', 173.835, 88.349, 128.834], ['C', ' CZ ', 175.14, 88.452, 128.463], ['C', ' H ', 173.671, 92.94, 126.436], ['C', ' HA ', 171.466, 91.069, 127.107], ['C', ' HB ', 173.385, 92.701, 128.748], ['C', ' HB ', 172.094, 91.767, 129.453], ['C', ' HD1', 175.311, 91.755, 127.94], ['C', ' HD2', 172.032, 89.391, 129.182], ['C', ' HE1', 176.717, 89.744, 127.842], ['C', ' HE2', 173.413, 87.368, 129.075], ['C', ' HZ ', 175.762, 87.553, 128.403]] AA_SCO= 1.9447368421052633 CA_SCO= 1.8716315789473683
[['C', ' N ', 169.748, 92.984, 127.517], ['C', ' CA ', 168.84, 94.061, 127.735], ['C', ' C ', 169.22, 94.718, 129.029], ['C', ' O ', 169.597, 94.02, 129.981], ['C', ' CB ', 167.494, 93.358, 127.812], ['C', ' CG ', 167.695, 92.092, 127.032], ['C', ' CD ', 169.123, 91.693, 127.295], ['C', ' HA ', 168.871, 94.775, 126.902], ['C', ' HB ', 167.22, 93.185, 128.87], ['C', ' HB ', 166.71, 94.001, 127.381], ['C', ' HG ', 166.976, 91.324, 127.357], ['C', ' HG ', 167.496, 92.283, 125.965], ['C', ' HD ', 169.203, 91.051, 128.179], ['C', ' HD ', 169.494, 91.21, 126.391]] AA_SCO= 1.7784210526315793 CA_SCO= 1.8226315789473682
[['C', ' N ', 169.101, 96.023, 129.097], ['C', ' CA ', 169.377, 96.69, 130.341], ['C', ' C ', 168.287, 96.063, 131.176], ['C', ' O ', 167.186, 95.886, 130.663], ['C', ' CB ', 169.26, 98.194, 130.209], ['C', ' CG ', 169.781, 98.945, 131.369], ['C', ' CD1', 171.141, 99.16, 131.462], ['C', ' CD2', 168.942, 99.429, 132.325], ['C', ' CE1', 171.651, 99.869, 132.501], ['C', ' CE2', 169.456, 100.136, 133.368], ['C', ' CZ ', 170.806, 100.364, 133.455], ['C', ' OH ', 171.313, 101.088, 134.502], ['C', ' H ', 168.81, 96.561, 128.288], ['C', ' HA ', 170.355, 96.406, 130.731], ['C', ' HB ', 169.8, 98.523, 129.32], ['C', ' HB ', 168.215, 98.465, 130.072], ['C', ' HD1', 171.809, 98.772, 130.698], ['C', ' HD2', 167.867, 99.258, 132.255], ['C', ' HE1', 172.722, 100.048, 132.57], ['C', ' HE2', 168.789, 100.535, 134.13], ['C', ' HH ', 172.117, 101.573, 134.208]] AA_SCO= 1.7578947368421047 CA_SCO= 1.8239473684210523
[['C', ' N ', 168.572, 95.732, 132.426], ['C', ' CA ', 167.719, 94.923, 133.323], ['C', ' C ', 168.403, 93.567, 133.474], ['C', ' O ', 168.519, 93.064, 134.598], ['C', ' CB ', 166.276, 94.625, 132.822], ['C', ' OG1', 165.568, 95.828, 132.594], ['C', ' CG2', 165.527, 93.828, 133.881], ['C', ' H ', 169.472, 96.013, 132.768], ['C', ' HA ', 167.658, 95.399, 134.298], ['C', ' HB ', 166.303, 94.03, 131.905], ['C', ' HG1', 165.946, 96.2, 131.785], ['C', ' HG2', 164.518, 93.628, 133.526], ['C', ' HG2', 166.025, 92.882, 134.076], ['C', ' HG2', 165.481, 94.408, 134.801]] AA_SCO= 1.7278947368421052 CA_SCO= 1.840736842105263
[['C', ' N ', 168.839, 92.937, 132.376], ['C', ' CA ', 169.591, 91.702, 132.534], ['C', ' C ', 170.923, 92.062, 133.126], ['C', ' O ', 171.393, 91.414, 134.063], ['C', ' CB ', 169.829, 90.976, 131.23], ['C', ' OG ', 168.675, 90.374, 130.7], ['C', ' H ', 168.736, 93.339, 131.445], ['C', ' HA ', 169.062, 91.04, 133.22], ['C', ' HB ', 170.189, 91.687, 130.517], ['C', ' HB ', 170.605, 90.276, 131.373], ['C', ' HG ', 168.994, 89.788, 129.949]] AA_SCO= 1.704736842105263 CA_SCO= 1.8409999999999995
[['C', ' N ', 171.496, 93.169, 132.653], ['C', ' CA ', 172.783, 93.549, 133.213], ['C', ' C ', 172.612, 93.901, 134.665], ['C', ' O ', 173.391, 93.487, 135.511], ['C', ' CB ', 173.38, 94.787, 132.538], ['C', ' CG ', 173.857, 94.694, 131.114], ['C', ' CD1', 174.268, 96.079, 130.688], ['C', ' CD2', 175.028, 93.726, 130.993], ['C', ' H ', 171.048, 93.648, 131.866], ['C', ' HA ', 173.464, 92.705, 133.15], ['C', ' HB ', 172.634, 95.576, 132.571], ['C', ' HB ', 174.214, 95.115, 133.117], ['C', ' HG ', 173.04, 94.364, 130.466], ['C', ' HD1', 174.612, 96.047, 129.66], ['C', ' HD1', 173.42, 96.756, 130.77], ['C', ' HD1', 175.079, 96.433, 131.327], ['C', ' HD2', 175.363, 93.689, 129.958], ['C', ' HD2', 175.846, 94.055, 131.628], ['C', ' HD2', 174.719, 92.748, 131.289]] AA_SCO= 1.703157894736842 CA_SCO= 1.8326842105263152
[['C', ' N ', 171.53, 94.583, 134.994], ['C', ' CA ', 171.346, 94.968, 136.374], ['C', ' C ', 171.162, 93.741, 137.227], ['C', ' O ', 171.749, 93.634, 138.295], ['C', ' CB ', 170.133, 95.864, 136.536], ['C', ' CG ', 170.274, 97.224, 135.959], ['C', ' CD ', 168.992, 97.97, 136.039], ['C', ' OE1', 167.95, 97.418, 135.7], ['C', ' NE2', 169.035, 99.201, 136.506], ['C', ' H ', 170.877, 94.852, 134.284], ['C', ' HA ', 172.234, 95.496, 136.718], ['C', ' HB ', 169.269, 95.382, 136.088], ['C', ' HB ', 169.921, 95.982, 137.599], ['C', ' HG ', 171.002, 97.757, 136.539], ['C', ' HG ', 170.59, 97.166, 134.92], ['C', ' HE2', 168.193, 99.74, 136.588], ['C', ' HE2', 169.908, 99.607, 136.778]] AA_SCO= 1.6194736842105262 CA_SCO= 1.8314736842105261
[['C', ' N ', 170.442, 92.748, 136.733], ['C', ' CA ', 170.244, 91.559, 137.529], ['C', ' C ', 171.566, 90.891, 137.849], ['C', ' O ', 171.865, 90.605, 139.018], ['C', ' CB ', 169.364, 90.537, 136.783], ['C', ' OG1', 168.068, 91.106, 136.53], ['C', ' CG2', 169.206, 89.272, 137.634], ['C', ' H ', 169.945, 92.849, 135.85], ['C', ' HA ', 169.757, 91.838, 138.463], ['C', ' HB ', 169.827, 90.278, 135.83], ['C', ' HG1', 168.155, 91.826, 135.864], ['C', ' HG2', 168.579, 88.566, 137.109], ['C', ' HG2', 170.173, 88.812, 137.827], ['C', ' HG2', 168.736, 89.534, 138.587]] AA_SCO= 1.7468421052631578 CA_SCO= 1.8451052631578946
[['C', ' N ', 172.428, 90.726, 136.859], ['C', ' CA ', 173.629, 90.023, 137.227], ['C', ' C ', 174.759, 90.914, 137.72], ['C', ' O ', 175.727, 90.426, 138.292], ['C', ' CB ', 174.049, 89.017, 136.172], ['C', ' CG ', 174.268, 89.464, 134.793], ['C', ' CD1', 175.413, 90.132, 134.432], ['C', ' CD2', 173.346, 89.132, 133.81], ['C', ' CE1', 175.621, 90.47, 133.135], ['C', ' CE2', 173.566, 89.475, 132.519], ['C', ' CZ ', 174.705, 90.141, 132.183], ['C', ' H ', 172.2, 91.005, 135.893], ['C', ' HA ', 173.37, 89.395, 138.066], ['C', ' HB ', 174.923, 88.543, 136.513], ['C', ' HB ', 173.287, 88.24, 136.133], ['C', ' HD1', 176.16, 90.383, 135.188], ['C', ' HD2', 172.438, 88.585, 134.079], ['C', ' HE1', 176.522, 90.995, 132.857], ['C', ' HE2', 172.845, 89.215, 131.756], ['C', ' HZ ', 174.888, 90.409, 131.15]] AA_SCO= 1.9852631578947364 CA_SCO= 1.8292105263157896
[['C', ' N ', 174.628, 92.214, 137.62], ['C', ' CA ', 175.637, 93.052, 138.214], ['C', ' C ', 175.241, 93.401, 139.649], ['C', ' O ', 176.044, 93.227, 140.572], ['C', ' CB ', 175.87, 94.289, 137.361], ['C', ' CG1', 176.45, 93.812, 136.022], ['C', ' CG2', 176.755, 95.29, 138.065], ['C', ' CD1', 176.505, 94.845, 135.006], ['C', ' H ', 173.874, 92.638, 137.071], ['C', ' HA ', 176.573, 92.501, 138.249], ['C', ' HB ', 174.908, 94.758, 137.152], ['C', ' HG1', 177.444, 93.422, 136.182], ['C', ' HG1', 175.828, 93.008, 135.635], ['C', ' HG2', 176.899, 96.167, 137.456], ['C', ' HG2', 176.286, 95.596, 138.987], ['C', ' HG2', 177.714, 94.834, 138.28], ['C', ' HD1', 176.902, 94.439, 134.084], ['C', ' HD1', 175.513, 95.216, 134.842], ['C', ' HD1', 177.117, 95.618, 135.341]] AA_SCO= 2.1252631578947367 CA_SCO= 1.8320526315789476
[['C', ' N ', 173.986, 93.797, 139.855], ['C', ' CA ', 173.523, 94.21, 141.161], ['C', ' C ', 173.058, 93.079, 142.081], ['C', ' O ', 173.09, 93.261, 143.297], ['C', ' CB ', 172.385, 95.189, 140.983], ['C', ' SG ', 172.891, 96.635, 140.065], ['C', ' H ', 173.338, 93.871, 139.08], ['C', ' HA ', 174.335, 94.725, 141.654], ['C', ' HB ', 171.546, 94.719, 140.481], ['C', ' HB ', 172.046, 95.514, 141.964], ['C', ' HG ', 174.171, 96.637, 140.533]] AA_SCO= 2.0657894736842106 CA_SCO= 1.827421052631579
[['C', ' N ', 172.624, 91.917, 141.557], ['C', ' CA ', 172.19, 90.863, 142.472], ['C', ' C ', 173.199, 89.724, 142.538], ['C', ' O ', 173.508, 89.239, 143.624], ['C', ' CB ', 170.815, 90.298, 142.084], ['C', ' CG ', 169.656, 91.299, 142.156], ['C', ' CD ', 168.307, 90.679, 141.792], ['C', ' OE1', 168.291, 89.535, 141.403], ['C', ' OE2', 167.307, 91.35, 141.913], ['C', ' H ', 172.558, 91.746, 140.553], ['C', ' HA ', 172.1, 91.282, 143.472], ['C', ' HB ', 170.848, 89.893, 141.083], ['C', ' HB ', 170.572, 89.472, 142.749], ['C', ' HG ', 169.604, 91.708, 143.164], ['C', ' HG ', 169.87, 92.12, 141.47]] AA_SCO= 2.034210526315789 CA_SCO= 1.8257894736842109
[['C', ' N ', 173.777, 89.333, 141.399], ['C', ' CA ', 174.742, 88.223, 141.446], ['C', ' C ', 176.072, 88.658, 142.06], ['C', ' O ', 176.702, 87.901, 142.796], ['C', ' CB ', 175.041, 87.654, 140.061], ['C', ' CG ', 173.917, 86.93, 139.325], ['C', ' CD ', 173.629, 85.569, 139.883], ['C', ' CE ', 172.628, 84.834, 138.996], ['C', ' NZ ', 172.356, 83.464, 139.49], ['C', ' H ', 173.456, 89.758, 140.527], ['C', ' HA ', 174.332, 87.435, 142.075], ['C', ' HB ', 175.414, 88.422, 139.431], ['C', ' HB ', 175.847, 86.935, 140.171], ['C', ' HG ', 173.004, 87.525, 139.397], ['C', ' HG ', 174.186, 86.827, 138.276], ['C', ' HD ', 174.553, 84.989, 139.938], ['C', ' HD ', 173.211, 85.658, 140.885], ['C', ' HE ', 171.693, 85.395, 138.968], ['C', ' HE ', 173.03, 84.768, 137.981], ['C', ' HZ ', 171.699, 83.008, 138.871], ['C', ' HZ ', 173.228, 82.953, 139.493], ['C', ' HZ ', 171.975, 83.5, 140.424]] AA_SCO= 1.9778947368421047 CA_SCO= 1.824526315789474
[['C', ' N ', 176.506, 89.876, 141.751], ['C', ' CA ', 177.763, 90.386, 142.281], ['C', ' C ', 177.547, 91.318, 143.465], ['C', ' O ', 178.451, 91.523, 144.274], ['C', ' CB ', 178.562, 91.065, 141.173], ['C', ' CG ', 178.923, 90.168, 139.985], ['C', ' CD1', 179.622, 90.997, 138.947], ['C', ' CD2', 179.813, 89.016, 140.435], ['C', ' H ', 175.966, 90.444, 141.11], ['C', ' HA ', 178.336, 89.552, 142.666], ['C', ' HB ', 178.001, 91.898, 140.794], ['C', ' HB ', 179.481, 91.44, 141.593], ['C', ' HG ', 178.009, 89.766, 139.539], ['C', ' HD1', 179.868, 90.379, 138.085], ['C', ' HD1', 178.956, 91.794, 138.642], ['C', ' HD1', 180.532, 91.417, 139.355], ['C', ' HD2', 180.046, 88.417, 139.595], ['C', ' HD2', 180.732, 89.398, 140.869], ['C', ' HD2', 179.31, 88.391, 141.159]] AA_SCO= 2.0094736842105263 CA_SCO= 1.8227894736842107
[['C', ' N ', 176.346, 91.873, 143.584], ['C', ' CA ', 176.028, 92.789, 144.671], ['C', ' C ', 176.464, 94.244, 144.494], ['C', ' O ', 176.625, 94.957, 145.486], ['C', ' H ', 175.627, 91.644, 142.915], ['C', ' HA ', 174.951, 92.764, 144.834], ['C', ' HA ', 176.473, 92.402, 145.585]] AA_SCO= 2.016315789473684 CA_SCO= 1.8216315789473678
[['C', ' N ', 176.69, 94.706, 143.269], ['C', ' CA ', 177.128, 96.089, 143.126], ['C', ' C ', 176.181, 96.928, 142.278], ['C', ' O ', 175.821, 96.558, 141.168], ['C', ' CB ', 178.563, 96.134, 142.572], ['C', ' CG1', 178.661, 95.45, 141.235], ['C', ' CG2', 179.001, 97.556, 142.452], ['C', ' H ', 176.52, 94.117, 142.448], ['C', ' HA ', 177.159, 96.544, 144.114], ['C', ' HB ', 179.215, 95.604, 143.264], ['C', ' HG1', 179.685, 95.492, 140.891], ['C', ' HG1', 178.352, 94.41, 141.322], ['C', ' HG1', 178.038, 95.952, 140.521], ['C', ' HG2', 179.992, 97.614, 142.1], ['C', ' HG2', 178.37, 98.074, 141.755], ['C', ' HG2', 178.949, 98.033, 143.423]] AA_SCO= 1.9431578947368422 CA_SCO= 1.8162631578947366
[['C', ' N ', 175.856, 98.108, 142.773], ['C', ' CA ', 174.974, 99.037, 142.081], ['C', ' C ', 175.598, 99.501, 140.762], ['C', ' O ', 176.813, 99.546, 140.611], ['C', ' CB ', 174.675, 100.21, 142.97], ['C', ' OG ', 174.047, 99.802, 144.148], ['C', ' H ', 176.194, 98.345, 143.695], ['C', ' HA ', 174.036, 98.532, 141.868], ['C', ' HB ', 175.574, 100.752, 143.194], ['C', ' HB ', 174.016, 100.873, 142.44], ['C', ' HG ', 173.854, 100.614, 144.635]] AA_SCO= 1.8057894736842106 CA_SCO= 1.8178947368421052
[['C', ' N ', 174.776, 99.853, 139.78], ['C', ' CA ', 175.309, 100.217, 138.461], ['C', ' C ', 176.171, 101.471, 138.498], ['C', ' O ', 177.149, 101.591, 137.763], ['C', ' CB ', 174.162, 100.452, 137.487], ['C', ' CG ', 173.328, 99.221, 137.169], ['C', ' SD ', 174.213, 97.81, 136.466], ['C', ' CE ', 174.511, 98.334, 134.806], ['C', ' H ', 173.779, 99.854, 139.946], ['C', ' HA ', 175.932, 99.395, 138.105], ['C', ' HB ', 173.491, 101.206, 137.898], ['C', ' HB ', 174.552, 100.852, 136.551], ['C', ' HG ', 172.824, 98.892, 138.068], ['C', ' HG ', 172.565, 99.522, 136.45], ['C', ' HE ', 175.015, 97.543, 134.263], ['C', ' HE ', 173.564, 98.548, 134.321], ['C', ' HE ', 175.129, 99.221, 134.816]] AA_SCO= 1.8894736842105262 CA_SCO= 1.8324210526315787
[['C', ' N ', 175.85, 102.398, 139.387], ['C', ' CA ', 176.58, 103.656, 139.476], ['C', ' C ', 177.958, 103.476, 140.074], ['C', ' O ', 178.764, 104.404, 140.088], ['C', ' CB ', 175.796, 104.698, 140.278], ['C', ' CG ', 175.64, 104.426, 141.757], ['C', ' CD ', 174.482, 103.553, 142.056], ['C', ' OE1', 173.976, 102.927, 141.14], ['C', ' OE2', 174.097, 103.476, 143.194], ['C', ' H ', 175.039, 102.269, 139.995], ['C', ' HA ', 176.709, 104.04, 138.467], ['C', ' HB ', 176.276, 105.669, 140.171], ['C', ' HB ', 174.798, 104.783, 139.867], ['C', ' HG ', 176.537, 103.978, 142.154], ['C', ' HG ', 175.502, 105.38, 142.262]] AA_SCO= 1.861578947368421 CA_SCO= 1.726578947368421
[['C', ' N ', 178.221, 102.306, 140.631], ['C', ' CA ', 179.492, 102.038, 141.244], ['C', ' C ', 180.421, 101.338, 140.28], ['C', ' O ', 181.565, 101.051, 140.63], ['C', ' CB ', 179.278, 101.18, 142.479], ['C', ' CG ', 178.412, 101.793, 143.59], ['C', ' CD1', 178.204, 100.755, 144.671], ['C', ' CD2', 179.072, 103.04, 144.164], ['C', ' H ', 177.54, 101.546, 140.588], ['C', ' HA ', 179.959, 102.978, 141.513], ['C', ' HB ', 178.777, 100.291, 142.153], ['C', ' HB ', 180.245, 100.904, 142.897], ['C', ' HG ', 177.444, 102.062, 143.187], ['C', ' HD1', 177.575, 101.171, 145.457], ['C', ' HD1', 177.717, 99.887, 144.246], ['C', ' HD1', 179.165, 100.464, 145.09], ['C', ' HD2', 178.439, 103.449, 144.951], ['C', ' HD2', 180.047, 102.781, 144.58], ['C', ' HD2', 179.196, 103.794, 143.393]] AA_SCO= 1.8973684210526318 CA_SCO= 1.7510526315789472
[['C', ' N ', 179.945, 101.047, 139.071], ['C', ' CA ', 180.786, 100.333, 138.137], ['C', ' C ', 181.481, 101.287, 137.196], ['C', ' O ', 180.848, 102.116, 136.541], ['C', ' CB ', 179.987, 99.31, 137.337], ['C', ' CG1', 180.941, 98.614, 136.349], ['C', ' CG2', 179.319, 98.352, 138.303], ['C', ' H ', 178.998, 101.325, 138.792], ['C', ' HA ', 181.548, 99.792, 138.697], ['C', ' HB ', 179.213, 99.805, 136.753], ['C', ' HG1', 180.419, 97.888, 135.787], ['C', ' HG1', 181.372, 99.328, 135.661], ['C', ' HG1', 181.745, 98.123, 136.898], ['C', ' HG2', 178.748, 97.619, 137.748], ['C', ' HG2', 180.061, 97.861, 138.898], ['C', ' HG2', 178.648, 98.901, 138.962]] AA_SCO= 2.0947368421052635 CA_SCO= 1.7937894736842102
[['C', ' N ', 182.798, 101.157, 137.144], ['C', ' CA ', 183.67, 101.966, 136.32], ['C', ' C ', 183.817, 101.401, 134.917], ['C', ' O ', 183.719, 102.13, 133.928], ['C', ' CB ', 185.036, 101.996, 136.979], ['C', ' CG ', 185.072, 102.724, 138.299], ['C', ' CD ', 186.337, 102.492, 139.02], ['C', ' OE1', 186.857, 101.4, 138.905], ['C', ' OE2', 186.789, 103.368, 139.705], ['C', ' H ', 183.221, 100.428, 137.715], ['C', ' HA ', 183.258, 102.973, 136.256], ['C', ' HB ', 185.376, 100.974, 137.146], ['C', ' HB ', 185.751, 102.472, 136.309], ['C', ' HG ', 184.95, 103.791, 138.124], ['C', ' HG ', 184.239, 102.385, 138.92]] AA_SCO= 2.129473684210527 CA_SCO= 1.7937894736842102
[['C', ' N ', 184.063, 100.095, 134.851], ['C', ' CA ', 184.289, 99.39, 133.586], ['C', ' C ', 183.682, 98.005, 133.547], ['C', ' O ', 183.526, 97.346, 134.577], ['C', ' CB ', 185.775, 99.314, 133.231], ['C', ' CG ', 186.398, 100.653, 132.915], ['C', ' CD ', 187.826, 100.543, 132.427], ['C', ' CE ', 188.35, 101.935, 132.048], ['C', ' NZ ', 189.769, 101.926, 131.61], ['C', ' H ', 184.105, 99.592, 135.741], ['C', ' HA ', 183.814, 99.963, 132.796], ['C', ' HB ', 186.332, 98.885, 134.044], ['C', ' HB ', 185.907, 98.663, 132.379], ['C', ' HG ', 185.796, 101.165, 132.161], ['C', ' HG ', 186.405, 101.26, 133.815], ['C', ' HD ', 188.455, 100.11, 133.206], ['C', ' HD ', 187.864, 99.899, 131.544], ['C', ' HE ', 187.741, 102.323, 131.227], ['C', ' HE ', 188.251, 102.6, 132.905], ['C', ' HZ ', 190.035, 102.91, 131.361], ['C', ' HZ ', 190.361, 101.597, 132.349], ['C', ' HZ ', 189.887, 101.331, 130.797]] AA_SCO= 2.2421052631578946 CA_SCO= 1.7933684210526315
[['C', ' N ', 183.386, 97.526, 132.341], ['C', ' CA ', 182.868, 96.173, 132.171], ['C', ' C ', 183.541, 95.417, 131.014], ['C', ' O ', 183.872, 96.0, 129.974], ['C', ' CB ', 181.37, 96.237, 131.932], ['C', ' CG ', 180.573, 96.767, 133.042], ['C', ' SD ', 178.848, 96.829, 132.634], ['C', ' CE ', 178.288, 97.727, 134.045], ['C', ' H ', 183.522, 98.107, 131.52], ['C', ' HA ', 183.062, 95.616, 133.082], ['C', ' HB ', 181.173, 96.908, 131.113], ['C', ' HB ', 180.991, 95.246, 131.666], ['C', ' HG ', 180.713, 96.139, 133.924], ['C', ' HG ', 180.897, 97.773, 133.279], ['C', ' HE ', 177.233, 97.898, 133.972], ['C', ' HE ', 178.511, 97.179, 134.938], ['C', ' HE ', 178.793, 98.661, 134.092]] AA_SCO= 2.2631578947368416 CA_SCO= 1.7933684210526315
[['C', ' N ', 183.657, 94.102, 131.175], ['C', ' CA ', 184.224, 93.206, 130.153], ['C', ' C ', 183.525, 91.857, 130.152], ['C', ' O ', 182.871, 91.496, 131.123], ['C', ' CB ', 185.744, 93.052, 130.352], ['C', ' CG ', 186.516, 92.413, 129.169], ['C', ' OD1', 185.894, 91.953, 128.217], ['C', ' OD2', 187.711, 92.356, 129.248], ['C', ' H ', 183.349, 93.724, 132.077], ['C', ' HA ', 184.075, 93.646, 129.181], ['C', ' HB ', 186.172, 94.036, 130.543], ['C', ' HB ', 185.942, 92.457, 131.211]] AA_SCO= 2.36578947368421 CA_SCO= 1.8017894736842102
[['C', ' N ', 183.631, 91.142, 129.043], ['C', ' CA ', 183.057, 89.808, 128.884], ['C', ' C ', 184.078, 88.744, 128.488], ['C', ' O ', 183.726, 87.574, 128.317], ['C', ' CB ', 181.926, 89.821, 127.841], ['C', ' CG1', 182.478, 90.238, 126.449], ['C', ' CG2', 180.85, 90.756, 128.312], ['C', ' CD1', 181.514, 90.034, 125.289], ['C', ' H ', 184.215, 91.539, 128.31], ['C', ' HA ', 182.633, 89.505, 129.836], ['C', ' HB ', 181.515, 88.816, 127.746], ['C', ' HG1', 182.755, 91.288, 126.484], ['C', ' HG1', 183.365, 89.653, 126.229], ['C', ' HG2', 180.014, 90.775, 127.624], ['C', ' HG2', 180.528, 90.412, 129.247], ['C', ' HG2', 181.246, 91.754, 128.418], ['C', ' HD1', 181.998, 90.345, 124.362], ['C', ' HD1', 181.256, 88.978, 125.228], ['C', ' HD1', 180.611, 90.619, 125.43]] AA_SCO= 2.379473684210526 CA_SCO= 1.8036315789473683
[['C', ' N ', 185.322, 89.142, 128.257], ['C', ' CA ', 186.291, 88.172, 127.786], ['C', ' C ', 186.937, 87.342, 128.887], ['C', ' O ', 186.626, 87.46, 130.075], ['C', ' H ', 185.596, 90.126, 128.369], ['C', ' HA ', 185.809, 87.511, 127.068], ['C', ' HA ', 187.07, 88.706, 127.241]] AA_SCO= 2.3242105263157895 CA_SCO= 1.8024736842105262
[['C', ' N ', 187.835, 86.449, 128.466], ['C', ' CA ', 188.575, 85.547, 129.351], ['C', ' C ', 187.675, 84.573, 130.103], ['C', ' O ', 188.075, 83.997, 131.114], ['C', ' CB ', 189.367, 86.356, 130.364], ['C', ' CG ', 190.281, 87.36, 129.757], ['C', ' CD ', 190.983, 88.13, 130.815], ['C', ' CE ', 191.83, 89.198, 130.211], ['C', ' NZ ', 192.459, 90.025, 131.229], ['C', ' H ', 188.029, 86.404, 127.474], ['C', ' HA ', 189.267, 84.961, 128.744], ['C', ' HB ', 188.707, 86.857, 131.051], ['C', ' HB ', 189.981, 85.678, 130.955], ['C', ' HG ', 191.014, 86.853, 129.131], ['C', ' HG ', 189.718, 88.055, 129.141], ['C', ' HD ', 190.247, 88.601, 131.466], ['C', ' HD ', 191.604, 87.464, 131.411], ['C', ' HE ', 192.605, 88.743, 129.599], ['C', ' HE ', 191.208, 89.834, 129.581], ['C', ' HZ ', 193.017, 90.741, 130.758], ['C', ' HZ ', 191.759, 90.477, 131.792], ['C', ' HZ ', 193.058, 89.475, 131.816]] AA_SCO= 2.2142105263157896 CA_SCO= 1.7379473684210522
[['C', ' N ', 186.468, 84.364, 129.6], ['C', ' CA ', 185.543, 83.423, 130.203], ['C', ' C ', 184.763, 83.978, 131.398], ['C', ' O ', 184.138, 83.194, 132.129], ['C', ' H ', 186.194, 84.871, 128.771], ['C', ' HA ', 184.835, 83.095, 129.442], ['C', ' HA ', 186.093, 82.537, 130.515]] AA_SCO= 2.1757894736842105 CA_SCO= 1.6761052631578948
[['C', ' N ', 184.816, 85.297, 131.632], ['C', ' CA ', 184.112, 85.903, 132.763], ['C', ' C ', 183.473, 87.238, 132.417], ['C', ' O ', 183.944, 87.96, 131.549], ['C', ' CB ', 185.066, 86.115, 133.938], ['C', ' CG ', 185.692, 84.857, 134.513], ['C', ' CD ', 186.629, 85.191, 135.661], ['C', ' CE ', 187.243, 83.952, 136.301], ['C', ' NZ ', 188.179, 83.23, 135.385], ['C', ' H ', 185.365, 85.906, 131.017], ['C', ' HA ', 183.313, 85.241, 133.08], ['C', ' HB ', 185.869, 86.75, 133.624], ['C', ' HB ', 184.537, 86.635, 134.736], ['C', ' HG ', 184.91, 84.184, 134.856], ['C', ' HG ', 186.263, 84.363, 133.734], ['C', ' HD ', 187.427, 85.836, 135.302], ['C', ' HD ', 186.087, 85.717, 136.422], ['C', ' HE ', 187.791, 84.262, 137.189], ['C', ' HE ', 186.444, 83.273, 136.598], ['C', ' HZ ', 188.562, 82.426, 135.861], ['C', ' HZ ', 187.681, 82.918, 134.562], ['C', ' HZ ', 188.932, 83.845, 135.11]] AA_SCO= 2.1378947368421053 CA_SCO= 1.6765263157894736
[['C', ' N ', 182.408, 87.585, 133.125], ['C', ' CA ', 181.836, 88.912, 133.002], ['C', ' C ', 182.47, 89.712, 134.14], ['C', ' O ', 182.336, 89.369, 135.322], ['C', ' CB ', 180.307, 88.901, 133.092], ['C', ' CG ', 179.696, 90.233, 132.819], ['C', ' CD1', 179.214, 90.511, 131.569], ['C', ' CD2', 179.642, 91.22, 133.773], ['C', ' CE1', 178.699, 91.747, 131.254], ['C', ' CE2', 179.125, 92.46, 133.463], ['C', ' CZ ', 178.662, 92.722, 132.203], ['C', ' H ', 182.016, 86.932, 133.803], ['C', ' HA ', 182.13, 89.357, 132.057], ['C', ' HB ', 179.907, 88.187, 132.374], ['C', ' HB ', 180.007, 88.59, 134.041], ['C', ' HD1', 179.248, 89.727, 130.816], ['C', ' HD2', 180.025, 91.019, 134.776], ['C', ' HE1', 178.327, 91.947, 130.246], ['C', ' HE2', 179.09, 93.239, 134.21], ['C', ' HZ ', 178.262, 93.704, 131.963]] AA_SCO= 2.1447368421052633 CA_SCO= 1.6752105263157893
[['C', ' N ', 183.234, 90.722, 133.784], ['C', ' CA ', 184.019, 91.469, 134.755], ['C', ' C ', 183.353, 92.78, 135.06], ['C', ' O ', 182.929, 93.494, 134.147], ['C', ' CB ', 185.364, 91.815, 134.137], ['C', ' CG ', 186.155, 90.648, 133.73], ['C', ' CD1', 185.982, 89.982, 132.571], ['C', ' CD2', 187.251, 90.007, 134.383], ['C', ' NE1', 186.857, 88.984, 132.467], ['C', ' CE2', 187.648, 88.969, 133.562], ['C', ' CE3', 187.915, 90.219, 135.562], ['C', ' CZ2', 188.673, 88.132, 133.897], ['C', ' CZ3', 188.95, 89.389, 135.903], ['C', ' CH2', 189.318, 88.366, 135.091], ['C', ' H ', 183.238, 90.967, 132.8], ['C', ' HA ', 184.132, 90.891, 135.671], ['C', ' HB ', 185.2, 92.443, 133.283], ['C', ' HB ', 185.943, 92.389, 134.852], ['C', ' HD1', 185.232, 90.206, 131.817], ['C', ' HE1', 186.881, 88.335, 131.637], ['C', ' HE3', 187.63, 91.005, 136.209], ['C', ' HZ2', 188.981, 87.308, 133.258], ['C', ' HZ3', 189.462, 89.57, 136.846], ['C', ' HH2', 190.141, 87.719, 135.392]] AA_SCO= 2.0063157894736845 CA_SCO= 1.6708947368421052
[['C', ' N ', 183.326, 93.141, 136.332], ['C', ' CA ', 182.819, 94.427, 136.752], ['C', ' C ', 183.869, 95.142, 137.598], ['C', ' O ', 184.195, 94.703, 138.699], ['C', ' CB ', 181.515, 94.192, 137.541], ['C', ' CG1', 180.959, 95.417, 138.017], ['C', ' CG2', 180.505, 93.56, 136.651], ['C', ' H ', 183.641, 92.474, 137.043], ['C', ' HA ', 182.609, 95.038, 135.871], ['C', ' HB ', 181.725, 93.556, 138.395], ['C', ' HG1', 180.048, 95.215, 138.562], ['C', ' HG1', 181.655, 95.909, 138.657], ['C', ' HG1', 180.74, 96.026, 137.171], ['C', ' HG2', 179.593, 93.403, 137.198], ['C', ' HG2', 180.317, 94.226, 135.813], ['C', ' HG2', 180.871, 92.61, 136.289]] AA_SCO= 1.9642105263157899 CA_SCO= 1.672
[['C', ' N ', 184.375, 96.267, 137.123], ['C', ' CA ', 185.426, 96.993, 137.836], ['C', ' C ', 184.749, 98.033, 138.687], ['C', ' O ', 184.009, 98.858, 138.139], ['C', ' CB ', 186.379, 97.605, 136.829], ['C', ' CG ', 187.156, 96.558, 136.06], ['C', ' CD1', 186.61, 95.96, 134.923], ['C', ' CD2', 188.407, 96.195, 136.483], ['C', ' CE1', 187.311, 95.008, 134.238], ['C', ' CE2', 189.114, 95.239, 135.793], ['C', ' CZ ', 188.571, 94.644, 134.681], ['C', ' OH ', 189.285, 93.683, 134.01], ['C', ' H ', 184.052, 96.606, 136.212], ['C', ' HA ', 185.969, 96.316, 138.492], ['C', ' HB ', 185.818, 98.203, 136.133], ['C', ' HB ', 187.084, 98.261, 137.339], ['C', ' HD1', 185.631, 96.234, 134.575], ['C', ' HD2', 188.84, 96.659, 137.369], ['C', ' HE1', 186.876, 94.54, 133.354], ['C', ' HE2', 190.108, 94.946, 136.134], ['C', ' HH ', 188.769, 93.355, 133.268]] AA_SCO= 1.8431578947368423 CA_SCO= 1.6719473684210526
[['C', ' N ', 184.986, 98.004, 140.009], ['C', ' CA ', 184.24, 98.886, 140.91], ['C', ' C ', 185.111, 99.658, 141.893], ['C', ' O ', 184.875, 99.542, 143.103], ['C', ' CB ', 183.312, 98.059, 141.806], ['C', ' OG1', 184.098, 97.196, 142.597], ['C', ' CG2', 182.446, 97.193, 140.955], ['C', ' H ', 185.653, 97.33, 140.416], ['C', ' HA ', 183.671, 99.605, 140.32], ['C', ' HB ', 182.701, 98.709, 142.436], ['C', ' HG1', 184.543, 97.762, 143.262], ['C', ' HG2', 181.825, 96.579, 141.584], ['C', ' HG2', 181.837, 97.821, 140.319], ['C', ' HG2', 183.062, 96.544, 140.353]] AA_SCO= 1.8763157894736842 CA_SCO= 1.6643684210526313
[['C', ' N ', 186.145, 100.367, 141.432], ['C', ' CA ', 187.092, 101.104, 142.286], ['C', ' C ', 187.982, 100.187, 143.116], ['C', ' O ', 189.201, 100.162, 142.953], ['C', ' CB ', 186.392, 102.063, 143.267], ['C', ' CG ', 185.676, 103.215, 142.642], ['C', ' CD ', 184.984, 104.063, 143.682], ['C', ' OE1', 184.785, 103.612, 144.812], ['C', ' NE2', 184.622, 105.284, 143.316], ['C', ' H ', 186.306, 100.458, 140.421], ['C', ' HA ', 187.736, 101.696, 141.632], ['C', ' HB ', 185.703, 101.551, 143.911], ['C', ' HB ', 187.15, 102.492, 143.919], ['C', ' HG ', 186.399, 103.834, 142.117], ['C', ' HG ', 184.931, 102.835, 141.942], ['C', ' HE2', 184.162, 105.89, 143.968], ['C', ' HE2', 184.815, 105.603, 142.385]] AA_SCO= 2.0189473684210526 CA_SCO= 1.612315789473684
[['C', ' N ', 187.369, 99.459, 144.032], ['C', ' CA ', 188.059, 98.514, 144.879], ['C', ' C ', 187.95, 97.107, 144.306], ['C', ' O ', 186.928, 96.436, 144.475], ['C', ' CB ', 187.495, 98.553, 146.299], ['C', ' CG ', 188.252, 97.647, 147.274], ['C', ' OD1', 189.108, 96.913, 146.831], ['C', ' OD2', 187.974, 97.708, 148.452], ['C', ' H ', 186.361, 99.538, 144.095], ['C', ' HA ', 189.113, 98.785, 144.918], ['C', ' HB ', 187.526, 99.576, 146.674], ['C', ' HB ', 186.449, 98.245, 146.274]] AA_SCO= 2.050526315789474 CA_SCO= 1.6148421052631579
[['C', ' N ', 189.003, 96.68, 143.619], ['C', ' CA ', 189.082, 95.38, 142.967], ['C', ' C ', 188.065, 95.215, 141.824], ['C', ' O ', 187.293, 96.132, 141.503], ['C', ' CB ', 188.867, 94.286, 144.041], ['C', ' CG ', 189.445, 92.928, 143.686], ['C', ' OD1', 189.995, 92.835, 142.614], ['C', ' OD2', 189.338, 92.008, 144.459], ['C', ' H ', 189.802, 97.295, 143.552], ['C', ' HA ', 190.083, 95.271, 142.55], ['C', ' HB ', 189.288, 94.623, 144.995], ['C', ' HB ', 187.794, 94.147, 144.197]] AA_SCO= 1.868421052631579 CA_SCO= 1.7182105263157892
[['C', ' N ', 188.088, 94.035, 141.213], ['C', ' CA ', 187.166, 93.69, 140.149], ['C', ' C ', 186.342, 92.485, 140.566], ['C', ' O ', 186.864, 91.487, 141.058], ['C', ' CB ', 187.929, 93.408, 138.836], ['C', ' CG1', 188.878, 92.226, 138.976], ['C', ' CG2', 186.953, 93.175, 137.704], ['C', ' H ', 188.794, 93.369, 141.523], ['C', ' HA ', 186.487, 94.524, 139.985], ['C', ' HB ', 188.538, 94.274, 138.616], ['C', ' HG1', 189.421, 92.096, 138.042], ['C', ' HG1', 189.587, 92.42, 139.783], ['C', ' HG1', 188.332, 91.313, 139.19], ['C', ' HG2', 187.503, 93.03, 136.799], ['C', ' HG2', 186.332, 92.302, 137.893], ['C', ' HG2', 186.335, 94.03, 137.592]] AA_SCO= 1.8610526315789473 CA_SCO= 1.7137894736842103
[['C', ' N ', 185.051, 92.563, 140.344], ['C', ' CA ', 184.194, 91.465, 140.697], ['C', ' C ', 183.948, 90.645, 139.464], ['C', ' O ', 183.783, 91.184, 138.367], ['C', ' CB ', 182.867, 91.998, 141.226], ['C', ' CG ', 182.938, 92.96, 142.417], ['C', ' CD1', 181.518, 93.426, 142.746], ['C', ' CD2', 183.595, 92.286, 143.609], ['C', ' H ', 184.671, 93.4, 139.901], ['C', ' HA ', 184.684, 90.832, 141.432], ['C', ' HB ', 182.375, 92.529, 140.42], ['C', ' HB ', 182.244, 91.156, 141.512], ['C', ' HG ', 183.524, 93.844, 142.136], ['C', ' HD1', 181.548, 94.136, 143.574], ['C', ' HD1', 181.094, 93.906, 141.875], ['C', ' HD1', 180.901, 92.575, 143.031], ['C', ' HD2', 183.632, 92.99, 144.441], ['C', ' HD2', 183.014, 91.41, 143.901], ['C', ' HD2', 184.612, 91.984, 143.362]] AA_SCO= 1.6757894736842105 CA_SCO= 1.7044736842105261
[['C', ' N ', 183.876, 89.336, 139.604], ['C', ' CA ', 183.574, 88.572, 138.417], ['C', ' C ', 182.449, 87.615, 138.592], ['C', ' O ', 182.299, 86.957, 139.626], ['C', ' CB ', 184.758, 87.74, 137.973], ['C', ' OG1', 185.092, 86.821, 139.018], ['C', ' CG2', 185.932, 88.614, 137.659], ['C', ' H ', 184.031, 88.88, 140.494], ['C', ' HA ', 183.295, 89.248, 137.613], ['C', ' HB ', 184.473, 87.184, 137.087], ['C', ' HG1', 184.341, 86.222, 139.168], ['C', ' HG2', 186.761, 87.998, 137.33], ['C', ' HG2', 185.64, 89.295, 136.87], ['C', ' HG2', 186.232, 89.181, 138.537]] AA_SCO= 1.692105263157895 CA_SCO= 1.6978421052631578
[['C', ' N ', 181.738, 87.468, 137.505], ['C', ' CA ', 180.661, 86.539, 137.328], ['C', ' C ', 181.095, 85.525, 136.282], ['C', ' O ', 181.386, 85.918, 135.157], ['C', ' CB ', 179.467, 87.316, 136.815], ['C', ' CG ', 178.23, 86.582, 136.471], ['C', ' CD1', 177.6, 85.998, 137.721], ['C', ' CD2', 177.33, 87.538, 135.803], ['C', ' H ', 181.971, 88.113, 136.741], ['C', ' HA ', 180.432, 86.085, 138.282], ['C', ' HB ', 179.185, 88.04, 137.563], ['C', ' HB ', 179.778, 87.857, 135.972], ['C', ' HG ', 178.455, 85.762, 135.784], ['C', ' HD1', 176.678, 85.48, 137.456], ['C', ' HD1', 178.264, 85.301, 138.199], ['C', ' HD1', 177.376, 86.806, 138.408], ['C', ' HD2', 176.409, 87.026, 135.532], ['C', ' HD2', 177.122, 88.359, 136.49], ['C', ' HD2', 177.806, 87.93, 134.906]] AA_SCO= 1.5521052631578947 CA_SCO= 1.697105263157895
[['C', ' N ', 181.165, 84.231, 136.555], ['C', ' CA ', 181.592, 83.265, 135.575], ['C', ' C ', 180.719, 83.409, 134.349], ['C', ' O ', 179.503, 83.592, 134.454], ['C', ' CB ', 181.362, 81.943, 136.303], ['C', ' CG ', 181.489, 82.3, 137.766], ['C', ' CD ', 180.884, 83.684, 137.88], ['C', ' HA ', 182.652, 83.419, 135.327], ['C', ' HB ', 180.389, 81.525, 136.032], ['C', ' HB ', 182.114, 81.21, 135.979], ['C', ' HG ', 180.954, 81.556, 138.38], ['C', ' HG ', 182.543, 82.272, 138.078], ['C', ' HD ', 179.808, 83.622, 138.06], ['C', ' HD ', 181.425, 84.229, 138.672]] AA_SCO= 1.5131578947368418 CA_SCO= 1.6963684210526317
[['C', ' N ', 181.316, 83.333, 133.183], ['C', ' CA ', 180.54, 83.514, 131.991], ['C', ' C ', 179.663, 82.303, 131.904], ['C', ' O ', 180.033, 81.235, 132.398], ['C', ' CB ', 181.437, 83.733, 130.783], ['C', ' CG ', 180.845, 84.339, 129.519], ['C', ' CD1', 180.425, 85.828, 129.792], ['C', ' CD2', 181.914, 84.306, 128.439], ['C', ' H ', 182.32, 83.145, 133.089], ['C', ' HA ', 179.899, 84.384, 132.126], ['C', ' HB ', 182.176, 84.431, 131.083], ['C', ' HB ', 181.922, 82.79, 130.528], ['C', ' HG ', 179.973, 83.772, 129.193], ['C', ' HD1', 180.027, 86.261, 128.874], ['C', ' HD1', 179.664, 85.892, 130.559], ['C', ' HD1', 181.305, 86.403, 130.108], ['C', ' HD2', 181.521, 84.743, 127.519], ['C', ' HD2', 182.785, 84.888, 128.771], ['C', ' HD2', 182.215, 83.276, 128.252]] AA_SCO= 1.4794736842105263 CA_SCO= 1.6951052631578947
[['C', ' N ', 178.491, 82.497, 131.337], ['C', ' CA ', 177.412, 81.529, 131.196], ['C', ' C ', 176.514, 81.528, 132.431], ['C', ' O ', 175.407, 81.004, 132.389], ['C', ' CB ', 177.912, 80.114, 130.883], ['C', ' CG ', 178.76, 80.012, 129.602], ['C', ' CD ', 179.151, 78.576, 129.326], ['C', ' CE ', 180.037, 78.466, 128.098], ['C', ' NZ ', 180.473, 77.06, 127.854], ['C', ' H ', 178.335, 83.422, 130.952], ['C', ' HA ', 176.797, 81.841, 130.352], ['C', ' HB ', 178.44, 79.677, 131.723], ['C', ' HB ', 177.042, 79.479, 130.716], ['C', ' HG ', 178.188, 80.397, 128.76], ['C', ' HG ', 179.665, 80.603, 129.701], ['C', ' HD ', 179.689, 78.181, 130.189], ['C', ' HD ', 178.254, 77.979, 129.173], ['C', ' HE ', 179.489, 78.822, 127.227], ['C', ' HE ', 180.921, 79.09, 128.238], ['C', ' HZ ', 181.06, 77.024, 127.033], ['C', ' HZ ', 180.994, 76.724, 128.652], ['C', ' HZ ', 179.663, 76.473, 127.712]] AA_SCO= 1.513684210526316 CA_SCO= 1.6904736842105264
[['C', ' N ', 176.821, 82.367, 133.426], ['C', ' CA ', 175.861, 82.554, 134.518], ['C', ' C ', 174.88, 83.629, 134.043], ['C', ' O ', 173.891, 83.956, 134.698], ['C', ' CB ', 176.556, 82.946, 135.812], ['C', ' CG ', 177.473, 81.871, 136.357], ['C', ' CD ', 176.746, 80.641, 136.829], ['C', ' OE1', 175.834, 80.773, 137.606], ['C', ' OE2', 177.1, 79.564, 136.412], ['C', ' H ', 177.743, 82.819, 133.504], ['C', ' HA ', 175.315, 81.624, 134.686], ['C', ' HB ', 177.157, 83.826, 135.633], ['C', ' HB ', 175.816, 83.194, 136.571], ['C', ' HG ', 178.15, 81.578, 135.562], ['C', ' HG ', 178.061, 82.282, 137.169]] AA_SCO= 1.656842105263158 CA_SCO= 1.671421052631579
[['C', ' N ', 175.184, 84.121, 132.84], ['C', ' CA ', 174.496, 85.099, 132.037], ['C', ' C ', 173.814, 84.383, 130.854], ['C', ' O ', 173.267, 85.023, 129.961], ['C', ' CB ', 175.495, 86.116, 131.467], ['C', ' OG1', 176.431, 85.446, 130.595], ['C', ' CG2', 176.266, 86.735, 132.588], ['C', ' H ', 176.047, 83.782, 132.455], ['C', ' HA ', 173.758, 85.613, 132.646], ['C', ' HB ', 174.97, 86.887, 130.931], ['C', ' HG1', 176.009, 85.298, 129.726], ['C', ' HG2', 176.974, 87.46, 132.186], ['C', ' HG2', 175.577, 87.234, 133.254], ['C', ' HG2', 176.81, 85.971, 133.138]] AA_SCO= 1.7226315789473683 CA_SCO= 1.7555263157894736
[['C', ' N ', 173.869, 83.045, 130.824], ['C', ' CA ', 173.372, 82.242, 129.704], ['C', ' C ', 171.909, 82.458, 129.379], ['C', ' O ', 171.516, 82.389, 128.223], ['C', ' CB ', 173.587, 80.755, 129.96], ['C', ' CG ', 173.173, 79.893, 128.838], ['C', ' ND1', 173.906, 79.784, 127.677], ['C', ' CD2', 172.095, 79.097, 128.68], ['C', ' CE1', 173.297, 78.954, 126.855], ['C', ' NE2', 172.195, 78.521, 127.439], ['C', ' H ', 174.297, 82.534, 131.596], ['C', ' HA ', 173.935, 82.504, 128.807], ['C', ' HB ', 174.637, 80.567, 130.119], ['C', ' HB ', 173.055, 80.449, 130.858], ['C', ' HD1', 174.762, 80.253, 127.47], ['C', ' HD2', 171.245, 78.868, 129.323], ['C', ' HE1', 173.721, 78.733, 125.877]] AA_SCO= 1.7899999999999998 CA_SCO= 1.7933684210526315
[['C', ' N ', 171.078, 82.632, 130.388], ['C', ' CA ', 169.653, 82.806, 130.156], ['C', ' C ', 169.23, 84.27, 130.051], ['C', ' O ', 168.037, 84.568, 130.099], ['C', ' H ', 171.44, 82.637, 131.331], ['C', ' HA ', 169.373, 82.282, 129.243], ['C', ' HA ', 169.103, 82.334, 130.968]] AA_SCO= 1.916315789473684 CA_SCO= 1.6945789473684212
[['C', ' N ', 170.192, 85.188, 129.98], ['C', ' CA ', 169.878, 86.603, 129.996], ['C', ' C ', 170.071, 87.46, 128.738], ['C', ' O ', 169.779, 88.668, 128.793], ['C', ' CB ', 170.697, 87.219, 131.103], ['C', ' CG ', 170.3, 86.811, 132.448], ['C', ' CD1', 170.88, 85.736, 133.054], ['C', ' CD2', 169.351, 87.545, 133.102], ['C', ' CE1', 170.512, 85.386, 134.32], ['C', ' CE2', 168.975, 87.205, 134.362], ['C', ' CZ ', 169.551, 86.127, 134.977], ['C', ' OH ', 169.17, 85.785, 136.248], ['C', ' H ', 171.174, 84.909, 129.915], ['C', ' HA ', 168.825, 86.69, 130.263], ['C', ' HB ', 171.744, 86.951, 130.966], ['C', ' HB ', 170.633, 88.245, 131.037], ['C', ' HD1', 171.623, 85.157, 132.537], ['C', ' HD2', 168.893, 88.406, 132.614], ['C', ' HE1', 170.975, 84.523, 134.804], ['C', ' HE2', 168.216, 87.794, 134.878], ['C', ' HH ', 168.47, 86.376, 136.543]] AA_SCO= 1.933684210526316 CA_SCO= 1.6667368421052629
[['C', ' N ', 170.573, 86.908, 127.629], ['C', ' CA ', 170.849, 87.733, 126.452], ['C', ' C ', 169.599, 87.886, 125.609], ['C', ' O ', 168.66, 87.095, 125.707], ['C', ' CB ', 171.992, 87.173, 125.604], ['C', ' CG ', 171.634, 86.09, 124.591], ['C', ' CD ', 171.412, 84.772, 125.166], ['C', ' OE1', 171.092, 84.7, 126.323], ['C', ' OE2', 171.559, 83.795, 124.451], ['C', ' H ', 170.782, 85.905, 127.569], ['C', ' HA ', 171.147, 88.725, 126.779], ['C', ' HB ', 172.447, 87.999, 125.062], ['C', ' HB ', 172.761, 86.763, 126.261], ['C', ' HG ', 170.763, 86.374, 124.008], ['C', ' HG ', 172.468, 86.011, 123.894]] AA_SCO= 2.0894736842105264 CA_SCO= 1.6662105263157891
[['C', ' N ', 169.565, 88.915, 124.787], ['C', ' CA ', 168.415, 89.111, 123.926], ['C', ' C ', 168.276, 88.077, 122.828], ['C', ' O ', 169.234, 87.778, 122.107], ['C', ' CB ', 168.426, 90.489, 123.333], ['C', ' CG ', 167.226, 90.815, 122.514], ['C', ' CD ', 167.074, 92.247, 122.296], ['C', ' OE1', 167.134, 93.018, 123.256], ['C', ' NE2', 166.839, 92.677, 121.091], ['C', ' H ', 170.37, 89.55, 124.762], ['C', ' HA ', 167.526, 89.037, 124.553], ['C', ' HB ', 168.557, 91.229, 124.103], ['C', ' HB ', 169.265, 90.529, 122.67], ['C', ' HG ', 167.341, 90.37, 121.538], ['C', ' HG ', 166.326, 90.448, 123.002], ['C', ' HE2', 166.733, 93.658, 120.924], ['C', ' HE2', 166.722, 92.05, 120.3]] AA_SCO= 2.1578947368421053 CA_SCO= 1.6482631578947367
[['C', ' N ', 167.029, 87.651, 122.616], ['C', ' CA ', 166.641, 86.621, 121.657], ['C', ' C ', 167.104, 86.893, 120.241], ['C', ' O ', 167.424, 85.967, 119.499], ['C', ' CB ', 165.139, 86.467, 121.636], ['C', ' H ', 166.314, 88.005, 123.238], ['C', ' HA ', 167.081, 85.69, 121.993], ['C', ' HB ', 164.867, 85.665, 120.946], ['C', ' HB ', 164.783, 86.225, 122.636], ['C', ' HB ', 164.681, 87.398, 121.3]] AA_SCO= 2.14421052631579 CA_SCO= 1.5279473684210523
[['C', ' N ', 167.198, 88.139, 119.848], ['C', ' CA ', 167.617, 88.434, 118.488], ['C', ' C ', 168.997, 87.849, 118.101], ['C', ' O ', 169.257, 87.717, 116.894], ['C', ' H ', 166.931, 88.899, 120.45], ['C', ' HA ', 166.858, 88.047, 117.806], ['C', ' HA ', 167.621, 89.514, 118.348]] AA_SCO= 2.1789473684210527 CA_SCO= 1.5387894736842103
[['C', ' N ', 169.907, 87.524, 119.095], ['C', ' CA ', 171.21, 86.929, 118.812], ['C', ' C ', 171.256, 85.447, 119.125], ['C', ' O ', 172.306, 84.817, 119.038], ['C', ' CB ', 172.393, 87.665, 119.511], ['C', ' SG ', 172.958, 89.208, 118.698], ['C', ' H ', 169.636, 87.672, 120.068], ['C', ' HA ', 171.392, 86.998, 117.746], ['C', ' HB ', 172.104, 87.924, 120.535], ['C', ' HB ', 173.267, 87.013, 119.591]] AA_SCO= 2.1900000000000004 CA_SCO= 1.5785263157894733
[['C', ' N ', 170.086, 84.825, 119.209], ['C', ' CA ', 170.09, 83.376, 119.285], ['C', ' C ', 170.507, 82.925, 117.898], ['C', ' O ', 171.035, 81.836, 117.706], ['C', ' CB ', 168.722, 82.802, 119.664], ['C', ' CG ', 168.263, 83.107, 121.076], ['C', ' CD ', 169.08, 82.404, 122.147], ['C', ' CE ', 168.518, 82.688, 123.542], ['C', ' NZ ', 169.369, 82.093, 124.615], ['C', ' H ', 169.202, 85.348, 119.26], ['C', ' HA ', 170.846, 83.044, 119.994], ['C', ' HB ', 167.967, 83.213, 118.989], ['C', ' HB ', 168.725, 81.722, 119.529], ['C', ' HG ', 168.412, 84.161, 121.225], ['C', ' HG ', 167.206, 82.879, 121.193], ['C', ' HD ', 169.09, 81.326, 121.965], ['C', ' HD ', 170.108, 82.769, 122.137], ['C', ' HE ', 168.474, 83.77, 123.692], ['C', ' HE ', 167.513, 82.277, 123.619], ['C', ' HZ ', 168.989, 82.318, 125.522], ['C', ' HZ ', 169.434, 81.096, 124.517], ['C', ' HZ ', 170.305, 82.508, 124.538]] AA_SCO= 2.1700000000000004 CA_SCO= 1.5567894736842103
[['C', ' N ', 170.252, 83.793, 116.921], ['C', ' CA ', 170.593, 83.555, 115.545], ['C', ' C ', 171.641, 84.547, 114.952], ['C', ' O ', 171.647, 84.716, 113.729], ['C', ' CB ', 169.331, 83.543, 114.683], ['C', ' CG1', 168.59, 84.887, 114.75], ['C', ' CG2', 168.425, 82.411, 115.218], ['C', ' CD1', 167.5, 85.052, 113.7], ['C', ' H ', 169.799, 84.666, 117.161], ['C', ' HA ', 171.026, 82.559, 115.482], ['C', ' HB ', 169.6, 83.358, 113.653], ['C', ' HG1', 168.135, 85.004, 115.736], ['C', ' HG1', 169.313, 85.694, 114.608], ['C', ' HG2', 167.533, 82.335, 114.624], ['C', ' HG2', 168.95, 81.472, 115.186], ['C', ' HG2', 168.149, 82.612, 116.248], ['C', ' HD1', 167.055, 86.036, 113.815], ['C', ' HD1', 167.941, 84.967, 112.699], ['C', ' HD1', 166.731, 84.297, 113.813]] AA_SCO= 2.348421052631579 CA_SCO= 1.5290526315789474
[['C', ' N ', 172.492, 85.234, 115.795], ['C', ' CA ', 173.581, 86.116, 115.305], ['C', ' C ', 174.744, 85.165, 115.085], ['C', ' O ', 175.114, 84.4, 115.978], ['C', ' CB ', 174.043, 87.299, 116.269], ['C', ' SG ', 172.904, 88.766, 116.562], ['C', ' H ', 172.428, 85.036, 116.801], ['C', ' HA ', 173.29, 86.569, 114.354], ['C', ' HB ', 174.242, 86.876, 117.246], ['C', ' HB ', 174.998, 87.72, 115.911]] AA_SCO= 2.3247368421052634 CA_SCO= 1.5365263157894737
[['C', ' N ', 175.296, 85.201, 113.893], ['C', ' CA ', 176.389, 84.312, 113.503], ['C', ' C ', 177.728, 85.04, 113.331], ['C', ' O ', 178.819, 84.485, 113.495], ['C', ' CB ', 175.933, 83.633, 112.209], ['C', ' CG ', 175.775, 84.614, 111.055], ['C', ' CD ', 175.139, 84.002, 109.829], ['C', ' CE ', 174.913, 85.11, 108.783], ['C', ' NZ ', 174.193, 84.648, 107.575], ['C', ' H ', 174.907, 85.854, 113.225], ['C', ' HA ', 176.513, 83.556, 114.279], ['C', ' HB ', 176.63, 82.866, 111.915], ['C', ' HB ', 174.97, 83.155, 112.374], ['C', ' HG ', 175.175, 85.466, 111.361], ['C', ' HG ', 176.758, 84.978, 110.757], ['C', ' HD ', 175.79, 83.233, 109.414], ['C', ' HD ', 174.174, 83.552, 110.084], ['C', ' HE ', 174.327, 85.904, 109.245], ['C', ' HE ', 175.878, 85.516, 108.48], ['C', ' HZ ', 174.063, 85.46, 106.935], ['C', ' HZ ', 174.706, 83.932, 107.108], ['C', ' HZ ', 173.259, 84.278, 107.823]] AA_SCO= 2.5115789473684216 CA_SCO= 1.5518421052631581
[['C', ' N ', 177.649, 86.305, 113.001], ['C', ' CA ', 178.8, 87.101, 112.66], ['C', ' C ', 179.496, 87.757, 113.825], ['C', ' O ', 179.447, 88.969, 113.987], ['C', ' CB ', 178.391, 88.12, 111.614], ['C', ' CG ', 177.21, 88.91, 112.048], ['C', ' OD1', 176.443, 88.392, 112.864], ['C', ' OD2', 177.032, 89.991, 111.563], ['C', ' H ', 176.744, 86.763, 112.949], ['C', ' HA ', 179.525, 86.439, 112.186], ['C', ' HB ', 179.226, 88.8, 111.426], ['C', ' HB ', 178.164, 87.613, 110.671]] AA_SCO= 2.4821052631578944 CA_SCO= 1.5546315789473684
[['C', ' N ', 180.208, 86.959, 114.616], ['C', ' CA ', 180.891, 87.506, 115.801], ['C', ' C ', 181.716, 88.691, 115.345], ['C', ' O ', 181.661, 89.801, 115.893], ['C', ' CB ', 181.832, 86.464, 116.439], ['C', ' CG ', 182.551, 86.99, 117.616], ['C', ' CD1', 181.881, 87.138, 118.78], ['C', ' CD2', 183.864, 87.319, 117.551], ['C', ' CE1', 182.505, 87.637, 119.869], ['C', ' CE2', 184.487, 87.81, 118.65], ['C', ' CZ ', 183.806, 87.976, 119.807], ['C', ' OH ', 184.428, 88.491, 120.916], ['C', ' H ', 180.165, 85.96, 114.397], ['C', ' HA ', 180.151, 87.85, 116.526], ['C', ' HB ', 181.308, 85.577, 116.735], ['C', ' HB ', 182.573, 86.156, 115.709], ['C', ' HD1', 180.834, 86.869, 118.836], ['C', ' HD2', 184.413, 87.199, 116.636], ['C', ' HE1', 181.965, 87.768, 120.782], ['C', ' HE2', 185.523, 88.082, 118.603], ['C', ' HH ', 183.796, 88.567, 121.635]] AA_SCO= 2.444736842105263 CA_SCO= 1.3084736842105265
[['C', ' N ', 182.456, 88.441, 114.287], ['C', ' CA ', 183.292, 89.417, 113.649], ['C', ' C ', 182.441, 90.204, 112.666], ['C', ' O ', 181.823, 89.624, 111.771], ['C', ' CB ', 184.432, 88.691, 112.933], ['C', ' CG1', 185.267, 89.631, 112.179], ['C', ' CG2', 185.261, 87.978, 113.957], ['C', ' H ', 182.395, 87.511, 113.901], ['C', ' HA ', 183.693, 90.088, 114.403], ['C', ' HB ', 184.017, 87.97, 112.226], ['C', ' HG1', 186.062, 89.07, 111.697], ['C', ' HG1', 184.664, 90.137, 111.425], ['C', ' HG1', 185.697, 90.36, 112.853], ['C', ' HG2', 186.057, 87.449, 113.478], ['C', ' HG2', 185.672, 88.702, 114.656], ['C', ' HG2', 184.649, 87.27, 114.487]] AA_SCO= 2.508421052631579 CA_SCO= 1.2727894736842105
[['C', ' N ', 182.492, 91.526, 112.745], ['C', ' CA ', 181.664, 92.368, 111.893], ['C', ' C ', 182.194, 92.422, 110.474], ['C', ' O ', 182.765, 93.407, 110.021], ['C', ' CB ', 181.578, 93.768, 112.478], ['C', ' H ', 183.043, 91.934, 113.482], ['C', ' HA ', 180.672, 91.929, 111.851], ['C', ' HB ', 180.929, 94.389, 111.86], ['C', ' HB ', 181.176, 93.722, 113.474], ['C', ' HB ', 182.556, 94.201, 112.513]] AA_SCO= 2.5078947368421054 CA_SCO= 1.266263157894737
[['C', ' N ', 181.919, 91.353, 109.756], ['C', ' CA ', 182.393, 91.097, 108.408], ['C', ' C ', 181.909, 92.093, 107.366], ['C', ' O ', 182.448, 92.157, 106.267], ['C', ' CB ', 182.023, 89.683, 107.994], ['C', ' CG ', 180.567, 89.419, 107.778], ['C', ' CD ', 180.316, 87.962, 107.462], ['C', ' OE1', 181.28, 87.236, 107.318], ['C', ' OE2', 179.169, 87.573, 107.317], ['C', ' H ', 181.438, 90.607, 110.26], ['C', ' HA ', 183.47, 91.142, 108.435], ['C', ' HB ', 182.55, 89.425, 107.077], ['C', ' HB ', 182.352, 88.996, 108.774], ['C', ' HG ', 179.999, 89.704, 108.665], ['C', ' HG ', 180.223, 90.018, 106.942]] AA_SCO= 2.4568421052631577 CA_SCO= 1.266263157894737
[['C', ' N ', 180.852, 92.816, 107.66], ['C', ' CA ', 180.352, 93.806, 106.724], ['C', ' C ', 180.879, 95.221, 107.015], ['C', ' O ', 180.518, 96.19, 106.342], ['C', ' CB ', 178.832, 93.76, 106.712], ['C', ' CG ', 178.169, 92.466, 106.187], ['C', ' CD1', 176.691, 92.584, 106.379], ['C', ' CD2', 178.476, 92.262, 104.697], ['C', ' H ', 180.415, 92.691, 108.56], ['C', ' HA ', 180.714, 93.547, 105.736], ['C', ' HB ', 178.49, 93.883, 107.726], ['C', ' HB ', 178.481, 94.564, 106.149], ['C', ' HG ', 178.522, 91.61, 106.755], ['C', ' HD1', 176.198, 91.677, 106.026], ['C', ' HD1', 176.501, 92.71, 107.432], ['C', ' HD1', 176.313, 93.44, 105.824], ['C', ' HD2', 177.976, 91.36, 104.355], ['C', ' HD2', 178.109, 93.114, 104.127], ['C', ' HD2', 179.542, 92.151, 104.532]] AA_SCO= 2.3194736842105264 CA_SCO= 1.2573684210526317
[['C', ' N ', 181.695, 95.35, 108.044], ['C', ' CA ', 182.268, 96.621, 108.462], ['C', ' C ', 183.415, 96.935, 107.536], ['C', ' O ', 183.843, 96.045, 106.818], ['C', ' CB ', 182.73, 96.557, 109.893], ['C', ' H ', 181.981, 94.513, 108.558], ['C', ' HA ', 181.516, 97.399, 108.356], ['C', ' HB ', 183.153, 97.516, 110.177], ['C', ' HB ', 181.892, 96.325, 110.538], ['C', ' HB ', 183.485, 95.788, 109.985]] AA_SCO= 2.306315789473684 CA_SCO= 1.2429473684210528
[['C', ' N ', 183.925, 98.171, 107.514], ['C', ' CA ', 185.076, 98.438, 106.657], ['C', ' C ', 186.307, 97.987, 107.425], ['C', ' O ', 187.269, 97.451, 106.864], ['C', ' CB ', 185.155, 99.941, 106.367], ['C', ' CG ', 183.981, 100.438, 105.535], ['C', ' OD1', 183.858, 100.039, 104.409], ['C', ' OD2', 183.157, 101.186, 106.046], ['C', ' H ', 183.574, 98.914, 108.122], ['C', ' HA ', 184.997, 97.866, 105.729], ['C', ' HB ', 185.172, 100.485, 107.312], ['C', ' HB ', 186.076, 100.166, 105.843]] AA_SCO= 2.322105263157895 CA_SCO= 1.2287368421052631
[['C', ' N ', 186.244, 98.206, 108.725], ['C', ' CA ', 187.25, 97.798, 109.687], ['C', ' C ', 186.503, 97.334, 110.915], ['C', ' O ', 185.474, 97.913, 111.224], ['C', ' CB ', 188.243, 98.951, 109.976], ['C', ' CG1', 187.517, 100.143, 110.499], ['C', ' CG2', 189.302, 98.511, 111.019], ['C', ' H ', 185.416, 98.706, 109.066], ['C', ' HA ', 187.802, 96.959, 109.278], ['C', ' HB ', 188.732, 99.226, 109.049], ['C', ' HG1', 188.218, 100.948, 110.677], ['C', ' HG1', 186.772, 100.468, 109.776], ['C', ' HG1', 187.036, 99.888, 111.419], ['C', ' HG2', 190.0, 99.327, 111.194], ['C', ' HG2', 188.828, 98.248, 111.961], ['C', ' HG2', 189.847, 97.649, 110.644]] AA_SCO= 2.2331578947368422 CA_SCO= 1.31
[['C', ' N ', 186.983, 96.328, 111.616], ['C', ' CA ', 186.311, 95.943, 112.85], ['C', ' C ', 187.291, 95.572, 113.931], ['C', ' O ', 188.423, 95.163, 113.663], ['C', ' CB ', 185.371, 94.789, 112.615], ['C', ' OG ', 186.067, 93.659, 112.211], ['C', ' H ', 187.814, 95.84, 111.278], ['C', ' HA ', 185.743, 96.795, 113.21], ['C', ' HB ', 184.825, 94.576, 113.535], ['C', ' HB ', 184.649, 95.063, 111.859], ['C', ' HG ', 185.418, 92.959, 112.155]] AA_SCO= 2.2463157894736847 CA_SCO= 1.3149473684210526
[['C', ' N ', 186.869, 95.751, 115.178], ['C', ' CA ', 187.725, 95.429, 116.3], ['C', ' C ', 187.07, 94.66, 117.442], ['C', ' O ', 185.843, 94.602, 117.582], ['C', ' CB ', 188.293, 96.709, 116.946], ['C', ' OG1', 187.228, 97.409, 117.593], ['C', ' CG2', 188.911, 97.642, 115.897], ['C', ' H ', 185.936, 96.132, 115.331], ['C', ' HA ', 188.521, 94.815, 115.916], ['C', ' HB ', 189.058, 96.438, 117.678], ['C', ' HG1', 186.88, 96.872, 118.313], ['C', ' HG2', 189.298, 98.529, 116.389], ['C', ' HG2', 189.71, 97.131, 115.393], ['C', ' HG2', 188.162, 97.94, 115.172]] AA_SCO= 2.328421052631579 CA_SCO= 1.3012105263157896
[['C', ' N ', 187.926, 94.174, 118.33], ['C', ' CA ', 187.526, 93.532, 119.588], ['C', ' C ', 188.782, 93.12, 120.318], ['C', ' O ', 189.85, 93.23, 119.754], ['C', ' H ', 188.917, 94.251, 118.069], ['C', ' HA ', 186.959, 94.237, 120.196], ['C', ' HA ', 186.89, 92.68, 119.413]] AA_SCO= 2.2694736842105265 CA_SCO= 1.3190526315789475
[['C', ' N ', 188.696, 92.592, 121.524], ['C', ' CA ', 189.908, 92.265, 122.29], ['C', ' C ', 190.29, 90.795, 122.344], ['C', ' O ', 191.207, 90.403, 123.06], ['C', ' CB ', 189.737, 92.776, 123.691], ['C', ' OG ', 188.658, 92.151, 124.312], ['C', ' H ', 187.795, 92.468, 121.973], ['C', ' HA ', 190.74, 92.8, 121.843], ['C', ' HB ', 190.651, 92.599, 124.264], ['C', ' HB ', 189.573, 93.847, 123.667], ['C', ' HG ', 188.608, 92.547, 125.202]] AA_SCO= 2.3668421052631583 CA_SCO= 1.4374210526315792
[['C', ' N ', 189.641, 89.976, 121.558], ['C', ' CA ', 189.837, 88.537, 121.656], ['C', ' C ', 191.26, 88.047, 121.414], ['C', ' O ', 191.733, 87.16, 122.111], ['C', ' CB ', 188.915, 87.849, 120.66], ['C', ' CG1', 189.203, 86.346, 120.592], ['C', ' CG2', 187.508, 88.109, 121.06], ['C', ' H ', 188.951, 90.369, 120.938], ['C', ' HA ', 189.545, 88.235, 122.663], ['C', ' HB ', 189.087, 88.259, 119.672], ['C', ' HG1', 188.53, 85.906, 119.903], ['C', ' HG1', 190.223, 86.137, 120.271], ['C', ' HG1', 189.042, 85.909, 121.575], ['C', ' HG2', 186.856, 87.641, 120.349], ['C', ' HG2', 187.326, 87.694, 122.05], ['C', ' HG2', 187.304, 89.174, 121.081]] AA_SCO= 2.3710526315789475 CA_SCO= 1.4390526315789474
[['C', ' N ', 191.93, 88.589, 120.421], ['C', ' CA ', 193.288, 88.171, 120.079], ['C', ' C ', 194.351, 89.037, 120.741], ['C', ' O ', 195.508, 89.03, 120.326], ['C', ' H ', 191.488, 89.316, 119.879], ['C', ' HA ', 193.436, 87.132, 120.371], ['C', ' HA ', 193.413, 88.212, 118.998]] AA_SCO= 2.273684210526316 CA_SCO= 1.383842105263158
[['C', ' N ', 193.971, 89.856, 121.718], ['C', ' CA ', 194.947, 90.76, 122.284], ['C', ' C ', 195.102, 90.718, 123.812], ['C', ' O ', 194.201, 90.294, 124.531], ['C', ' CB ', 194.58, 92.14, 121.849], ['C', ' OG ', 194.728, 92.297, 120.469], ['C', ' H ', 193.01, 89.875, 122.076], ['C', ' HA ', 195.896, 90.503, 121.831], ['C', ' HB ', 193.542, 92.322, 122.123], ['C', ' HB ', 195.152, 92.83, 122.358], ['C', ' HG ', 194.58, 93.227, 120.297]] AA_SCO= 2.27842105263158 CA_SCO= 1.3896842105263159
[['C', ' N ', 196.273, 91.114, 124.342], ['C', ' CA ', 196.559, 91.297, 125.749], ['C', ' C ', 195.849, 92.538, 126.241], ['C', ' O ', 195.56, 93.428, 125.446], ['C', ' CB ', 198.072, 91.451, 125.779], ['C', ' CG ', 198.408, 92.006, 124.453], ['C', ' CD ', 197.434, 91.358, 123.486], ['C', ' HA ', 196.232, 90.407, 126.309], ['C', ' HB ', 198.359, 92.129, 126.6], ['C', ' HB ', 198.551, 90.476, 125.977], ['C', ' HG ', 198.296, 93.079, 124.484], ['C', ' HG ', 199.454, 91.814, 124.235], ['C', ' HD ', 197.244, 92.073, 122.687], ['C', ' HD ', 197.809, 90.4, 123.11]] AA_SCO= 2.262631578947369 CA_SCO= 1.4144736842105263
[['C', ' N ', 195.669, 92.659, 127.539], ['C', ' CA ', 194.979, 93.824, 128.07], ['C', ' C ', 195.543, 95.138, 127.56], ['C', ' O ', 196.749, 95.393, 127.637], ['C', ' CB ', 195.142, 93.887, 129.586], ['C', ' CG ', 194.502, 92.768, 130.367], ['C', ' OD1', 193.808, 91.943, 129.815], ['C', ' OD2', 194.714, 92.739, 131.55], ['C', ' H ', 195.941, 91.914, 128.17], ['C', ' HA ', 193.919, 93.771, 127.794], ['C', ' HB ', 196.206, 93.901, 129.824], ['C', ' HB ', 194.727, 94.833, 129.941]] AA_SCO= 2.2157894736842105 CA_SCO= 1.4152631578947368
[['C', ' N ', 194.644, 95.999, 127.084], ['C', ' CA ', 194.982, 97.323, 126.583], ['C', ' C ', 195.083, 97.377, 125.071], ['C', ' O ', 194.955, 98.453, 124.482], ['C', ' H ', 193.647, 95.716, 127.049], ['C', ' HA ', 194.23, 98.034, 126.927], ['C', ' HA ', 195.934, 97.627, 127.014]] AA_SCO= 2.2089473684210525 CA_SCO= 1.4150526315789473
[['C', ' N ', 195.201, 96.221, 124.445], ['C', ' CA ', 195.323, 96.063, 123.006], ['C', ' C ', 194.065, 95.47, 122.432], ['C', ' O ', 193.378, 94.703, 123.101], ['C', ' CB ', 196.491, 95.143, 122.697], ['C', ' CG ', 197.801, 95.676, 122.97], ['C', ' CD1', 198.399, 95.78, 124.174], ['C', ' CD2', 198.75, 96.125, 122.01], ['C', ' NE1', 199.652, 96.282, 124.027], ['C', ' CE2', 199.881, 96.503, 122.706], ['C', ' CE3', 198.737, 96.223, 120.638], ['C', ' CZ2', 200.989, 96.989, 122.072], ['C', ' CZ3', 199.848, 96.703, 119.998], ['C', ' CH2', 200.943, 97.079, 120.696], ['C', ' H ', 195.251, 95.355, 124.997], ['C', ' HA ', 195.482, 97.024, 122.544], ['C', ' HB ', 196.407, 94.277, 123.318], ['C', ' HB ', 196.446, 94.823, 121.66], ['C', ' HD1', 197.943, 95.492, 125.129], ['C', ' HE1', 200.308, 96.445, 124.78], ['C', ' HE3', 197.867, 95.919, 120.078], ['C', ' HZ2', 201.883, 97.295, 122.617], ['C', ' HZ3', 199.834, 96.77, 118.924], ['C', ' HH2', 201.812, 97.46, 120.157]] AA_SCO= 2.220526315789474 CA_SCO= 1.4127894736842106
[['C', ' N ', 193.774, 95.748, 121.175], ['C', ' CA ', 192.628, 95.107, 120.557], ['C', ' C ', 192.981, 94.618, 119.162], ['C', ' O ', 193.959, 95.048, 118.558], ['C', ' CB ', 191.46, 96.062, 120.524], ['C', ' OG ', 191.748, 97.151, 119.736], ['C', ' H ', 194.323, 96.426, 120.637], ['C', ' HA ', 192.342, 94.245, 121.152], ['C', ' HB ', 190.58, 95.566, 120.142], ['C', ' HB ', 191.232, 96.393, 121.537], ['C', ' HG ', 190.998, 97.755, 119.837]] AA_SCO= 2.3100000000000005 CA_SCO= 1.6539473684210526
[['C', ' N ', 192.234, 93.652, 118.684], ['C', ' CA ', 192.391, 93.084, 117.362], ['C', ' C ', 191.739, 94.003, 116.378], ['C', ' O ', 190.625, 94.46, 116.619], ['C', ' CB ', 191.732, 91.698, 117.292], ['C', ' OG1', 192.374, 90.833, 118.233], ['C', ' CG2', 191.833, 91.104, 115.876], ['C', ' H ', 191.463, 93.339, 119.246], ['C', ' HA ', 193.445, 92.997, 117.119], ['C', ' HB ', 190.68, 91.787, 117.566], ['C', ' HG1', 192.275, 91.214, 119.113], ['C', ' HG2', 191.368, 90.126, 115.861], ['C', ' HG2', 191.327, 91.745, 115.16], ['C', ' HG2', 192.869, 91.01, 115.593]] AA_SCO= 2.2868421052631582 CA_SCO= 1.670421052631579
[['C', ' N ', 192.423, 94.289, 115.284], ['C', ' CA ', 191.895, 95.122, 114.228], ['C', ' C ', 191.894, 94.389, 112.909], ['C', ' O ', 192.949, 93.986, 112.407], ['C', ' CB ', 192.797, 96.346, 114.032], ['C', ' CG1', 192.251, 97.26, 112.931], ['C', ' CG2', 192.965, 97.052, 115.292], ['C', ' H ', 193.354, 93.901, 115.182], ['C', ' HA ', 190.876, 95.414, 114.472], ['C', ' HB ', 193.765, 96.007, 113.702], ['C', ' HG1', 192.926, 98.102, 112.795], ['C', ' HG1', 192.17, 96.722, 111.988], ['C', ' HG1', 191.268, 97.627, 113.22], ['C', ' HG2', 193.625, 97.88, 115.107], ['C', ' HG2', 192.008, 97.408, 115.646], ['C', ' HG2', 193.406, 96.398, 116.048]] AA_SCO= 2.216315789473684 CA_SCO= 1.6768421052631581
[['C', ' N ', 190.737, 94.27, 112.302], ['C', ' CA ', 190.681, 93.631, 111.017], ['C', ' C ', 190.242, 94.62, 109.971], ['C', ' O ', 189.151, 95.185, 110.065], ['C', ' CB ', 189.686, 92.472, 110.986], ['C', ' CG1', 190.044, 91.435, 112.045], ['C', ' CG2', 189.728, 91.884, 109.578], ['C', ' CD1', 189.044, 90.332, 112.208], ['C', ' H ', 189.891, 94.596, 112.772], ['C', ' HA ', 191.67, 93.265, 110.745], ['C', ' HB ', 188.68, 92.822, 111.218], ['C', ' HG1', 190.945, 91.01, 111.829], ['C', ' HG1', 190.126, 91.941, 112.997], ['C', ' HG2', 189.086, 91.065, 109.5], ['C', ' HG2', 189.43, 92.619, 108.837], ['C', ' HG2', 190.715, 91.561, 109.346], ['C', ' HD1', 189.381, 89.667, 112.996], ['C', ' HD1', 188.084, 90.761, 112.48], ['C', ' HD1', 188.942, 89.766, 111.296]] AA_SCO= 2.2357894736842105 CA_SCO= 1.6805263157894736
[['C', ' N ', 191.057, 94.815, 108.949], ['C', ' CA ', 190.672, 95.723, 107.884], ['C', ' C ', 190.165, 94.857, 106.748], ['C', ' O ', 190.807, 93.867, 106.35], ['C', ' CB ', 191.849, 96.598, 107.463], ['C', ' OG1', 192.931, 95.751, 107.085], ['C', ' CG2', 192.273, 97.489, 108.638], ['C', ' H ', 191.958, 94.32, 108.912], ['C', ' HA ', 189.861, 96.368, 108.217], ['C', ' HB ', 191.558, 97.203, 106.621], ['C', ' HG1', 193.613, 96.234, 106.615], ['C', ' HG2', 193.118, 98.104, 108.363], ['C', ' HG2', 191.441, 98.129, 108.919], ['C', ' HG2', 192.553, 96.867, 109.483]] AA_SCO= 2.3157894736842106 CA_SCO= 1.7069473684210528
[['C', ' N ', 188.965, 95.178, 106.278], ['C', ' CA ', 188.27, 94.389, 105.282], ['C', ' C ', 187.483, 95.142, 104.218], ['C', ' O ', 186.287, 95.323, 104.382], ['C', ' CB ', 187.343, 93.45, 105.987], ['C', ' CG ', 186.41, 94.085, 106.966], ['C', ' CD ', 185.365, 93.175, 107.269], ['C', ' NE ', 185.882, 91.97, 107.817], ['C', ' CZ ', 186.135, 91.77, 109.098], ['C', ' NH1', 185.898, 92.724, 109.969], ['C', ' NH2', 186.621, 90.625, 109.46], ['C', ' H ', 188.488, 96.026, 106.606], ['C', ' HA ', 189.017, 93.792, 104.764], ['C', ' HB ', 186.76, 92.885, 105.264], ['C', ' HB ', 187.935, 92.747, 106.562], ['C', ' HG ', 186.963, 94.286, 107.882], ['C', ' HG ', 185.992, 95.0, 106.629], ['C', ' HD ', 184.649, 93.62, 107.959], ['C', ' HD ', 184.854, 92.931, 106.342], ['C', ' HE ', 186.108, 91.22, 107.148], ['C', ' HH1', 185.52, 93.608, 109.653], ['C', ' HH1', 186.11, 92.626, 110.96], ['C', ' HH2', 186.807, 89.918, 108.763], ['C', ' HH2', 186.827, 90.449, 110.428]] AA_SCO= 2.315263157894737 CA_SCO= 1.6647894736842106
[['C', ' N ', 188.119, 95.515, 103.119], ['C', ' CA ', 187.553, 96.335, 102.027], ['C', ' C ', 188.318, 97.611, 101.991], ['C', ' O ', 188.505, 98.266, 103.029], ['C', ' CB ', 186.035, 96.701, 102.141], ['C', ' OG1', 185.248, 95.524, 102.163], ['C', ' CG2', 185.577, 97.543, 100.95], ['C', ' H ', 189.095, 95.269, 103.049], ['C', ' HA ', 187.706, 95.822, 101.078], ['C', ' HB ', 185.856, 97.286, 103.05], ['C', ' HG1', 185.354, 95.165, 103.039], ['C', ' HG2', 184.517, 97.766, 101.065], ['C', ' HG2', 186.125, 98.476, 100.901], ['C', ' HG2', 185.726, 96.984, 100.026]] AA_SCO= 2.333157894736842 CA_SCO= 1.6554736842105264
[['C', ' N ', 188.773, 97.965, 100.788], ['C', ' CA ', 189.552, 99.161, 100.655], ['C', ' C ', 188.682, 100.287, 101.145], ['C', ' O ', 187.629, 100.563, 100.568], ['C', ' CB ', 189.912, 99.412, 99.192], ['C', ' CG ', 190.855, 98.355, 98.57], ['C', ' OD1', 191.324, 97.457, 99.26], ['C', ' OD2', 191.105, 98.462, 97.399], ['C', ' H ', 188.595, 97.386, 99.98], ['C', ' HA ', 190.449, 99.09, 101.261], ['C', ' HB ', 188.998, 99.447, 98.601], ['C', ' HB ', 190.385, 100.391, 99.108]] AA_SCO= 2.3636842105263156 CA_SCO= 1.6771578947368422
[['C', ' N ', 189.156, 100.931, 102.191], ['C', ' CA ', 188.514, 102.012, 102.928], ['C', ' C ', 188.971, 101.899, 104.359], ['C', ' O ', 189.449, 102.87, 104.955], ['C', ' CB ', 186.983, 101.961, 102.893], ['C', ' H ', 190.058, 100.585, 102.532], ['C', ' HA ', 188.855, 102.964, 102.528], ['C', ' HB ', 186.589, 102.776, 103.499], ['C', ' HB ', 186.594, 102.076, 101.897], ['C', ' HB ', 186.633, 101.014, 103.305]] AA_SCO= 2.2673684210526317 CA_SCO= 1.696842105263158
[['C', ' N ', 188.762, 100.705, 104.926], ['C', ' CA ', 189.12, 100.431, 106.306], ['C', ' C ', 190.618, 100.353, 106.464], ['C', ' O ', 191.18, 100.799, 107.468], ['C', ' H ', 188.392, 99.933, 104.356], ['C', ' HA ', 188.71, 101.201, 106.958], ['C', ' HA ', 188.678, 99.485, 106.604]] AA_SCO= 2.1694736842105264 CA_SCO= 1.6398947368421053
[['C', ' N ', 191.277, 99.802, 105.451], ['C', ' CA ', 192.706, 99.636, 105.501], ['C', ' C ', 193.345, 100.955, 105.24], ['C', ' O ', 194.372, 101.262, 105.814], ['C', ' CB ', 193.144, 98.663, 104.434], ['C', ' CG ', 192.694, 99.172, 103.109], ['C', ' OD1', 191.63, 99.838, 103.087], ['C', ' OD2', 193.379, 98.962, 102.136], ['C', ' H ', 190.772, 99.484, 104.622], ['C', ' HA ', 193.009, 99.295, 106.483], ['C', ' HB ', 194.23, 98.562, 104.443], ['C', ' HB ', 192.708, 97.683, 104.607]] AA_SCO= 2.143157894736842 CA_SCO= 1.6022631578947368
[['C', ' N ', 192.689, 101.749, 104.422], ['C', ' CA ', 193.183, 103.042, 104.05], ['C', ' C ', 193.186, 103.938, 105.254], ['C', ' O ', 194.22, 104.505, 105.593], ['C', ' CB ', 192.32, 103.625, 102.959], ['C', ' OG ', 192.774, 104.891, 102.586], ['C', ' H ', 191.871, 101.35, 103.983], ['C', ' HA ', 194.203, 102.937, 103.684], ['C', ' HB ', 192.322, 102.956, 102.101], ['C', ' HB ', 191.297, 103.699, 103.312], ['C', ' HG ', 192.202, 105.176, 101.872]] AA_SCO= 2.175263157894737 CA_SCO= 1.497421052631579
[['C', ' N ', 192.082, 104.008, 105.981], ['C', ' CA ', 192.11, 104.893, 107.119], ['C', ' C ', 193.025, 104.388, 108.217], ['C', ' O ', 193.647, 105.182, 108.917], ['C', ' CB ', 190.702, 105.182, 107.66], ['C', ' CG1', 190.723, 106.355, 108.693], ['C', ' CG2', 190.092, 103.955, 108.281], ['C', ' CD1', 191.129, 107.704, 108.158], ['C', ' H ', 191.232, 103.516, 105.689], ['C', ' HA ', 192.517, 105.833, 106.764], ['C', ' HB ', 190.071, 105.492, 106.829], ['C', ' HG1', 189.729, 106.444, 109.095], ['C', ' HG1', 191.393, 106.125, 109.496], ['C', ' HG2', 189.115, 104.195, 108.619], ['C', ' HG2', 190.039, 103.168, 107.547], ['C', ' HG2', 190.659, 103.613, 109.115], ['C', ' HD1', 191.08, 108.435, 108.958], ['C', ' HD1', 192.143, 107.689, 107.776], ['C', ' HD1', 190.461, 107.982, 107.371]] AA_SCO= 2.1615789473684215 CA_SCO= 1.4608947368421052
[['C', ' N ', 193.104, 103.068, 108.41], ['C', ' CA ', 193.976, 102.574, 109.446], ['C', ' C ', 195.434, 102.802, 109.032], ['C', ' O ', 196.234, 103.271, 109.822], ['C', ' CB ', 193.671, 101.116, 109.76], ['C', ' CG ', 194.346, 100.636, 110.995], ['C', ' CD1', 193.894, 101.069, 112.234], ['C', ' CD2', 195.405, 99.773, 110.95], ['C', ' CE1', 194.488, 100.663, 113.392], ['C', ' CE2', 196.006, 99.358, 112.118], ['C', ' CZ ', 195.544, 99.809, 113.336], ['C', ' H ', 192.546, 102.408, 107.863], ['C', ' HA ', 193.804, 103.146, 110.348], ['C', ' HB ', 192.591, 100.985, 109.876], ['C', ' HB ', 193.985, 100.496, 108.921], ['C', ' HD1', 193.061, 101.747, 112.275], ['C', ' HD2', 195.776, 99.423, 109.985], ['C', ' HE1', 194.12, 101.024, 114.358], ['C', ' HE2', 196.853, 98.682, 112.079], ['C', ' HZ ', 196.026, 99.485, 114.243]] AA_SCO= 2.2957894736842106 CA_SCO= 1.526315789473684
[['C', ' N ', 195.778, 102.547, 107.771], ['C', ' CA ', 197.137, 102.744, 107.272], ['C', ' C ', 197.527, 104.214, 107.154], ['C', ' O ', 198.712, 104.53, 107.143], ['C', ' CB ', 197.356, 102.042, 105.943], ['C', ' CG ', 197.398, 100.553, 106.077], ['C', ' CD ', 197.606, 99.867, 104.746], ['C', ' CE ', 197.546, 98.37, 104.932], ['C', ' NZ ', 198.673, 97.862, 105.764], ['C', ' H ', 195.094, 102.176, 107.126], ['C', ' HA ', 197.818, 102.297, 107.996], ['C', ' HB ', 196.56, 102.316, 105.25], ['C', ' HB ', 198.296, 102.376, 105.509], ['C', ' HG ', 198.219, 100.302, 106.742], ['C', ' HG ', 196.477, 100.199, 106.531], ['C', ' HD ', 196.816, 100.172, 104.053], ['C', ' HD ', 198.571, 100.144, 104.325], ['C', ' HE ', 196.61, 98.125, 105.434], ['C', ' HE ', 197.565, 97.872, 103.964], ['C', ' HZ ', 198.547, 96.854, 105.89], ['C', ' HZ ', 199.556, 98.047, 105.321], ['C', ' HZ ', 198.654, 98.292, 106.668]] AA_SCO= 2.3389473684210524 CA_SCO= 1.5422105263157893
[['C', ' N ', 196.556, 105.127, 107.092], ['C', ' CA ', 196.86, 106.557, 107.114], ['C', ' C ', 197.189, 106.981, 108.54], ['C', ' O ', 197.595, 108.119, 108.778], ['C', ' CB ', 195.709, 107.398, 106.58], ['C', ' CG ', 195.468, 107.285, 105.1], ['C', ' CD ', 194.194, 107.977, 104.697], ['C', ' OE1', 193.402, 108.382, 105.553], ['C', ' NE2', 193.985, 108.124, 103.4], ['C', ' H ', 195.582, 104.836, 106.963], ['C', ' HA ', 197.74, 106.738, 106.498], ['C', ' HB ', 194.792, 107.092, 107.089], ['C', ' HB ', 195.88, 108.447, 106.817], ['C', ' HG ', 196.287, 107.798, 104.602], ['C', ' HG ', 195.453, 106.266, 104.777], ['C', ' HE2', 193.155, 108.577, 103.074], ['C', ' HE2', 194.654, 107.779, 102.739]] AA_SCO= 2.3452631578947365 CA_SCO= 1.547
[['C', ' N ', 196.945, 106.077, 109.475], ['C', ' CA ', 197.206, 106.173, 110.876], ['C', ' C ', 198.298, 105.129, 111.058], ['C', ' O ', 198.798, 104.614, 110.062], ['C', ' CB ', 195.972, 105.938, 111.714], ['C', ' H ', 196.619, 105.157, 109.192], ['C', ' HA ', 197.621, 107.156, 111.106], ['C', ' HB ', 196.241, 106.011, 112.747], ['C', ' HB ', 195.245, 106.683, 111.488], ['C', ' HB ', 195.556, 104.957, 111.498]] AA_SCO= 2.386842105263158 CA_SCO= 1.5444736842105262
[['C', ' N ', 198.755, 104.88, 112.279], ['C', ' CA ', 199.89, 103.971, 112.584], ['C', ' C ', 201.15, 104.795, 112.264], ['C', ' O ', 202.011, 104.997, 113.12], ['C', ' CB ', 199.857, 102.613, 111.834], ['C', ' CG1', 201.119, 101.838, 112.163], ['C', ' CG2', 198.593, 101.827, 112.236], ['C', ' H ', 198.315, 105.384, 113.026], ['C', ' HA ', 199.901, 103.754, 113.651], ['C', ' HB ', 199.868, 102.762, 110.772], ['C', ' HG1', 201.107, 100.887, 111.636], ['C', ' HG1', 201.996, 102.406, 111.857], ['C', ' HG1', 201.16, 101.661, 113.239], ['C', ' HG2', 198.579, 100.878, 111.706], ['C', ' HG2', 198.594, 101.639, 113.3], ['C', ' HG2', 197.701, 102.397, 111.967]] AA_SCO= 2.3968421052631577 CA_SCO= 1.499
[['C', ' N ', 201.241, 105.3, 111.033], ['C', ' CA ', 202.216, 106.327, 110.746], ['C', ' C ', 201.416, 107.44, 111.364], ['C', ' O ', 200.308, 107.137, 111.777], ['C', ' CB ', 202.451, 106.556, 109.261], ['C', ' CG ', 201.261, 107.147, 108.491], ['C', ' CD ', 201.613, 107.395, 107.069], ['C', ' OE1', 202.641, 106.914, 106.652], ['C', ' OE2', 200.897, 108.099, 106.397], ['C', ' H ', 200.551, 105.01, 110.34], ['C', ' HA ', 203.147, 106.179, 111.292], ['C', ' HB ', 203.3, 107.223, 109.127], ['C', ' HB ', 202.703, 105.606, 108.789], ['C', ' HG ', 200.424, 106.441, 108.531], ['C', ' HG ', 200.926, 108.078, 108.933]] AA_SCO= 2.3668421052631574 CA_SCO= 1.5006842105263156
[['C', ' N ', 201.856, 108.698, 111.447], ['C', ' CA ', 200.957, 109.613, 112.174], ['C', ' C ', 200.601, 108.876, 113.472], ['C', ' O ', 199.43, 108.604, 113.746], ['C', ' CB ', 199.706, 109.963, 111.359], ['C', ' H ', 202.747, 108.983, 111.068], ['C', ' HA ', 201.498, 110.526, 112.421], ['C', ' HB ', 199.067, 110.621, 111.946], ['C', ' HB ', 200.001, 110.468, 110.441], ['C', ' HB ', 199.137, 109.077, 111.095]] AA_SCO= 2.3005263157894738 CA_SCO= 1.5065789473684208
[['C', ' N ', 201.651, 108.514, 114.223], ['C', ' CA ', 201.659, 107.567, 115.349], ['C', ' C ', 200.673, 107.693, 116.504], ['C', ' O ', 201.065, 107.739, 117.675], ['C', ' H ', 202.548, 108.863, 113.922], ['C', ' HA ', 201.542, 106.568, 114.929], ['C', ' HA ', 202.663, 107.568, 115.769]] AA_SCO= 2.2584210526315793 CA_SCO= 1.5203684210526314
[['C', ' N ', 199.393, 107.612, 116.165], ['C', ' CA ', 198.3, 107.533, 117.106], ['C', ' C ', 198.057, 106.08, 117.457], ['C', ' O ', 197.287, 105.769, 118.359], ['C', ' CB ', 197.031, 108.099, 116.486], ['C', ' CG ', 197.061, 109.572, 116.087], ['C', ' CD1', 195.785, 109.882, 115.401], ['C', ' CD2', 197.25, 110.466, 117.309], ['C', ' H ', 199.177, 107.665, 115.179], ['C', ' HA ', 198.557, 108.071, 118.011], ['C', ' HB ', 196.811, 107.52, 115.588], ['C', ' HB ', 196.212, 107.955, 117.189], ['C', ' HG ', 197.875, 109.748, 115.386], ['C', ' HD1', 195.792, 110.923, 115.091], ['C', ' HD1', 195.692, 109.237, 114.531], ['C', ' HD1', 194.947, 109.709, 116.076], ['C', ' HD2', 197.254, 111.509, 116.991], ['C', ' HD2', 196.433, 110.306, 118.015], ['C', ' HD2', 198.196, 110.246, 117.796]] AA_SCO= 2.2963157894736845 CA_SCO= 1.496736842105263
[['C', ' N ', 198.684, 105.178, 116.708], ['C', ' CA ', 198.558, 103.75, 116.944], ['C', ' C ', 199.883, 103.061, 116.901], ['C', ' O ', 200.778, 103.434, 116.143], ['C', ' CB ', 197.7, 103.004, 115.931], ['C', ' CG ', 196.377, 103.438, 115.855], ['C', ' CD1', 195.924, 104.044, 114.748], ['C', ' CD2', 195.57, 103.302, 116.913], ['C', ' CE1', 194.658, 104.499, 114.697], ['C', ' CE2', 194.325, 103.766, 116.879], ['C', ' CZ ', 193.874, 104.354, 115.77], ['C', ' H ', 199.307, 105.517, 115.994], ['C', ' HA ', 198.136, 103.602, 117.933], ['C', ' HB ', 198.134, 103.098, 114.966], ['C', ' HB ', 197.695, 101.941, 116.182], ['C', ' HD1', 196.586, 104.146, 113.901], ['C', ' HD2', 195.948, 102.822, 117.799], ['C', ' HE1', 194.277, 104.984, 113.801], ['C', ' HE2', 193.686, 103.667, 117.75], ['C', ' HZ ', 192.91, 104.703, 115.746]] AA_SCO= 2.2110526315789474 CA_SCO= 1.2996842105263158
[['C', ' N ', 199.959, 101.981, 117.634], ['C', ' CA ', 201.079, 101.08, 117.525], ['C', ' C ', 200.463, 99.747, 117.207], ['C', ' O ', 199.326, 99.479, 117.604], ['C', ' CB ', 201.953, 101.08, 118.772], ['C', ' CG ', 201.284, 100.734, 120.066], ['C', ' CD ', 202.287, 100.758, 121.189], ['C', ' OE1', 203.439, 100.962, 120.901], ['C', ' OE2', 201.914, 100.583, 122.33], ['C', ' H ', 199.191, 101.789, 118.285], ['C', ' HA ', 201.704, 101.373, 116.68], ['C', ' HB ', 202.774, 100.378, 118.631], ['C', ' HB ', 202.393, 102.071, 118.891], ['C', ' HG ', 200.494, 101.459, 120.27], ['C', ' HG ', 200.827, 99.764, 119.989]] AA_SCO= 2.2115789473684204 CA_SCO= 1.168
[['C', ' N ', 201.172, 98.919, 116.457], ['C', ' CA ', 200.568, 97.669, 116.032], ['C', ' C ', 201.536, 96.514, 115.855], ['C', ' O ', 202.728, 96.717, 115.602], ['C', ' CB ', 199.779, 97.926, 114.743], ['C', ' OG1', 199.085, 96.769, 114.389], ['C', ' CG2', 200.674, 98.324, 113.617], ['C', ' H ', 202.11, 99.162, 116.168], ['C', ' HA ', 199.859, 97.367, 116.789], ['C', ' HB ', 199.061, 98.725, 114.921], ['C', ' HG1', 198.471, 96.543, 115.118], ['C', ' HG2', 200.072, 98.502, 112.727], ['C', ' HG2', 201.208, 99.232, 113.881], ['C', ' HG2', 201.389, 97.529, 113.415]] AA_SCO= 2.248947368421052 CA_SCO= 1.221157894736842
[['C', ' N ', 201.002, 95.303, 116.001], ['C', ' CA ', 201.75, 94.061, 115.853], ['C', ' C ', 200.996, 93.113, 114.906], ['C', ' O ', 199.772, 93.052, 114.952], ['C', ' CB ', 201.849, 93.36, 117.214], ['C', ' CG ', 202.479, 94.15, 118.354], ['C', ' CD ', 203.954, 94.344, 118.183], ['C', ' CE ', 204.552, 95.04, 119.392], ['C', ' NZ ', 206.017, 95.28, 119.224], ['C', ' H ', 199.997, 95.277, 116.2], ['C', ' HA ', 202.732, 94.298, 115.47], ['C', ' HB ', 200.857, 93.07, 117.532], ['C', ' HB ', 202.42, 92.434, 117.1], ['C', ' HG ', 202.006, 95.126, 118.415], ['C', ' HG ', 202.293, 93.631, 119.289], ['C', ' HD ', 204.44, 93.375, 118.043], ['C', ' HD ', 204.143, 94.959, 117.302], ['C', ' HE ', 204.049, 95.997, 119.539], ['C', ' HE ', 204.394, 94.419, 120.275], ['C', ' HZ ', 206.383, 95.743, 120.045], ['C', ' HZ ', 206.492, 94.395, 119.096], ['C', ' HZ ', 206.171, 95.865, 118.412]] AA_SCO= 2.0921052631578942 CA_SCO= 1.259
[['C', ' N ', 201.653, 92.279, 114.095], ['C', ' CA ', 200.987, 91.292, 113.265], ['C', ' C ', 200.183, 90.431, 114.202], ['C', ' O ', 200.701, 90.068, 115.252], ['C', ' CB ', 202.156, 90.514, 112.668], ['C', ' CG ', 203.31, 91.495, 112.692], ['C', ' CD ', 203.111, 92.306, 113.962], ['C', ' HA ', 200.356, 91.774, 112.506], ['C', ' HB ', 202.352, 89.61, 113.267], ['C', ' HB ', 201.895, 90.165, 111.654], ['C', ' HG ', 204.27, 90.939, 112.706], ['C', ' HG ', 203.313, 92.11, 111.783], ['C', ' HD ', 203.597, 91.819, 114.831], ['C', ' HD ', 203.496, 93.313, 113.768]] AA_SCO= 2.1078947368421055 CA_SCO= 1.2562105263157897
[['C', ' N ', 198.988, 90.009, 113.825], ['C', ' CA ', 198.168, 89.217, 114.74], ['C', ' C ', 198.775, 87.869, 115.127], ['C', ' O ', 198.351, 87.241, 116.092], ['C', ' CB ', 196.761, 89.04, 114.181], ['C', ' CG1', 195.718, 88.652, 115.284], ['C', ' CG2', 196.754, 88.008, 113.06], ['C', ' CD1', 195.461, 89.743, 116.335], ['C', ' H ', 198.589, 90.284, 112.917], ['C', ' HA ', 198.098, 89.802, 115.657], ['C', ' HB ', 196.464, 89.978, 113.785], ['C', ' HG1', 194.782, 88.463, 114.799], ['C', ' HG1', 196.024, 87.748, 115.799], ['C', ' HG2', 195.758, 87.933, 112.653], ['C', ' HG2', 197.443, 88.315, 112.273], ['C', ' HG2', 197.054, 87.032, 113.43], ['C', ' HD1', 194.697, 89.4, 117.037], ['C', ' HD1', 196.36, 89.958, 116.896], ['C', ' HD1', 195.12, 90.653, 115.849]] AA_SCO= 2.177894736842105 CA_SCO= 1.263947368421053
[['C', ' N ', 199.701, 87.369, 114.328], ['C', ' CA ', 200.373, 86.116, 114.616], ['C', ' C ', 201.298, 86.219, 115.835], ['C', ' O ', 201.688, 85.2, 116.418], ['C', ' CB ', 201.153, 85.667, 113.392], ['C', ' CG ', 200.259, 85.387, 112.198], ['C', ' CD ', 199.877, 86.635, 111.474], ['C', ' OE1', 200.441, 87.665, 111.785], ['C', ' OE2', 199.019, 86.582, 110.634], ['C', ' H ', 199.984, 87.909, 113.502], ['C', ' HA ', 199.609, 85.369, 114.832], ['C', ' HB ', 201.879, 86.434, 113.119], ['C', ' HB ', 201.705, 84.757, 113.624], ['C', ' HG ', 200.779, 84.721, 111.513], ['C', ' HG ', 199.356, 84.882, 112.543]] AA_SCO= 2.1794736842105267 CA_SCO= 1.3421052631578951
[['C', ' N ', 201.687, 87.442, 116.19], ['C', ' CA ', 202.581, 87.701, 117.302], ['C', ' C ', 201.756, 88.168, 118.488], ['C', ' O ', 200.757, 88.848, 118.292], ['C', ' CB ', 203.591, 88.791, 116.934], ['C', ' CG ', 204.503, 88.456, 115.765], ['C', ' CD ', 205.502, 89.553, 115.486], ['C', ' OE1', 205.569, 90.475, 116.265], ['C', ' OE2', 206.182, 89.477, 114.49], ['C', ' H ', 201.308, 88.253, 115.694], ['C', ' HA ', 203.104, 86.783, 117.568], ['C', ' HB ', 203.05, 89.706, 116.679], ['C', ' HB ', 204.216, 89.011, 117.797], ['C', ' HG ', 205.034, 87.532, 115.98], ['C', ' HG ', 203.89, 88.297, 114.878]] AA_SCO= 2.247894736842105 CA_SCO= 1.3803684210526317
[['C', ' N ', 202.226, 87.877, 119.706], ['C', ' CA ', 201.605, 88.313, 120.968], ['C', ' C ', 200.319, 87.539, 121.246], ['C', ' O ', 199.256, 87.881, 120.747], ['C', ' CB ', 201.294, 89.833, 120.964], ['C', ' CG1', 200.665, 90.22, 122.267], ['C', ' CG2', 202.566, 90.637, 120.704], ['C', ' H ', 203.058, 87.307, 119.755], ['C', ' HA ', 202.306, 88.113, 121.779], ['C', ' HB ', 200.557, 90.059, 120.21], ['C', ' HG1', 200.433, 91.278, 122.233], ['C', ' HG1', 199.759, 89.655, 122.423], ['C', ' HG1', 201.355, 90.02, 123.085], ['C', ' HG2', 202.323, 91.694, 120.707], ['C', ' HG2', 203.294, 90.428, 121.484], ['C', ' HG2', 202.989, 90.373, 119.738]] AA_SCO= 2.2478947368421056 CA_SCO= 1.4225789473684214
[['C', ' N ', 200.409, 86.508, 122.074], ['C', ' CA ', 199.287, 85.598, 122.226], ['C', ' C ', 198.21, 86.182, 123.162], ['C', ' O ', 198.548, 86.981, 124.037], ['C', ' CB ', 199.782, 84.251, 122.751], ['C', ' CG ', 200.85, 83.584, 121.875], ['C', ' CD ', 200.368, 83.267, 120.45], ['C', ' CE ', 201.437, 82.483, 119.687], ['C', ' NZ ', 201.081, 82.265, 118.253], ['C', ' H ', 201.287, 86.318, 122.531], ['C', ' HA ', 198.88, 85.465, 121.244], ['C', ' HB ', 200.206, 84.388, 123.745], ['C', ' HB ', 198.962, 83.557, 122.847], ['C', ' HG ', 201.72, 84.234, 121.812], ['C', ' HG ', 201.158, 82.653, 122.352], ['C', ' HD ', 199.445, 82.69, 120.488], ['C', ' HD ', 200.181, 84.192, 119.9], ['C', ' HE ', 202.377, 83.032, 119.736], ['C', ' HE ', 201.57, 81.513, 120.167], ['C', ' HZ ', 201.82, 81.745, 117.8], ['C', ' HZ ', 200.22, 81.745, 118.188], ['C', ' HZ ', 200.973, 83.17, 117.783]] AA_SCO= 2.262631578947369 CA_SCO= 1.4596842105263161
[['C', ' N ', 196.927, 85.746, 123.06], ['C', ' CA ', 196.305, 84.682, 122.255], ['C', ' C ', 196.48, 84.975, 120.796], ['C', ' O ', 196.539, 86.127, 120.425], ['C', ' CB ', 194.821, 84.802, 122.621], ['C', ' CG ', 194.809, 85.486, 123.957], ['C', ' CD ', 195.968, 86.459, 123.892], ['C', ' HA ', 196.707, 83.701, 122.521], ['C', ' HB ', 194.281, 85.37, 121.847], ['C', ' HB ', 194.369, 83.802, 122.648], ['C', ' HG ', 193.842, 86.008, 124.088], ['C', ' HG ', 194.897, 84.758, 124.773], ['C', ' HD ', 195.663, 87.395, 123.383], ['C', ' HD ', 196.383, 86.653, 124.89]] AA_SCO= 2.2331578947368427 CA_SCO= 1.4574736842105263
[['C', ' N ', 196.609, 83.962, 119.965], ['C', ' CA ', 196.805, 84.283, 118.566], ['C', ' C ', 195.472, 84.424, 117.87], ['C', ' O ', 194.412, 84.298, 118.49], ['C', ' H ', 196.553, 83.003, 120.277], ['C', ' HA ', 197.373, 85.213, 118.471], ['C', ' HA ', 197.391, 83.501, 118.087]] AA_SCO= 2.2500000000000004 CA_SCO= 1.4533157894736841
[['C', ' N ', 195.51, 84.563, 116.549], ['C', ' CA ', 194.294, 84.73, 115.769], ['C', ' C ', 193.355, 83.559, 115.964], ['C', ' O ', 192.136, 83.745, 116.008], ['C', ' CB ', 194.602, 84.873, 114.277], ['C', ' CG ', 193.376, 85.13, 113.333], ['C', ' CD1', 192.669, 86.426, 113.704], ['C', ' CD2', 193.855, 85.188, 111.895], ['C', ' H ', 196.407, 84.618, 116.083], ['C', ' HA ', 193.807, 85.634, 116.125], ['C', ' HB ', 195.291, 85.691, 114.153], ['C', ' HB ', 195.089, 83.96, 113.936], ['C', ' HG ', 192.667, 84.318, 113.431], ['C', ' HD1', 191.842, 86.572, 113.034], ['C', ' HD1', 192.295, 86.391, 114.718], ['C', ' HD1', 193.355, 87.237, 113.601], ['C', ' HD2', 193.0, 85.347, 111.235], ['C', ' HD2', 194.566, 86.001, 111.769], ['C', ' HD2', 194.335, 84.24, 111.639]] AA_SCO= 2.2247368421052633 CA_SCO= 1.4501052631578948
[['C', ' N ', 193.92, 82.37, 116.166], ['C', ' CA ', 193.146, 81.157, 116.321], ['C', ' C ', 192.068, 81.28, 117.392], ['C', ' O ', 191.033, 80.626, 117.284], ['C', ' H ', 194.925, 82.289, 116.131], ['C', ' HA ', 192.693, 80.899, 115.365], ['C', ' HA ', 193.814, 80.336, 116.574]] AA_SCO= 2.2373684210526315 CA_SCO= 1.4463157894736838
[['C', ' N ', 192.271, 82.091, 118.432], ['C', ' CA ', 191.218, 82.187, 119.422], ['C', ' C ', 189.996, 82.854, 118.817], ['C', ' O ', 188.864, 82.503, 119.146], ['C', ' CB ', 191.673, 82.945, 120.666], ['C', ' CG ', 190.618, 83.067, 121.81], ['C', ' CD1', 190.147, 81.688, 122.282], ['C', ' CD2', 191.241, 83.819, 122.96], ['C', ' H ', 193.121, 82.657, 118.529], ['C', ' HA ', 190.953, 81.174, 119.707], ['C', ' HB ', 192.551, 82.449, 121.069], ['C', ' HB ', 191.964, 83.958, 120.367], ['C', ' HG ', 189.757, 83.611, 121.452], ['C', ' HD1', 189.419, 81.818, 123.083], ['C', ' HD1', 189.67, 81.144, 121.473], ['C', ' HD1', 190.996, 81.117, 122.654], ['C', ' HD2', 190.512, 83.931, 123.759], ['C', ' HD2', 192.102, 83.273, 123.333], ['C', ' HD2', 191.554, 84.797, 122.619]] AA_SCO= 2.234210526315789 CA_SCO= 1.4911578947368418
[['C', ' N ', 190.21, 83.838, 117.955], ['C', ' CA ', 189.113, 84.546, 117.342], ['C', ' C ', 188.424, 83.622, 116.385], ['C', ' O ', 187.2, 83.66, 116.26], ['C', ' CB ', 189.596, 85.823, 116.66], ['C', ' CG ', 188.525, 86.707, 115.999], ['C', ' CD1', 187.469, 87.119, 116.997], ['C', ' CD2', 189.196, 87.946, 115.461], ['C', ' H ', 191.16, 84.06, 117.663], ['C', ' HA ', 188.402, 84.792, 118.11], ['C', ' HB ', 190.127, 86.425, 117.396], ['C', ' HB ', 190.304, 85.536, 115.883], ['C', ' HG ', 188.044, 86.159, 115.185], ['C', ' HD1', 186.751, 87.753, 116.502], ['C', ' HD1', 186.948, 86.254, 117.396], ['C', ' HD1', 187.922, 87.667, 117.802], ['C', ' HD2', 188.45, 88.579, 114.983], ['C', ' HD2', 189.66, 88.486, 116.281], ['C', ' HD2', 189.956, 87.672, 114.738]] AA_SCO= 2.254210526315789 CA_SCO= 1.4913684210526312
[['C', ' N ', 189.216, 82.796, 115.712], ['C', ' CA ', 188.682, 81.831, 114.77], ['C', ' C ', 187.781, 80.833, 115.504], ['C', ' O ', 186.802, 80.367, 114.932], ['C', ' CB ', 189.803, 81.093, 114.053], ['C', ' CG ', 190.617, 81.951, 113.092], ['C', ' CD ', 191.798, 81.205, 112.532], ['C', ' OE1', 192.049, 80.13, 113.022], ['C', ' OE2', 192.453, 81.692, 111.639], ['C', ' H ', 190.228, 82.882, 115.864], ['C', ' HA ', 188.083, 82.36, 114.03], ['C', ' HB ', 190.467, 80.659, 114.782], ['C', ' HB ', 189.378, 80.27, 113.479], ['C', ' HG ', 189.975, 82.266, 112.275], ['C', ' HG ', 190.951, 82.835, 113.62]] AA_SCO= 2.214210526315789 CA_SCO= 1.4896315789473682
[['C', ' N ', 188.138, 80.48, 116.755], ['C', ' CA ', 187.316, 79.602, 117.592], ['C', ' C ', 186.038, 80.275, 118.086], ['C', ' O ', 184.986, 79.643, 118.088], ['C', ' CB ', 188.076, 79.109, 118.82], ['C', ' CG ', 189.16, 78.11, 118.555], ['C', ' CD ', 189.86, 77.72, 119.852], ['C', ' CE ', 190.981, 76.725, 119.606], ['C', ' NZ ', 191.695, 76.368, 120.866], ['C', ' H ', 189.032, 80.827, 117.106], ['C', ' HA ', 187.021, 78.742, 116.991], ['C', ' HB ', 188.535, 79.962, 119.316], ['C', ' HB ', 187.371, 78.669, 119.525], ['C', ' HG ', 188.725, 77.223, 118.097], ['C', ' HG ', 189.881, 78.529, 117.863], ['C', ' HD ', 190.278, 78.616, 120.316], ['C', ' HD ', 189.138, 77.28, 120.538], ['C', ' HE ', 190.565, 75.82, 119.167], ['C', ' HE ', 191.695, 77.162, 118.906], ['C', ' HZ ', 192.433, 75.707, 120.66], ['C', ' HZ ', 192.096, 77.201, 121.276], ['C', ' HZ ', 191.046, 75.952, 121.519]] AA_SCO= 2.2699999999999996 CA_SCO= 1.493736842105263
[['C', ' N ', 186.101, 81.56, 118.493], ['C', ' CA ', 184.866, 82.21, 118.955], ['C', ' C ', 183.933, 82.365, 117.769], ['C', ' O ', 182.719, 82.13, 117.866], ['C', ' CB ', 185.141, 83.588, 119.553], ['C', ' CG ', 185.423, 83.646, 121.052], ['C', ' CD1', 186.676, 82.885, 121.4], ['C', ' CD2', 185.567, 85.08, 121.432], ['C', ' H ', 187.008, 82.035, 118.538], ['C', ' HA ', 184.385, 81.573, 119.695], ['C', ' HB ', 186.008, 84.01, 119.038], ['C', ' HB ', 184.283, 84.23, 119.346], ['C', ' HG ', 184.599, 83.191, 121.594], ['C', ' HD1', 186.855, 82.949, 122.472], ['C', ' HD1', 186.584, 81.84, 121.121], ['C', ' HD1', 187.501, 83.328, 120.88], ['C', ' HD2', 185.762, 85.165, 122.499], ['C', ' HD2', 186.389, 85.489, 120.882], ['C', ' HD2', 184.67, 85.622, 121.188]] AA_SCO= 2.296842105263157 CA_SCO= 1.518631578947368
[['C', ' N ', 184.517, 82.739, 116.639], ['C', ' CA ', 183.821, 82.807, 115.388], ['C', ' C ', 183.648, 81.35, 115.111], ['C', ' O ', 184.212, 80.562, 115.834], ['C', ' CB ', 184.602, 83.546, 114.317], ['C', ' H ', 185.512, 82.973, 116.639], ['C', ' HA ', 182.842, 83.269, 115.526], ['C', ' HB ', 184.058, 83.514, 113.376], ['C', ' HB ', 184.746, 84.581, 114.623], ['C', ' HB ', 185.574, 83.068, 114.194]] AA_SCO= 2.3784210526315785 CA_SCO= 1.6974210526315787
[['C', ' N ', 182.793, 80.933, 114.22], ['C', ' CA ', 182.616, 79.489, 113.985], ['C', ' C ', 181.814, 78.854, 115.119], ['C', ' O ', 180.732, 78.349, 114.852], ['C', ' CB ', 183.936, 78.739, 113.791], ['C', ' H ', 182.302, 81.605, 113.653], ['C', ' HA ', 182.051, 79.375, 113.064], ['C', ' HB ', 183.708, 77.701, 113.566], ['C', ' HB ', 184.472, 79.178, 112.954], ['C', ' HB ', 184.589, 78.741, 114.647]] AA_SCO= 2.3736842105263154 CA_SCO= 1.8072631578947365
[['C', ' N ', 182.253, 78.911, 116.384], ['C', ' CA ', 181.377, 78.369, 117.413], ['C', ' C ', 180.097, 79.172, 117.459], ['C', ' O ', 179.009, 78.602, 117.558], ['C', ' CB ', 182.016, 78.417, 118.791], ['C', ' CG ', 183.138, 77.455, 119.026], ['C', ' CD ', 183.791, 77.72, 120.373], ['C', ' OE1', 183.446, 78.702, 121.045], ['C', ' NE2', 184.722, 76.863, 120.774], ['C', ' H ', 183.173, 79.314, 116.623], ['C', ' HA ', 181.133, 77.336, 117.162], ['C', ' HB ', 182.42, 79.422, 118.948], ['C', ' HB ', 181.258, 78.247, 119.55], ['C', ' HG ', 182.728, 76.448, 119.04], ['C', ' HG ', 183.876, 77.538, 118.238], ['C', ' HE2', 185.178, 76.995, 121.656], ['C', ' HE2', 184.969, 76.082, 120.2]] AA_SCO= 2.316315789473684 CA_SCO= 1.8143157894736839
[['C', ' N ', 180.202, 80.496, 117.332], ['C', ' CA ', 179.009, 81.312, 117.342], ['C', ' C ', 178.143, 80.974, 116.146], ['C', ' O ', 176.913, 80.952, 116.245], ['C', ' CB ', 179.355, 82.794, 117.352], ['C', ' CG ', 178.147, 83.707, 117.463], ['C', ' CD ', 178.577, 85.148, 117.603], ['C', ' CE ', 177.437, 86.099, 117.556], ['C', ' NZ ', 176.501, 85.93, 118.691], ['C', ' H ', 181.127, 80.944, 117.303], ['C', ' HA ', 178.441, 81.084, 118.243], ['C', ' HB ', 180.031, 83.008, 118.183], ['C', ' HB ', 179.884, 83.049, 116.429], ['C', ' HG ', 177.534, 83.611, 116.565], ['C', ' HG ', 177.552, 83.412, 118.323], ['C', ' HD ', 179.152, 85.298, 118.517], ['C', ' HD ', 179.175, 85.37, 116.758], ['C', ' HE ', 177.814, 87.111, 117.558], ['C', ' HE ', 176.916, 85.941, 116.635], ['C', ' HZ ', 175.756, 86.59, 118.586], ['C', ' HZ ', 176.119, 84.997, 118.685], ['C', ' HZ ', 176.942, 86.113, 119.605]] AA_SCO= 2.4589473684210525 CA_SCO= 1.8226842105263155
[['C', ' N ', 178.782, 80.724, 115.007], ['C', ' CA ', 178.038, 80.432, 113.801], ['C', ' C ', 177.281, 79.133, 113.957], ['C', ' O ', 176.113, 79.063, 113.585], ['C', ' CB ', 178.967, 80.325, 112.601], ['C', ' CG ', 179.595, 81.627, 112.194], ['C', ' CD ', 180.536, 81.471, 111.017], ['C', ' CE ', 181.2, 82.802, 110.693], ['C', ' NZ ', 182.19, 82.697, 109.584], ['C', ' H ', 179.79, 80.752, 115.007], ['C', ' HA ', 177.316, 81.228, 113.632], ['C', ' HB ', 179.742, 79.606, 112.808], ['C', ' HB ', 178.402, 79.948, 111.746], ['C', ' HG ', 178.822, 82.324, 111.915], ['C', ' HG ', 180.132, 82.048, 113.04], ['C', ' HD ', 181.303, 80.735, 111.239], ['C', ' HD ', 179.976, 81.136, 110.146], ['C', ' HE ', 180.434, 83.528, 110.417], ['C', ' HE ', 181.717, 83.16, 111.584], ['C', ' HZ ', 182.615, 83.614, 109.444], ['C', ' HZ ', 182.936, 82.063, 109.827], ['C', ' HZ ', 181.753, 82.393, 108.732]] AA_SCO= 2.4336842105263155 CA_SCO= 1.8233684210526315
[['C', ' N ', 177.914, 78.123, 114.556], ['C', ' CA ', 177.251, 76.845, 114.739], ['C', ' C ', 176.067, 76.976, 115.665], ['C', ' O ', 175.025, 76.364, 115.424], ['C', ' CB ', 178.206, 75.809, 115.322], ['C', ' CG ', 179.293, 75.331, 114.386], ['C', ' CD ', 180.24, 74.383, 115.063], ['C', ' OE1', 180.098, 74.186, 116.249], ['C', ' OE2', 181.105, 73.858, 114.403], ['C', ' H ', 178.898, 78.226, 114.814], ['C', ' HA ', 176.899, 76.496, 113.766], ['C', ' HB ', 178.697, 76.238, 116.198], ['C', ' HB ', 177.64, 74.941, 115.656], ['C', ' HG ', 178.826, 74.824, 113.542], ['C', ' HG ', 179.839, 76.183, 113.999]] AA_SCO= 2.4431578947368418 CA_SCO= 1.8145789473684213
[['C', ' N ', 176.211, 77.775, 116.723], ['C', ' CA ', 175.114, 77.942, 117.651], ['C', ' C ', 173.954, 78.597, 116.938], ['C', ' O ', 172.804, 78.162, 117.082], ['C', ' CB ', 175.561, 78.795, 118.829], ['C', ' CG ', 176.542, 78.097, 119.751], ['C', ' CD ', 177.047, 79.029, 120.843], ['C', ' CE ', 178.121, 78.357, 121.686], ['C', ' NZ ', 178.69, 79.283, 122.705], ['C', ' H ', 177.122, 78.216, 116.898], ['C', ' HA ', 174.794, 76.963, 118.005], ['C', ' HB ', 176.046, 79.697, 118.453], ['C', ' HB ', 174.694, 79.104, 119.411], ['C', ' HG ', 176.042, 77.249, 120.217], ['C', ' HG ', 177.38, 77.719, 119.178], ['C', ' HD ', 177.466, 79.926, 120.384], ['C', ' HD ', 176.219, 79.322, 121.487], ['C', ' HE ', 177.691, 77.495, 122.192], ['C', ' HE ', 178.926, 78.018, 121.029], ['C', ' HZ ', 179.4, 78.801, 123.237], ['C', ' HZ ', 179.105, 80.081, 122.24], ['C', ' HZ ', 177.959, 79.598, 123.326]] AA_SCO= 2.4468421052631575 CA_SCO= 1.814526315789474
[['C', ' N ', 174.252, 79.608, 116.114], ['C', ' CA ', 173.196, 80.255, 115.382], ['C', ' C ', 172.565, 79.274, 114.422], ['C', ' O ', 171.354, 79.149, 114.385], ['C', ' CB ', 173.732, 81.455, 114.627], ['C', ' H ', 175.213, 79.959, 116.048], ['C', ' HA ', 172.438, 80.582, 116.09], ['C', ' HB ', 172.933, 81.946, 114.085], ['C', ' HB ', 174.172, 82.149, 115.339], ['C', ' HB ', 174.493, 81.124, 113.926]] AA_SCO= 2.4073684210526314 CA_SCO= 1.8097894736842106
[['C', ' N ', 173.352, 78.45, 113.742], ['C', ' CA ', 172.757, 77.534, 112.782], ['C', ' C ', 171.81, 76.558, 113.44], ['C', ' O ', 170.76, 76.231, 112.876], ['C', ' CB ', 173.834, 76.777, 112.023], ['C', ' CG ', 174.608, 77.621, 111.028], ['C', ' CD ', 175.757, 76.879, 110.431], ['C', ' OE1', 176.012, 75.784, 110.875], ['C', ' OE2', 176.383, 77.396, 109.536], ['C', ' H ', 174.368, 78.53, 113.809], ['C', ' HA ', 172.192, 78.119, 112.061], ['C', ' HB ', 174.548, 76.365, 112.736], ['C', ' HB ', 173.387, 75.94, 111.488], ['C', ' HG ', 173.93, 77.914, 110.229], ['C', ' HG ', 174.958, 78.524, 111.505]] AA_SCO= 2.311052631578947 CA_SCO= 1.876
[['C', ' N ', 172.159, 76.083, 114.627], ['C', ' CA ', 171.283, 75.158, 115.315], ['C', ' C ', 169.974, 75.839, 115.678], ['C', ' O ', 168.9, 75.236, 115.552], ['C', ' CB ', 171.977, 74.611, 116.552], ['C', ' CG ', 173.111, 73.662, 116.219], ['C', ' CD ', 173.843, 73.185, 117.454], ['C', ' CE ', 175.006, 72.279, 117.073], ['C', ' NZ ', 175.787, 71.834, 118.261], ['C', ' H ', 173.076, 76.335, 115.015], ['C', ' HA ', 171.057, 74.331, 114.643], ['C', ' HB ', 172.392, 75.444, 117.128], ['C', ' HB ', 171.258, 74.094, 117.183], ['C', ' HG ', 172.703, 72.799, 115.695], ['C', ' HG ', 173.814, 74.158, 115.556], ['C', ' HD ', 174.228, 74.049, 118.0], ['C', ' HD ', 173.159, 72.638, 118.101], ['C', ' HE ', 174.619, 71.402, 116.556], ['C', ' HE ', 175.671, 72.823, 116.398], ['C', ' HZ ', 176.548, 71.239, 117.959], ['C', ' HZ ', 176.163, 72.641, 118.738], ['C', ' HZ ', 175.187, 71.319, 118.89]] AA_SCO= 2.2973684210526315 CA_SCO= 1.869578947368421
[['C', ' N ', 170.053, 77.096, 116.11], ['C', ' CA ', 168.859, 77.821, 116.488], ['C', ' C ', 168.036, 78.231, 115.281], ['C', ' O ', 166.807, 78.212, 115.336], ['C', ' CB ', 169.248, 79.021, 117.299], ['C', ' CG ', 169.738, 78.629, 118.647], ['C', ' OD1', 169.372, 77.577, 119.188], ['C', ' ND2', 170.579, 79.441, 119.207], ['C', ' H ', 170.98, 77.524, 116.248], ['C', ' HA ', 168.239, 77.166, 117.099], ['C', ' HB ', 170.046, 79.56, 116.782], ['C', ' HB ', 168.404, 79.699, 117.402], ['C', ' HD2', 170.956, 79.23, 120.105], ['C', ' HD2', 170.861, 80.291, 118.72]] AA_SCO= 2.2989473684210524 CA_SCO= 1.8738947368421055
[['C', ' N ', 168.697, 78.545, 114.178], ['C', ' CA ', 168.022, 78.955, 112.965], ['C', ' C ', 167.252, 77.765, 112.44], ['C', ' O ', 166.097, 77.89, 112.022], ['C', ' CB ', 169.022, 79.473, 111.913], ['C', ' CG1', 169.664, 80.779, 112.392], ['C', ' CG2', 168.291, 79.754, 110.651], ['C', ' CD1', 170.905, 81.233, 111.649], ['C', ' H ', 169.712, 78.548, 114.22], ['C', ' HA ', 167.319, 79.753, 113.201], ['C', ' HB ', 169.803, 78.736, 111.748], ['C', ' HG1', 168.916, 81.567, 112.293], ['C', ' HG1', 169.915, 80.682, 113.412], ['C', ' HG2', 168.971, 80.127, 109.924], ['C', ' HG2', 167.82, 78.858, 110.267], ['C', ' HG2', 167.537, 80.507, 110.842], ['C', ' HD1', 171.251, 82.175, 112.084], ['C', ' HD1', 171.686, 80.484, 111.753], ['C', ' HD1', 170.702, 81.389, 110.604]] AA_SCO= 2.328421052631579 CA_SCO= 1.8765263157894738
[['C', ' N ', 167.899, 76.608, 112.417], ['C', ' CA ', 167.225, 75.422, 111.959], ['C', ' C ', 166.042, 75.097, 112.854], ['C', ' O ', 164.977, 74.742, 112.346], ['C', ' CB ', 168.185, 74.263, 111.938], ['C', ' H ', 168.876, 76.56, 112.714], ['C', ' HA ', 166.853, 75.608, 110.951], ['C', ' HB ', 167.673, 73.373, 111.577], ['C', ' HB ', 169.024, 74.499, 111.284], ['C', ' HB ', 168.555, 74.089, 112.951]] AA_SCO= 2.3473684210526318 CA_SCO= 1.7639473684210527
[['C', ' N ', 166.19, 75.274, 114.176], ['C', ' CA ', 165.086, 74.99, 115.071], ['C', ' C ', 163.911, 75.899, 114.78], ['C', ' O ', 162.759, 75.464, 114.838], ['C', ' CB ', 165.516, 75.162, 116.506], ['C', ' H ', 167.099, 75.531, 114.573], ['C', ' HA ', 164.777, 73.957, 114.91], ['C', ' HB ', 164.688, 74.921, 117.166], ['C', ' HB ', 166.354, 74.497, 116.71], ['C', ' HB ', 165.824, 76.192, 116.669]] AA_SCO= 2.3742105263157893 CA_SCO= 1.6709473684210525
[['C', ' N ', 164.183, 77.161, 114.456], ['C', ' CA ', 163.087, 78.057, 114.166], ['C', ' C ', 162.306, 77.562, 112.978], ['C', ' O ', 161.069, 77.563, 113.0], ['C', ' CB ', 163.563, 79.443, 113.843], ['C', ' CG ', 164.131, 80.233, 114.965], ['C', ' CD ', 164.516, 81.555, 114.474], ['C', ' NE ', 163.343, 82.292, 114.119], ['C', ' CZ ', 162.631, 82.998, 114.978], ['C', ' NH1', 162.969, 83.115, 116.236], ['C', ' NH2', 161.57, 83.592, 114.562], ['C', ' H ', 165.151, 77.499, 114.489], ['C', ' HA ', 162.432, 78.095, 115.023], ['C', ' HB ', 164.341, 79.366, 113.104], ['C', ' HB ', 162.755, 80.006, 113.391], ['C', ' HG ', 163.381, 80.342, 115.74], ['C', ' HG ', 164.996, 79.749, 115.37], ['C', ' HD ', 165.073, 82.102, 115.229], ['C', ' HD ', 165.134, 81.447, 113.579], ['C', ' HE ', 162.98, 82.273, 113.15], ['C', ' HH1', 163.791, 82.674, 116.602], ['C', ' HH1', 162.371, 83.697, 116.831], ['C', ' HH2', 161.31, 83.497, 113.566], ['C', ' HH2', 161.038, 84.14, 115.246]] AA_SCO= 2.391578947368421 CA_SCO= 1.6195789473684208
[['C', ' N ', 163.018, 77.089, 111.952], ['C', ' CA ', 162.33, 76.583, 110.778], ['C', ' C ', 161.483, 75.367, 111.129], ['C', ' O ', 160.322, 75.269, 110.725], ['C', ' CB ', 163.313, 76.24, 109.661], ['C', ' CG ', 162.642, 75.762, 108.378], ['C', ' CD ', 163.647, 75.562, 107.256], ['C', ' CE ', 162.968, 75.035, 105.997], ['C', ' NZ ', 163.938, 74.831, 104.882], ['C', ' H ', 164.044, 77.163, 111.979], ['C', ' HA ', 161.664, 77.365, 110.413], ['C', ' HB ', 163.906, 77.109, 109.423], ['C', ' HB ', 163.997, 75.463, 110.006], ['C', ' HG ', 162.131, 74.816, 108.564], ['C', ' HG ', 161.899, 76.499, 108.07], ['C', ' HD ', 164.109, 76.517, 107.021], ['C', ' HD ', 164.422, 74.864, 107.573], ['C', ' HE ', 162.486, 74.085, 106.224], ['C', ' HE ', 162.209, 75.749, 105.677], ['C', ' HZ ', 163.447, 74.482, 104.069], ['C', ' HZ ', 164.383, 75.709, 104.653], ['C', ' HZ ', 164.641, 74.161, 105.161]] AA_SCO= 2.388888888888889 CA_SCO= 1.6045555555555557
[['C', ' N ', 162.027, 74.474, 111.952], ['C', ' CA ', 161.334, 73.25, 112.348], ['C', ' C ', 160.037, 73.557, 113.081], ['C', ' O ', 159.037, 72.854, 112.926], ['C', ' CB ', 162.229, 72.402, 113.244], ['C', ' CG ', 163.412, 71.765, 112.544], ['C', ' CD ', 164.345, 71.107, 113.506], ['C', ' OE1', 164.178, 71.323, 114.683], ['C', ' OE2', 165.215, 70.385, 113.079], ['C', ' H ', 162.999, 74.617, 112.253], ['C', ' HA ', 161.096, 72.685, 111.449], ['C', ' HB ', 162.611, 73.018, 114.051], ['C', ' HB ', 161.639, 71.606, 113.696], ['C', ' HG ', 163.044, 71.018, 111.843], ['C', ' HG ', 163.945, 72.517, 111.976]] AA_SCO= 2.474705882352941 CA_SCO= 1.5855294117647056
[['C', ' N ', 160.042, 74.638, 113.848], ['C', ' CA ', 158.892, 75.067, 114.621], ['C', ' C ', 157.888, 75.9, 113.821], ['C', ' O ', 156.871, 76.323, 114.373], ['C', ' CB ', 159.373, 75.863, 115.82], ['C', ' CG ', 160.105, 75.032, 116.848], ['C', ' SD ', 160.52, 75.947, 118.339], ['C', ' CE ', 161.894, 76.959, 117.792], ['C', ' H ', 160.931, 75.141, 113.957], ['C', ' HA ', 158.373, 74.178, 114.972], ['C', ' HB ', 160.052, 76.635, 115.464], ['C', ' HB ', 158.531, 76.358, 116.302], ['C', ' HG ', 159.479, 74.188, 117.127], ['C', ' HG ', 161.022, 74.636, 116.416], ['C', ' HE ', 162.251, 77.567, 118.622], ['C', ' HE ', 162.696, 76.323, 117.436], ['C', ' HE ', 161.566, 77.601, 117.003]] AA_SCO= 2.4587499999999998 CA_SCO= 1.5639999999999998
[['C', ' N ', 158.163, 76.156, 112.539], ['C', ' CA ', 157.262, 76.935, 111.704], ['C', ' C ', 157.343, 78.443, 111.912], ['C', ' O ', 156.372, 79.158, 111.661], ['C', ' H ', 159.01, 75.777, 112.106], ['C', ' HA ', 157.485, 76.709, 110.661], ['C', ' HA ', 156.242, 76.601, 111.881]] AA_SCO= 2.45 CA_SCO= 1.5371333333333332
[['C', ' N ', 158.472, 78.938, 112.389], ['C', ' CA ', 158.615, 80.356, 112.642], ['C', ' C ', 159.264, 81.049, 111.465], ['C', ' O ', 159.89, 80.39, 110.625], ['C', ' CB ', 159.485, 80.554, 113.87], ['C', ' CG ', 158.995, 79.929, 115.154], ['C', ' CD1', 160.057, 80.126, 116.199], ['C', ' CD2', 157.686, 80.576, 115.591], ['C', ' H ', 159.279, 78.33, 112.567], ['C', ' HA ', 157.63, 80.762, 112.808], ['C', ' HB ', 160.455, 80.129, 113.655], ['C', ' HB ', 159.617, 81.611, 114.046], ['C', ' HG ', 158.845, 78.857, 115.011], ['C', ' HD1', 159.736, 79.67, 117.136], ['C', ' HD1', 160.97, 79.663, 115.871], ['C', ' HD1', 160.226, 81.192, 116.35], ['C', ' HD2', 157.357, 80.124, 116.525], ['C', ' HD2', 157.835, 81.65, 115.739], ['C', ' HD2', 156.915, 80.42, 114.843]] AA_SCO= 2.447142857142857 CA_SCO= 1.5323571428571428
[['C', ' N ', 159.073, 82.362, 111.288], ['C', ' CA ', 159.806, 83.103, 110.307], ['C', ' C ', 161.23, 82.796, 110.658], ['C', ' O ', 161.615, 82.915, 111.83], ['C', ' CB ', 159.391, 84.541, 110.592], ['C', ' CG ', 158.0, 84.399, 111.187], ['C', ' CD ', 158.071, 83.136, 112.029], ['C', ' HA ', 159.542, 82.764, 109.294], ['C', ' HB ', 160.103, 85.016, 111.281], ['C', ' HB ', 159.403, 85.13, 109.664], ['C', ' HG ', 157.75, 85.288, 111.775], ['C', ' HG ', 157.249, 84.331, 110.388], ['C', ' HD ', 158.422, 83.365, 113.044], ['C', ' HD ', 157.081, 82.663, 112.019]] AA_SCO= 2.4123076923076923 CA_SCO= 1.5345384615384614
[['C', ' N ', 162.013, 82.445, 109.663], ['C', ' CA ', 163.375, 82.041, 109.912], ['C', ' C ', 164.407, 82.704, 109.031], ['C', ' O ', 164.645, 82.235, 107.92], ['C', ' CB ', 163.481, 80.522, 109.778], ['C', ' OG1', 162.545, 79.91, 110.676], ['C', ' CG2', 164.868, 80.073, 110.14], ['C', ' H ', 161.64, 82.398, 108.723], ['C', ' HA ', 163.614, 82.265, 110.948], ['C', ' HB ', 163.25, 80.22, 108.757], ['C', ' HG1', 161.611, 80.127, 110.419], ['C', ' HG2', 164.935, 79.005, 110.059], ['C', ' HG2', 165.6, 80.518, 109.478], ['C', ' HG2', 165.09, 80.369, 111.157]] AA_SCO= 2.4408333333333334 CA_SCO= 1.4983333333333333
[['C', ' N ', 164.918, 83.869, 109.412], ['C', ' CA ', 165.975, 84.564, 108.735], ['C', ' C ', 167.193, 83.674, 108.915], ['C', ' O ', 167.263, 82.992, 109.943], ['C', ' CB ', 166.088, 85.865, 109.516], ['C', ' CG ', 164.783, 85.963, 110.255], ['C', ' CD ', 164.406, 84.574, 110.573], ['C', ' HA ', 165.706, 84.724, 107.677], ['C', ' HB ', 166.964, 85.83, 110.18], ['C', ' HB ', 166.247, 86.707, 108.822], ['C', ' HG ', 164.896, 86.613, 111.122], ['C', ' HG ', 164.021, 86.423, 109.62], ['C', ' HD ', 164.907, 84.23, 111.491], ['C', ' HD ', 163.327, 84.546, 110.65]] AA_SCO= 2.4145454545454546 CA_SCO= 1.4595454545454545
[['C', ' N ', 168.138, 83.708, 107.967], ['C', ' CA ', 169.415, 82.963, 108.005], ['C', ' C ', 170.624, 83.917, 108.036], ['C', ' O ', 170.507, 85.065, 108.469], ['C', ' OXT', 171.756, 83.423, 107.972], ['C', ' CB ', 169.493, 81.94, 106.813], ['C', ' CG ', 168.547, 80.685, 106.952], ['C', ' CD1', 167.09, 80.762, 106.676], ['C', ' CD2', 169.112, 79.364, 107.354], ['C', ' CE1', 166.232, 79.576, 106.823], ['C', ' CE2', 168.252, 78.182, 107.496], ['C', ' CZ ', 166.814, 78.292, 107.236], ['C', ' H ', 167.984, 84.304, 107.167], ['C', ' HA ', 169.462, 82.389, 108.929], ['C', ' HB ', 169.253, 82.442, 105.874], ['C', ' HB ', 170.524, 81.58, 106.704], ['C', ' HD1', 166.646, 81.712, 106.379], ['C', ' HD2', 170.181, 79.285, 107.556], ['C', ' HE1', 165.161, 79.662, 106.633], ['C', ' HE2', 168.68, 77.225, 107.802], ['C', ' HZ ', 166.184, 77.422, 107.351]] AA_SCO= 2.401 CA_SCO= 1.4128
[['B', ' N ', 145.2, 100.621, 69.368], ['B', ' CA ', 145.368, 100.212, 70.775], ['B', ' C ', 145.026, 101.428, 71.689], ['B', ' O ', 145.19, 102.544, 71.198], ['B', ' CB ', 146.822, 99.703, 71.016], ['B', ' CG ', 147.23, 98.353, 70.244], ['B', ' CD ', 148.751, 97.944, 70.501], ['B', ' CE ', 149.204, 96.622, 69.728], ['B', ' NZ ', 148.617, 95.362, 70.319], ['B', ' H ', 145.976, 100.286, 68.816], ['B', ' H ', 144.338, 100.245, 68.998], ['B', ' H ', 145.172, 101.636, 69.325], ['B', ' HA ', 144.669, 99.39, 70.96], ['B', ' HB ', 147.551, 100.491, 70.737], ['B', ' HB ', 146.985, 99.513, 72.085], ['B', ' HG ', 146.577, 97.54, 70.587], ['B', ' HG ', 147.077, 98.475, 69.163], ['B', ' HD ', 149.399, 98.758, 70.162], ['B', ' HD ', 148.932, 97.807, 71.58], ['B', ' HE ', 148.899, 96.696, 68.682], ['B', ' HE ', 150.294, 96.545, 69.771], ['B', ' HZ ', 148.94, 94.561, 69.804], ['B', ' HZ ', 148.938, 95.285, 71.303], ['B', ' HZ ', 147.615, 95.398, 70.292]]
[['B', ' N ', 144.516, 101.247, 72.971], ['B', ' CA ', 144.144, 102.294, 73.944], ['B', ' C ', 145.322, 102.999, 74.613], ['B', ' O ', 146.466, 102.525, 74.549], ['B', ' CB ', 143.316, 101.52, 74.981], ['B', ' CG ', 143.848, 100.118, 74.968], ['B', ' CD ', 144.203, 99.842, 73.525], ['B', ' HA ', 143.506, 103.043, 73.442], ['B', ' HB ', 143.44, 101.989, 75.98], ['B', ' HB ', 142.248, 101.578, 74.739], ['B', ' HG ', 144.693, 100.046, 75.665], ['B', ' HG ', 143.072, 99.438, 75.36], ['B', ' HD ', 145.078, 99.173, 73.485], ['B', ' HD ', 143.328, 99.402, 73.015]]
[['B', ' N ', 145.024, 104.12, 75.264], ['B', ' CA ', 146.0, 104.831, 76.069], ['B', ' C ', 146.231, 104.119, 77.366], ['B', ' O ', 145.743, 102.995, 77.414], ['B', ' CB ', 145.519, 106.242, 76.332], ['B', ' CG ', 144.314, 106.332, 77.189], ['B', ' CD ', 143.828, 107.717, 77.334], ['B', ' NE ', 142.627, 107.717, 78.132], ['B', ' CZ ', 142.602, 107.734, 79.476], ['B', ' NH1', 143.707, 107.797, 80.175], ['B', ' NH2', 141.462, 107.67, 80.127], ['B', ' H ', 144.075, 104.473, 75.204], ['B', ' HA ', 146.952, 104.85, 75.566], ['B', ' HB ', 146.312, 106.811, 76.813], ['B', ' HB ', 145.261, 106.727, 75.396], ['B', ' HG ', 143.512, 105.748, 76.741], ['B', ' HG ', 144.533, 105.935, 78.177], ['B', ' HD ', 144.576, 108.349, 77.804], ['B', ' HD ', 143.582, 108.117, 76.343], ['B', ' HE ', 141.74, 107.662, 77.643], ['B', ' HH1', 144.603, 107.842, 79.732], ['B', ' HH1', 143.629, 107.796, 81.2], ['B', ' HH2', 140.587, 107.609, 79.632], ['B', ' HH2', 141.504, 107.648, 81.155]]
[['B', ' N ', 147.476, 104.304, 77.75], ['B', ' CA ', 147.815, 104.266, 79.147], ['B', ' C ', 149.149, 104.949, 79.363], ['B', ' O ', 149.987, 104.956, 78.47], ['B', ' CB ', 147.838, 102.779, 79.605], ['B', ' CG1', 148.031, 102.615, 81.072], ['B', ' CG2', 148.87, 101.994, 78.854], ['B', ' CD1', 146.883, 103.025, 81.909], ['B', ' H ', 148.132, 103.746, 77.236], ['B', ' HA ', 147.053, 104.807, 79.701], ['B', ' HB ', 146.87, 102.334, 79.395], ['B', ' HG1', 148.209, 101.578, 81.234], ['B', ' HG1', 148.903, 103.145, 81.394], ['B', ' HG2', 148.824, 100.955, 79.162], ['B', ' HG2', 148.67, 102.046, 77.807], ['B', ' HG2', 149.861, 102.394, 79.059], ['B', ' HD1', 147.112, 102.814, 82.949], ['B', ' HD1', 146.671, 104.081, 81.805], ['B', ' HD1', 146.012, 102.452, 81.609]]
[['B', ' N ', 149.346, 105.566, 80.51], ['B', ' CA ', 150.663, 106.091, 80.808], ['B', ' C ', 151.408, 105.062, 81.643], ['B', ' O ', 150.775, 104.381, 82.441], ['B', ' H ', 148.615, 105.596, 81.207], ['B', ' HA ', 151.203, 106.309, 79.906], ['B', ' HA ', 150.545, 107.006, 81.372]]
[['B', ' N ', 152.73, 104.924, 81.491], ['B', ' CA ', 153.479, 104.015, 82.345], ['B', ' C ', 154.176, 104.719, 83.469], ['B', ' O ', 155.276, 104.242, 83.759], ['B', ' CB ', 154.372, 103.094, 81.568], ['B', ' CG ', 153.649, 101.871, 80.975], ['B', ' CD1', 152.248, 101.716, 80.901], ['B', ' CD2', 154.42, 100.852, 80.584], ['B', ' CE1', 151.734, 100.568, 80.382], ['B', ' CE2', 153.899, 99.737, 80.095], ['B', ' CZ ', 152.576, 99.595, 79.965], ['B', ' OH ', 152.091, 98.481, 79.415], ['B', ' H ', 153.255, 105.494, 80.835], ['B', ' HA ', 152.764, 103.364, 82.843], ['B', ' HB ', 154.77, 103.667, 80.737], ['B', ' HB ', 155.218, 102.77, 82.143], ['B', ' HD1', 151.562, 102.466, 81.221], ['B', ' HD2', 155.487, 100.939, 80.667], ['B', ' HE1', 150.669, 100.435, 80.299], ['B', ' HE2', 154.553, 98.955, 79.801], ['B', ' HH ', 152.837, 97.899, 79.205]]
[['B', ' N ', 154.031, 106.027, 83.358], ['B', ' CA ', 154.001, 106.648, 84.657], ['B', ' C ', 152.509, 106.716, 84.83], ['B', ' O ', 151.857, 107.595, 84.261], ['B', ' CB ', 154.599, 108.07, 84.698], ['B', ' CG1', 156.037, 108.093, 84.116], ['B', ' CG2', 154.544, 108.634, 86.117], ['B', ' CD1', 157.06, 107.18, 84.782], ['B', ' H ', 154.63, 106.464, 82.663], ['B', ' HA ', 154.427, 106.003, 85.426], ['B', ' HB ', 154.004, 108.723, 84.078], ['B', ' HG1', 155.984, 107.827, 83.068], ['B', ' HG1', 156.4, 109.11, 84.19], ['B', ' HG2', 154.936, 109.65, 86.122], ['B', ' HG2', 153.51, 108.65, 86.472], ['B', ' HG2', 155.132, 108.018, 86.794], ['B', ' HD1', 158.021, 107.3, 84.283], ['B', ' HD1', 157.173, 107.436, 85.833], ['B', ' HD1', 156.745, 106.141, 84.697]]
[['B', ' N ', 151.952, 105.783, 85.574], ['B', ' CA ', 150.515, 105.72, 85.611], ['B', ' C ', 150.014, 106.256, 86.91], ['B', ' O ', 150.231, 105.674, 87.978], ['B', ' CB ', 149.968, 104.315, 85.504], ['B', ' CG ', 148.486, 104.325, 85.404], ['B', ' ND1', 147.696, 103.326, 85.916], ['B', ' CD2', 147.639, 105.215, 84.831], ['B', ' CE1', 146.427, 103.613, 85.671], ['B', ' NE2', 146.376, 104.747, 85.016], ['B', ' H ', 152.527, 105.09, 86.059], ['B', ' HA ', 150.101, 106.317, 84.805], ['B', ' HB ', 150.401, 103.79, 84.677], ['B', ' HB ', 150.22, 103.78, 86.398], ['B', ' HD2', 147.893, 106.136, 84.312], ['B', ' HE1', 145.567, 103.029, 85.94], ['B', ' HE2', 145.509, 105.215, 84.679]]
[['B', ' N ', 149.337, 107.366, 86.845], ['B', ' CA ', 148.885, 107.982, 88.052], ['B', ' C ', 147.462, 107.599, 88.39], ['B', ' O ', 146.542, 107.843, 87.61], ['B', ' CB ', 149.055, 109.485, 87.885], ['B', ' CG ', 148.592, 110.389, 88.995], ['B', ' CD1', 149.351, 110.145, 90.25], ['B', ' CD2', 148.815, 111.793, 88.546], ['B', ' H ', 149.168, 107.801, 85.948], ['B', ' HA ', 149.517, 107.652, 88.851], ['B', ' HB ', 150.117, 109.685, 87.725], ['B', ' HB ', 148.523, 109.784, 86.983], ['B', ' HG ', 147.551, 110.223, 89.204], ['B', ' HD1', 148.989, 110.833, 91.01], ['B', ' HD1', 149.216, 109.135, 90.608], ['B', ' HD1', 150.412, 110.321, 90.09], ['B', ' HD2', 148.509, 112.439, 89.311], ['B', ' HD2', 149.877, 111.958, 88.341], ['B', ' HD2', 148.242, 111.982, 87.647]]
[['B', ' N ', 147.283, 106.975, 89.558], ['B', ' CA ', 145.96, 106.577, 90.02], ['B', ' C ', 145.596, 107.422, 91.239], ['B', ' O ', 144.438, 107.512, 91.638], ['B', ' CB ', 145.892, 105.093, 90.332], ['B', ' OG ', 146.114, 104.331, 89.193], ['B', ' H ', 148.076, 106.752, 90.139], ['B', ' HA ', 145.234, 106.785, 89.234], ['B', ' HB ', 146.623, 104.835, 91.06], ['B', ' HB ', 144.918, 104.858, 90.751], ['B', ' HG ', 145.857, 103.441, 89.424]]
[['B', ' N ', 146.596, 108.113, 91.766], ['B', ' CA ', 146.502, 108.982, 92.92], ['B', ' C ', 147.909, 109.201, 93.493], ['B', ' O ', 148.78, 108.356, 93.32], ['B', ' H ', 147.515, 107.977, 91.392], ['B', ' HA ', 146.057, 109.934, 92.634], ['B', ' HA ', 145.86, 108.524, 93.671]]
[['B', ' N ', 148.093, 110.335, 94.191], ['B', ' CA ', 149.336, 110.792, 94.85], ['B', ' C ', 150.447, 111.174, 93.876], ['B', ' O ', 150.61, 110.573, 92.827], ['B', ' CB ', 149.894, 109.717, 95.769], ['B', ' SG ', 148.83, 109.262, 97.152], ['B', ' H ', 147.299, 110.952, 94.243], ['B', ' HA ', 149.092, 111.668, 95.454], ['B', ' HB ', 150.141, 108.812, 95.214], ['B', ' HB ', 150.811, 110.093, 96.173], ['B', ' HG ', 149.567, 108.215, 97.572]]
[['B', ' N ', 151.258, 112.16, 94.243], ['B', ' CA ', 152.362, 112.561, 93.367], ['B', ' C ', 153.778, 112.519, 93.945], ['B', ' O ', 154.714, 112.824, 93.235], ['B', ' CB ', 152.089, 113.928, 92.769], ['B', ' OG1', 151.9, 114.878, 93.825], ['B', ' CG2', 150.846, 113.855, 91.876], ['B', ' H ', 151.079, 112.651, 95.105], ['B', ' HA ', 152.371, 111.868, 92.524], ['B', ' HB ', 152.942, 114.236, 92.159], ['B', ' HG1', 151.753, 115.751, 93.413], ['B', ' HG2', 150.666, 114.827, 91.428], ['B', ' HG2', 151.013, 113.125, 91.082], ['B', ' HG2', 149.978, 113.562, 92.449]]
[['B', ' N ', 153.977, 112.099, 95.198], ['B', ' CA ', 155.346, 112.095, 95.79], ['B', ' C ', 156.211, 110.968, 95.236], ['B', ' O ', 157.442, 110.942, 95.357], ['B', ' H ', 153.182, 111.83, 95.755], ['B', ' HA ', 155.84, 113.046, 95.592], ['B', ' HA ', 155.271, 111.992, 96.872]]
[['B', ' N ', 155.549, 110.065, 94.568], ['B', ' CA ', 156.147, 108.909, 93.971], ['B', ' C ', 156.63, 109.28, 92.581], ['B', ' O ', 157.329, 108.527, 91.915], ['B', ' CB ', 155.087, 107.84, 93.965], ['B', ' CG ', 154.702, 107.414, 95.38], ['B', ' OD1', 155.55, 107.167, 96.188], ['B', ' OD2', 153.536, 107.411, 95.649], ['B', ' H ', 154.549, 110.174, 94.506], ['B', ' HA ', 156.996, 108.587, 94.557], ['B', ' HB ', 154.194, 108.23, 93.488], ['B', ' HB ', 155.418, 107.0, 93.382]]
[['B', ' N ', 156.279, 110.486, 92.169], ['B', ' CA ', 156.65, 111.073, 90.913], ['B', ' C ', 157.487, 112.264, 91.297], ['B', ' O ', 157.397, 112.75, 92.415], ['B', ' CB ', 155.436, 111.472, 90.096], ['B', ' H ', 155.718, 111.08, 92.774], ['B', ' HA ', 157.261, 110.37, 90.349], ['B', ' HB ', 155.754, 111.943, 89.169], ['B', ' HB ', 154.846, 110.583, 89.869], ['B', ' HB ', 154.828, 112.175, 90.67]]
[['B', ' N ', 158.355, 112.721, 90.424], ['B', ' CA ', 159.175, 113.883, 90.766], ['B', ' C ', 159.929, 113.649, 92.069], ['B', ' O ', 160.067, 114.541, 92.903], ['B', ' CB ', 158.324, 115.144, 90.85], ['B', ' CG ', 157.63, 115.455, 89.558], ['B', ' SD ', 158.795, 115.669, 88.212], ['B', ' CE ', 157.723, 115.973, 86.883], ['B', ' H ', 158.424, 112.299, 89.509], ['B', ' HA ', 159.911, 114.015, 89.983], ['B', ' HB ', 157.576, 115.054, 91.635], ['B', ' HB ', 158.96, 115.995, 91.103], ['B', ' HG ', 156.941, 114.65, 89.308], ['B', ' HG ', 157.051, 116.374, 89.67], ['B', ' HE ', 158.296, 116.135, 85.976], ['B', ' HE ', 157.06, 115.122, 86.747], ['B', ' HE ', 157.131, 116.859, 87.102]]
[['B', ' N ', 160.424, 112.426, 92.184], ['B', ' CA ', 161.224, 111.877, 93.252], ['B', ' C ', 162.192, 111.024, 92.476], ['B', ' O ', 163.363, 110.886, 92.796], ['B', ' CB ', 160.324, 111.206, 94.256], ['B', ' OG ', 159.559, 110.193, 93.711], ['B', ' H ', 160.238, 111.786, 91.434], ['B', ' HA ', 161.772, 112.672, 93.759], ['B', ' HB ', 160.912, 110.813, 95.088], ['B', ' HB ', 159.656, 111.964, 94.652], ['B', ' HG ', 158.741, 110.205, 94.303]]
[['B', ' N ', 161.723, 110.613, 91.302], ['B', ' CA ', 162.534, 109.926, 90.298], ['B', ' C ', 163.579, 110.922, 89.807], ['B', ' O ', 164.754, 110.612, 89.621], ['B', ' CB ', 161.65, 109.446, 89.132], ['B', ' CG ', 162.341, 108.657, 87.978], ['B', ' CD1', 161.332, 107.65, 87.383], ['B', ' CD2', 162.808, 109.623, 86.863], ['B', ' H ', 160.734, 110.732, 91.138], ['B', ' HA ', 163.04, 109.078, 90.758], ['B', ' HB ', 160.871, 108.805, 89.544], ['B', ' HB ', 161.172, 110.315, 88.685], ['B', ' HG ', 163.201, 108.118, 88.362], ['B', ' HD1', 161.808, 107.089, 86.577], ['B', ' HD1', 161.003, 106.956, 88.151], ['B', ' HD1', 160.468, 108.183, 86.987], ['B', ' HD2', 163.277, 109.042, 86.069], ['B', ' HD2', 161.949, 110.159, 86.46], ['B', ' HD2', 163.525, 110.337, 87.224]]
[['B', ' N ', 163.134, 112.156, 89.627], ['B', ' CA ', 163.903, 113.255, 89.09], ['B', ' C ', 164.907, 113.788, 90.104], ['B', ' O ', 165.722, 114.658, 89.803], ['B', ' CB ', 162.972, 114.375, 88.606], ['B', ' OG1', 162.179, 114.825, 89.692], ['B', ' CG2', 162.08, 113.852, 87.489], ['B', ' H ', 162.174, 112.356, 89.846], ['B', ' HA ', 164.461, 112.886, 88.229], ['B', ' HB ', 163.551, 115.207, 88.237], ['B', ' HG1', 161.69, 115.617, 89.424], ['B', ' HG2', 161.427, 114.648, 87.144], ['B', ' HG2', 162.704, 113.514, 86.663], ['B', ' HG2', 161.479, 113.021, 87.848]]
[['B', ' N ', 164.93, 113.237, 91.311], ['B', ' CA ', 165.901, 113.694, 92.275], ['B', ' C ', 167.201, 112.926, 92.087], ['B', ' O ', 168.156, 113.079, 92.841], ['B', ' CB ', 165.381, 113.663, 93.69], ['B', ' CG ', 164.295, 114.694, 93.945], ['B', ' CD ', 163.894, 114.677, 95.34], ['B', ' OE1', 164.351, 113.782, 96.0], ['B', ' OE2', 163.145, 115.51, 95.772], ['B', ' H ', 164.297, 112.483, 91.589], ['B', ' HA ', 166.116, 114.74, 92.067], ['B', ' HB ', 164.957, 112.687, 93.905], ['B', ' HB ', 166.198, 113.838, 94.389], ['B', ' HG ', 164.668, 115.685, 93.693], ['B', ' HG ', 163.435, 114.484, 93.308]]
[['B', ' N ', 167.263, 112.135, 91.014], ['B', ' CA ', 168.5, 111.499, 90.617], ['B', ' C ', 169.443, 112.609, 90.169], ['B', ' O ', 170.66, 112.429, 90.079], ['B', ' CB ', 168.258, 110.527, 89.502], ['B', ' CG ', 167.642, 109.33, 89.976], ['B', ' OD1', 167.939, 108.911, 91.085], ['B', ' ND2', 166.779, 108.758, 89.201], ['B', ' H ', 166.417, 111.951, 90.47], ['B', ' HA ', 168.948, 110.997, 91.475], ['B', ' HB ', 167.621, 110.984, 88.74], ['B', ' HB ', 169.188, 110.28, 89.049], ['B', ' HD2', 166.302, 107.935, 89.503], ['B', ' HD2', 166.565, 109.156, 88.312]]
[['B', ' N ', 168.855, 113.734, 89.769], ['B', ' CA ', 169.526, 114.955, 89.386], ['B', ' C ', 170.565, 114.836, 88.308], ['B', ' O ', 170.315, 115.136, 87.139], ['B', ' CB ', 170.17, 115.612, 90.624], ['B', ' CG ', 169.172, 116.173, 91.618], ['B', ' CD1', 169.109, 115.759, 92.953], ['B', ' CD2', 168.309, 117.099, 91.186], ['B', ' CE1', 168.143, 116.315, 93.804], ['B', ' CE2', 167.405, 117.621, 91.994], ['B', ' CZ ', 167.287, 117.263, 93.273], ['B', ' OH ', 166.298, 117.898, 93.985], ['B', ' H ', 167.837, 113.792, 89.835], ['B', ' HA ', 168.768, 115.63, 89.013], ['B', ' HB ', 170.791, 114.889, 91.15], ['B', ' HB ', 170.824, 116.426, 90.302], ['B', ' HD1', 169.801, 115.002, 93.328], ['B', ' HD2', 168.339, 117.435, 90.172], ['B', ' HE1', 168.068, 116.007, 94.846], ['B', ' HE2', 166.749, 118.352, 91.609], ['B', ' HH ', 166.166, 117.548, 94.878]]
[['B', ' N ', 171.709, 114.295, 88.694], ['B', ' CA ', 172.908, 114.244, 87.879], ['B', ' C ', 172.719, 113.389, 86.665], ['B', ' O ', 173.318, 113.625, 85.616], ['B', ' CB ', 174.066, 113.707, 88.707], ['B', ' CG ', 174.555, 114.693, 89.803], ['B', ' OD1', 174.194, 115.869, 89.791], ['B', ' OD2', 175.292, 114.254, 90.65], ['B', ' H ', 171.737, 113.924, 89.639], ['B', ' HA ', 173.146, 115.256, 87.551], ['B', ' HB ', 173.753, 112.78, 89.192], ['B', ' HB ', 174.9, 113.464, 88.049]]
[['B', ' N ', 171.882, 112.385, 86.802], ['B', ' CA ', 171.638, 111.514, 85.676], ['B', ' C ', 170.206, 111.56, 85.208], ['B', ' O ', 169.799, 110.65, 84.492], ['B', ' CB ', 171.951, 110.04, 85.991], ['B', ' CG1', 171.025, 109.535, 87.138], ['B', ' CG2', 173.42, 109.932, 86.372], ['B', ' CD1', 171.003, 108.033, 87.346], ['B', ' H ', 171.443, 112.242, 87.719], ['B', ' HA ', 172.27, 111.826, 84.846], ['B', ' HB ', 171.761, 109.426, 85.11], ['B', ' HG1', 171.345, 110.002, 88.069], ['B', ' HG1', 170.004, 109.83, 86.929], ['B', ' HG2', 173.681, 108.902, 86.584], ['B', ' HG2', 174.028, 110.292, 85.543], ['B', ' HG2', 173.616, 110.54, 87.252], ['B', ' HD1', 170.322, 107.799, 88.164], ['B', ' HD1', 170.654, 107.548, 86.43], ['B', ' HD1', 171.995, 107.669, 87.593]]
[['B', ' N ', 169.377, 112.525, 85.621], ['B', ' CA ', 168.004, 112.305, 85.186], ['B', ' C ', 167.87, 112.641, 83.715], ['B', ' O ', 167.071, 112.029, 83.008], ['B', ' CB ', 166.973, 113.092, 85.999], ['B', ' CG ', 166.753, 114.568, 85.703], ['B', ' CD1', 165.604, 114.702, 84.692], ['B', ' CD2', 166.392, 115.262, 86.909], ['B', ' H ', 169.68, 113.337, 86.174], ['B', ' HA ', 167.767, 111.254, 85.324], ['B', ' HB ', 166.013, 112.591, 85.896], ['B', ' HB ', 167.268, 113.026, 87.049], ['B', ' HG ', 167.654, 115.018, 85.298], ['B', ' HD1', 165.432, 115.73, 84.525], ['B', ' HD1', 165.8, 114.223, 83.75], ['B', ' HD1', 164.709, 114.263, 85.125], ['B', ' HD2', 166.217, 116.308, 86.684], ['B', ' HD2', 165.513, 114.83, 87.289], ['B', ' HD2', 167.173, 115.174, 87.623]]
[['B', ' N ', 168.659, 113.604, 83.217], ['B', ' CA ', 168.513, 113.981, 81.822], ['B', ' C ', 168.82, 112.783, 80.952], ['B', ' O ', 168.129, 112.522, 79.969], ['B', ' CB ', 169.445, 115.135, 81.47], ['B', ' H ', 169.333, 114.072, 83.81], ['B', ' HA ', 167.48, 114.276, 81.649], ['B', ' HB ', 169.312, 115.403, 80.421], ['B', ' HB ', 169.231, 115.994, 82.088], ['B', ' HB ', 170.478, 114.834, 81.635]]
[['B', ' N ', 169.823, 112.008, 81.353], ['B', ' CA ', 170.19, 110.825, 80.605], ['B', ' C ', 169.215, 109.694, 80.852], ['B', ' O ', 168.776, 108.999, 79.921], ['B', ' CB ', 171.586, 110.377, 81.014], ['B', ' CG ', 172.668, 111.322, 80.602], ['B', ' CD ', 172.771, 111.42, 79.12], ['B', ' OE1', 172.886, 110.394, 78.487], ['B', ' OE2', 172.709, 112.508, 78.606], ['B', ' H ', 170.36, 112.28, 82.163], ['B', ' HA ', 170.184, 111.069, 79.542], ['B', ' HB ', 171.626, 110.267, 82.103], ['B', ' HB ', 171.796, 109.398, 80.578], ['B', ' HG ', 172.456, 112.31, 81.009], ['B', ' HG ', 173.617, 110.981, 81.013]]
[['B', ' N ', 168.753, 109.564, 82.095], ['B', ' CA ', 167.894, 108.455, 82.432], ['B', ' C ', 166.604, 108.536, 81.654], ['B', ' O ', 166.127, 107.536, 81.122], ['B', ' CB ', 167.601, 108.428, 83.937], ['B', ' CG ', 166.762, 107.234, 84.489], ['B', ' CD1', 167.493, 105.899, 84.21], ['B', ' CD2', 166.544, 107.441, 86.006], ['B', ' H ', 169.078, 110.171, 82.848], ['B', ' HA ', 168.42, 107.562, 82.177], ['B', ' HB ', 168.551, 108.44, 84.469], ['B', ' HB ', 167.063, 109.34, 84.185], ['B', ' HG ', 165.791, 107.199, 83.981], ['B', ' HD1', 166.906, 105.084, 84.592], ['B', ' HD1', 167.627, 105.756, 83.149], ['B', ' HD1', 168.468, 105.906, 84.702], ['B', ' HD2', 165.949, 106.621, 86.412], ['B', ' HD2', 167.51, 107.472, 86.515], ['B', ' HD2', 166.017, 108.384, 86.167]]
[['B', ' N ', 166.074, 109.747, 81.505], ['B', ' CA ', 164.824, 109.966, 80.797], ['B', ' C ', 164.994, 110.275, 79.309], ['B', ' O ', 164.013, 110.621, 78.646], ['B', ' CB ', 164.038, 111.106, 81.467], ['B', ' CG ', 163.552, 110.868, 82.943], ['B', ' CD1', 162.9, 112.148, 83.465], ['B', ' CD2', 162.535, 109.71, 82.989], ['B', ' H ', 166.522, 110.548, 81.965], ['B', ' HA ', 164.243, 109.048, 80.853], ['B', ' HB ', 164.685, 111.988, 81.478], ['B', ' HB ', 163.166, 111.331, 80.858], ['B', ' HG ', 164.411, 110.636, 83.579], ['B', ' HD1', 162.572, 112.0, 84.494], ['B', ' HD1', 163.628, 112.947, 83.428], ['B', ' HD1', 162.043, 112.404, 82.844], ['B', ' HD2', 162.19, 109.562, 84.003], ['B', ' HD2', 161.688, 109.959, 82.355], ['B', ' HD2', 162.988, 108.788, 82.639]]
[['B', ' N ', 166.22, 110.201, 78.786], ['B', ' CA ', 166.445, 110.491, 77.372], ['B', ' C ', 167.061, 109.31, 76.637], ['B', ' O ', 166.548, 108.88, 75.604], ['B', ' CB ', 167.381, 111.705, 77.146], ['B', ' OG1', 166.832, 112.877, 77.75], ['B', ' CG2', 167.537, 111.965, 75.653], ['B', ' H ', 166.994, 109.883, 79.362], ['B', ' HA ', 165.488, 110.71, 76.906], ['B', ' HB ', 168.362, 111.503, 77.58], ['B', ' HG1', 167.01, 112.818, 78.712], ['B', ' HG2', 168.191, 112.821, 75.508], ['B', ' HG2', 167.966, 111.106, 75.153], ['B', ' HG2', 166.561, 112.177, 75.223]]
[['B', ' N ', 168.204, 108.826, 77.13], ['B', ' CA ', 168.959, 107.798, 76.435], ['B', ' C ', 168.848, 106.4, 77.025], ['B', ' O ', 169.106, 105.415, 76.336], ['B', ' CB ', 170.41, 108.218, 76.377], ['B', ' CG ', 170.615, 109.444, 75.519], ['B', ' OD1', 169.953, 109.6, 74.486], ['B', ' ND2', 171.514, 110.314, 75.907], ['B', ' H ', 168.556, 109.177, 78.018], ['B', ' HA ', 168.579, 107.737, 75.415], ['B', ' HB ', 170.764, 108.438, 77.391], ['B', ' HB ', 171.014, 107.402, 75.986], ['B', ' HD2', 171.682, 111.137, 75.366], ['B', ' HD2', 172.056, 110.176, 76.762]]
[['B', ' N ', 168.474, 106.307, 78.288], ['B', ' CA ', 168.434, 105.019, 78.963], ['B', ' C ', 167.053, 104.381, 78.993], ['B', ' O ', 166.815, 103.362, 78.343], ['B', ' CB ', 168.928, 105.223, 80.36], ['B', ' CG ', 170.39, 105.587, 80.439], ['B', ' SD ', 170.916, 106.037, 82.092], ['B', ' CE ', 170.844, 104.481, 82.932], ['B', ' H ', 168.301, 107.167, 78.81], ['B', ' HA ', 169.102, 104.336, 78.441], ['B', ' HB ', 168.359, 105.998, 80.785], ['B', ' HB ', 168.744, 104.339, 80.932], ['B', ' HG ', 170.99, 104.745, 80.098], ['B', ' HG ', 170.587, 106.432, 79.777], ['B', ' HE ', 171.154, 104.619, 83.968], ['B', ' HE ', 169.833, 104.1, 82.907], ['B', ' HE ', 171.513, 103.77, 82.447]]
[['B', ' N ', 166.141, 104.959, 79.762], ['B', ' CA ', 164.81, 104.408, 79.891], ['B', ' C ', 163.852, 105.308, 79.139], ['B', ' O ', 163.657, 106.461, 79.503], ['B', ' CB ', 164.427, 104.325, 81.38], ['B', ' CG1', 163.013, 103.766, 81.535], ['B', ' CG2', 165.463, 103.442, 82.13], ['B', ' H ', 166.353, 105.828, 80.253], ['B', ' HA ', 164.786, 103.41, 79.454], ['B', ' HB ', 164.436, 105.335, 81.806], ['B', ' HG1', 162.752, 103.73, 82.592], ['B', ' HG1', 162.305, 104.409, 81.013], ['B', ' HG1', 162.968, 102.763, 81.115], ['B', ' HG2', 165.206, 103.396, 83.185], ['B', ' HG2', 165.456, 102.438, 81.712], ['B', ' HG2', 166.453, 103.867, 82.023]]
[['B', ' N ', 163.224, 104.786, 78.104], ['B', ' CA ', 162.389, 105.643, 77.288], ['B', ' C ', 160.962, 105.733, 77.806], ['B', ' O ', 160.163, 104.798, 77.665], ['B', ' CB ', 162.376, 105.144, 75.843], ['B', ' CG ', 161.653, 106.085, 74.908], ['B', ' OD1', 161.253, 107.123, 75.364], ['B', ' OD2', 161.518, 105.772, 73.746], ['B', ' H ', 163.378, 103.82, 77.853], ['B', ' HA ', 162.813, 106.648, 77.299], ['B', ' HB ', 163.403, 105.025, 75.493], ['B', ' HB ', 161.894, 104.168, 75.796]]
[['B', ' N ', 160.615, 106.848, 78.427], ['B', ' CA ', 159.273, 106.926, 78.939], ['B', ' C ', 158.455, 107.398, 77.8], ['B', ' O ', 158.363, 108.59, 77.521], ['B', ' CB ', 159.115, 107.925, 80.094], ['B', ' CG1', 160.091, 107.601, 81.252], ['B', ' CG2', 157.637, 107.977, 80.545], ['B', ' CD1', 159.953, 106.217, 81.866], ['B', ' H ', 161.276, 107.609, 78.513], ['B', ' HA ', 158.918, 105.943, 79.232], ['B', ' HB ', 159.395, 108.917, 79.736], ['B', ' HG1', 161.115, 107.701, 80.882], ['B', ' HG1', 159.934, 108.331, 82.042], ['B', ' HG2', 157.524, 108.71, 81.328], ['B', ' HG2', 156.997, 108.265, 79.709], ['B', ' HG2', 157.312, 107.005, 80.912], ['B', ' HD1', 160.686, 106.107, 82.665], ['B', ' HD1', 158.955, 106.08, 82.279], ['B', ' HD1', 160.137, 105.46, 81.113]]
[['B', ' N ', 157.828, 106.445, 77.174], ['B', ' CA ', 157.031, 106.739, 76.021], ['B', ' C ', 155.693, 107.324, 76.403], ['B', ' O ', 155.175, 108.165, 75.684], ['B', ' CB ', 156.921, 105.516, 75.083], ['B', ' CG1', 158.25, 105.284, 74.417], ['B', ' CG2', 156.627, 104.241, 75.852], ['B', ' H ', 158.038, 105.499, 77.487], ['B', ' HA ', 157.562, 107.5, 75.447], ['B', ' HB ', 156.159, 105.713, 74.338], ['B', ' HG1', 158.19, 104.43, 73.747], ['B', ' HG1', 158.54, 106.169, 73.846], ['B', ' HG1', 159.006, 105.094, 75.177], ['B', ' HG2', 156.571, 103.405, 75.157], ['B', ' HG2', 157.437, 104.071, 76.531], ['B', ' HG2', 155.721, 104.286, 76.404]]
[['B', ' N ', 155.102, 106.842, 77.486], ['B', ' CA ', 153.817, 107.356, 77.944], ['B', ' C ', 153.822, 107.555, 79.448], ['B', ' O ', 154.476, 106.818, 80.199], ['B', ' CB ', 152.671, 106.494, 77.476], ['B', ' CG ', 152.506, 106.468, 75.984], ['B', ' CD1', 153.305, 105.709, 75.214], ['B', ' CD2', 151.536, 107.204, 75.395], ['B', ' CE1', 153.201, 105.687, 73.89], ['B', ' CE2', 151.403, 107.161, 74.037], ['B', ' CZ ', 152.245, 106.412, 73.295], ['B', ' OH ', 152.078, 106.331, 71.944], ['B', ' H ', 155.588, 106.14, 78.025], ['B', ' HA ', 153.66, 108.335, 77.498], ['B', ' HB ', 152.817, 105.53, 77.829], ['B', ' HB ', 151.747, 106.872, 77.885], ['B', ' HD1', 154.032, 105.128, 75.669], ['B', ' HD2', 150.878, 107.807, 75.999], ['B', ' HE1', 153.873, 105.071, 73.304], ['B', ' HE2', 150.636, 107.726, 73.537], ['B', ' HH ', 151.11, 106.355, 71.762]]
[['B', ' N ', 153.034, 108.516, 79.873], ['B', ' CA ', 152.865, 108.934, 81.252], ['B', ' C ', 152.733, 110.413, 81.102], ['B', ' O ', 153.749, 111.101, 80.973], ['B', ' H ', 152.538, 109.053, 79.17], ['B', ' HA ', 151.988, 108.514, 81.724], ['B', ' HA ', 153.742, 108.677, 81.837]]
[['B', ' N ', 151.503, 110.913, 81.181], ['B', ' CA ', 151.237, 112.317, 80.907], ['B', ' C ', 152.009, 113.257, 81.793], ['B', ' O ', 152.499, 114.277, 81.326], ['B', ' CB ', 149.746, 112.571, 80.947], ['B', ' CG ', 149.032, 111.858, 79.792], ['B', ' CD ', 148.689, 110.422, 80.096], ['B', ' OE1', 148.285, 110.127, 81.221], ['B', ' NE2', 148.867, 109.522, 79.133], ['B', ' H ', 150.726, 110.289, 81.371], ['B', ' HA ', 151.541, 112.514, 79.898], ['B', ' HB ', 149.336, 112.23, 81.895], ['B', ' HB ', 149.554, 113.642, 80.87], ['B', ' HG ', 148.139, 112.376, 79.573], ['B', ' HG ', 149.687, 111.864, 78.913], ['B', ' HE2', 148.651, 108.56, 79.296], ['B', ' HE2', 149.257, 109.798, 78.222]]
[['B', ' N ', 152.313, 112.827, 82.996], ['B', ' CA ', 153.09, 113.636, 83.888], ['B', ' C ', 154.383, 114.086, 83.192], ['B', ' O ', 154.846, 115.195, 83.428], ['B', ' CB ', 153.477, 112.823, 85.138], ['B', ' OG1', 152.294, 112.32, 85.782], ['B', ' CG2', 154.286, 113.664, 86.124], ['B', ' H ', 151.928, 111.958, 83.34], ['B', ' HA ', 152.506, 114.512, 84.172], ['B', ' HB ', 154.088, 111.973, 84.83], ['B', ' HG1', 151.639, 113.036, 85.945], ['B', ' HG2', 154.545, 113.054, 86.987], ['B', ' HG2', 155.195, 114.017, 85.652], ['B', ' HG2', 153.695, 114.517, 86.45]]
[['B', ' N ', 155.044, 113.197, 82.435], ['B', ' CA ', 156.305, 113.551, 81.793], ['B', ' C ', 156.209, 113.825, 80.286], ['B', ' O ', 157.029, 114.578, 79.751], ['B', ' CB ', 157.329, 112.434, 82.027], ['B', ' CG ', 157.686, 112.107, 83.521], ['B', ' CD1', 158.669, 110.924, 83.549], ['B', ' CD2', 158.3, 113.336, 84.218], ['B', ' H ', 154.631, 112.289, 82.233], ['B', ' HA ', 156.665, 114.468, 82.245], ['B', ' HB ', 156.935, 111.522, 81.571], ['B', ' HB ', 158.249, 112.7, 81.51], ['B', ' HG ', 156.779, 111.811, 84.051], ['B', ' HD1', 158.911, 110.672, 84.581], ['B', ' HD1', 158.226, 110.065, 83.07], ['B', ' HD1', 159.58, 111.196, 83.022], ['B', ' HD2', 158.543, 113.085, 85.251], ['B', ' HD2', 159.209, 113.631, 83.695], ['B', ' HD2', 157.597, 114.165, 84.218]]
[['B', ' N ', 155.278, 113.172, 79.581], ['B', ' CA ', 155.157, 113.333, 78.125], ['B', ' C ', 153.727, 113.639, 77.68], ['B', ' O ', 152.786, 112.975, 78.092], ['B', ' CB ', 155.667, 112.069, 77.404], ['B', ' CG1', 157.146, 111.877, 77.65], ['B', ' CG2', 154.954, 110.84, 77.905], ['B', ' H ', 154.627, 112.564, 80.081], ['B', ' HA ', 155.788, 114.166, 77.823], ['B', ' HB ', 155.512, 112.187, 76.334], ['B', ' HG1', 157.488, 110.985, 77.118], ['B', ' HG1', 157.692, 112.747, 77.29], ['B', ' HG1', 157.333, 111.749, 78.711], ['B', ' HG2', 155.349, 109.992, 77.376], ['B', ' HG2', 155.139, 110.715, 78.962], ['B', ' HG2', 153.893, 110.901, 77.73]]
[['B', ' N ', 153.534, 114.517, 76.702], ['B', ' CA ', 152.155, 114.828, 76.293], ['B', ' C ', 151.671, 113.814, 75.267], ['B', ' O ', 151.506, 114.119, 74.087], ['B', ' CB ', 152.117, 116.247, 75.72], ['B', ' CG ', 150.747, 116.859, 75.556], ['B', ' OD1', 149.809, 116.315, 76.06], ['B', ' OD2', 150.667, 117.95, 75.029], ['B', ' H ', 154.312, 115.006, 76.291], ['B', ' HA ', 151.506, 114.776, 77.168], ['B', ' HB ', 152.664, 116.888, 76.378], ['B', ' HB ', 152.618, 116.259, 74.751]]
[['B', ' N ', 151.5, 112.591, 75.738], ['B', ' CA ', 151.145, 111.464, 74.902], ['B', ' C ', 150.135, 110.526, 75.512], ['B', ' O ', 150.212, 110.178, 76.695], ['B', ' CB ', 152.403, 110.656, 74.584], ['B', ' CG ', 153.479, 111.326, 73.732], ['B', ' CD1', 154.724, 110.484, 73.785], ['B', ' CD2', 152.987, 111.453, 72.297], ['B', ' H ', 151.674, 112.476, 76.733], ['B', ' HA ', 150.706, 111.852, 73.987], ['B', ' HB ', 152.863, 110.332, 75.517], ['B', ' HB ', 152.097, 109.783, 74.044], ['B', ' HG ', 153.719, 112.307, 74.128], ['B', ' HD1', 155.503, 110.947, 73.185], ['B', ' HD1', 155.063, 110.408, 74.809], ['B', ' HD1', 154.514, 109.484, 73.402], ['B', ' HD2', 153.763, 111.918, 71.692], ['B', ' HD2', 152.758, 110.462, 71.902], ['B', ' HD2', 152.096, 112.073, 72.26]]
[['B', ' N ', 149.248, 110.046, 74.67], ['B', ' CA ', 148.27, 109.03, 74.991], ['B', ' C ', 148.039, 108.195, 73.747], ['B', ' O ', 148.329, 108.644, 72.64], ['B', ' CB ', 147.017, 109.638, 75.621], ['B', ' CG ', 146.464, 110.767, 74.921], ['B', ' CD1', 145.497, 110.792, 73.988], ['B', ' CD2', 146.841, 112.128, 75.15], ['B', ' NE1', 145.253, 112.086, 73.607], ['B', ' CE2', 146.07, 112.91, 74.316], ['B', ' CE3', 147.751, 112.737, 76.003], ['B', ' CZ2', 146.187, 114.278, 74.298], ['B', ' CZ3', 147.867, 114.078, 75.988], ['B', ' CH2', 147.115, 114.844, 75.16], ['B', ' H ', 149.25, 110.406, 73.722], ['B', ' HA ', 148.688, 108.369, 75.746], ['B', ' HB ', 146.242, 108.899, 75.653], ['B', ' HB ', 147.228, 109.934, 76.645], ['B', ' HD1', 144.983, 109.917, 73.596], ['B', ' HE1', 144.572, 112.374, 72.918], ['B', ' HE3', 148.357, 112.153, 76.681], ['B', ' HZ2', 145.584, 114.908, 73.644], ['B', ' HZ3', 148.586, 114.524, 76.663], ['B', ' HH2', 147.252, 115.928, 75.186]]
[['B', ' N ', 147.557, 106.98, 73.972], ['B', ' CA ', 147.308, 105.883, 73.02], ['B', ' C ', 148.679, 105.19, 72.891], ['B', ' O ', 149.569, 105.662, 72.174], ['B', ' CB ', 146.711, 106.38, 71.708], ['B', ' CG ', 145.392, 107.195, 71.918], ['B', ' CD ', 144.276, 106.447, 72.614], ['B', ' OE1', 144.129, 105.289, 72.394], ['B', ' OE2', 143.585, 107.051, 73.404], ['B', ' H ', 147.364, 106.774, 74.935], ['B', ' HA ', 146.601, 105.173, 73.414], ['B', ' HB ', 147.427, 106.97, 71.143], ['B', ' HB ', 146.455, 105.515, 71.093], ['B', ' HG ', 145.608, 108.085, 72.473], ['B', ' HG ', 145.038, 107.507, 70.94]]
[['B', ' N ', 148.824, 104.071, 73.636], ['B', ' CA ', 150.078, 103.323, 73.866], ['B', ' C ', 150.312, 101.974, 73.136], ['B', ' O ', 149.47, 101.082, 73.224], ['B', ' CB ', 150.081, 102.998, 75.379], ['B', ' CG ', 151.115, 101.949, 75.877], ['B', ' SD ', 152.783, 102.504, 76.036], ['B', ' CE ', 152.744, 102.892, 77.704], ['B', ' H ', 147.983, 103.716, 74.094], ['B', ' HA ', 150.87, 104.008, 73.642], ['B', ' HB ', 150.269, 103.922, 75.939], ['B', ' HB ', 149.098, 102.66, 75.651], ['B', ' HG ', 150.809, 101.633, 76.852], ['B', ' HG ', 151.092, 101.07, 75.277], ['B', ' HE ', 153.707, 103.286, 78.021], ['B', ' HE ', 151.957, 103.593, 77.907], ['B', ' HE ', 152.542, 101.997, 78.223]]
[['B', ' N ', 151.46, 101.761, 72.441], ['B', ' CA ', 151.908, 100.492, 71.893], ['B', ' C ', 152.436, 99.806, 73.118], ['B', ' O ', 152.95, 100.506, 73.966], ['B', ' CB ', 153.006, 100.891, 70.916], ['B', ' CG ', 153.581, 102.143, 71.524], ['B', ' CD ', 152.402, 102.838, 72.219], ['B', ' HA ', 151.081, 99.942, 71.434], ['B', ' HB ', 153.744, 100.075, 70.835], ['B', ' HB ', 152.579, 101.046, 69.914], ['B', ' HG ', 154.383, 101.88, 72.238], ['B', ' HG ', 154.043, 102.768, 70.747], ['B', ' HD ', 152.78, 103.159, 73.171], ['B', ' HD ', 151.972, 103.65, 71.609]]
[['B', ' N ', 152.493, 98.512, 73.218], ['B', ' CA ', 152.998, 98.05, 74.496], ['B', ' C ', 154.43, 98.48, 74.831], ['B', ' O ', 155.361, 98.34, 74.037], ['B', ' CB ', 152.905, 96.533, 74.544], ['B', ' CG ', 151.478, 96.007, 74.458], ['B', ' CD ', 150.981, 95.831, 73.062], ['B', ' OE1', 151.68, 96.225, 72.143], ['B', ' OE2', 149.887, 95.313, 72.899], ['B', ' H ', 152.161, 97.855, 72.508], ['B', ' HA ', 152.348, 98.455, 75.272], ['B', ' HB ', 153.489, 96.1, 73.733], ['B', ' HB ', 153.336, 96.177, 75.485], ['B', ' HG ', 151.414, 95.058, 74.99], ['B', ' HG ', 150.837, 96.712, 74.952]]
[['B', ' N ', 154.576, 98.931, 76.07], ['B', ' CA ', 155.827, 99.297, 76.73], ['B', ' C ', 156.085, 98.154, 77.687], ['B', ' O ', 155.131, 97.531, 78.139], ['B', ' CB ', 155.766, 100.68, 77.378], ['B', ' CG ', 157.019, 101.098, 78.227], ['B', ' SD ', 156.884, 102.782, 78.938], ['B', ' CE ', 158.322, 102.919, 79.972], ['B', ' H ', 153.71, 99.017, 76.585], ['B', ' HA ', 156.635, 99.303, 75.997], ['B', ' HB ', 155.712, 101.405, 76.575], ['B', ' HB ', 154.872, 100.798, 77.915], ['B', ' HG ', 157.145, 100.405, 79.056], ['B', ' HG ', 157.914, 101.058, 77.607], ['B', ' HE ', 158.324, 103.891, 80.455], ['B', ' HE ', 158.295, 102.137, 80.737], ['B', ' HE ', 159.225, 102.812, 79.366]]
[['B', ' N ', 157.336, 97.856, 78.006], ['B', ' CA ', 157.567, 96.678, 78.824], ['B', ' C ', 157.357, 96.882, 80.325], ['B', ' O ', 156.726, 96.044, 80.982], ['B', ' CB ', 159.04, 96.333, 78.646], ['B', ' CG ', 159.412, 96.031, 77.199], ['B', ' OD1', 159.114, 94.977, 76.669], ['B', ' OD2', 159.961, 96.931, 76.609], ['B', ' H ', 158.116, 98.373, 77.616], ['B', ' HA ', 156.923, 95.875, 78.47], ['B', ' HB ', 159.658, 97.157, 79.001], ['B', ' HB ', 159.28, 95.462, 79.26]]
[['B', ' N ', 157.779, 98.023, 80.856], ['B', ' CA ', 157.671, 98.262, 82.297], ['B', ' C ', 156.794, 99.402, 82.69], ['B', ' O ', 157.095, 100.552, 82.377], ['B', ' CB ', 159.047, 98.578, 82.882], ['B', ' CG ', 159.098, 99.019, 84.391], ['B', ' CD1', 158.637, 97.869, 85.325], ['B', ' CD2', 160.521, 99.492, 84.675], ['B', ' H ', 158.235, 98.7, 80.263], ['B', ' HA ', 157.269, 97.365, 82.756], ['B', ' HB ', 159.668, 97.691, 82.783], ['B', ' HB ', 159.493, 99.374, 82.288], ['B', ' HG ', 158.421, 99.859, 84.568], ['B', ' HD1', 158.689, 98.209, 86.356], ['B', ' HD1', 157.61, 97.589, 85.104], ['B', ' HD1', 159.276, 97.01, 85.197], ['B', ' HD2', 160.606, 99.82, 85.706], ['B', ' HD2', 161.218, 98.698, 84.491], ['B', ' HD2', 160.759, 100.324, 84.013]]
[['B', ' N ', 155.775, 99.096, 83.468], ['B', ' CA ', 154.886, 100.118, 83.945], ['B', ' C ', 155.195, 100.498, 85.364], ['B', ' O ', 155.291, 99.635, 86.241], ['B', ' CB ', 153.462, 99.642, 83.87], ['B', ' H ', 155.598, 98.114, 83.701], ['B', ' HA ', 155.021, 100.994, 83.34], ['B', ' HB ', 152.817, 100.431, 84.218], ['B', ' HB ', 153.204, 99.384, 82.86], ['B', ' HB ', 153.351, 98.769, 84.497]]
[['B', ' N ', 155.317, 101.787, 85.615], ['B', ' CA ', 155.498, 102.246, 86.975], ['B', ' C ', 154.17, 102.805, 87.392], ['B', ' O ', 153.659, 103.738, 86.76], ['B', ' CB ', 156.6, 103.298, 87.061], ['B', ' CG ', 157.994, 102.863, 86.558], ['B', ' CD1', 158.955, 104.036, 86.696], ['B', ' CD2', 158.488, 101.653, 87.347], ['B', ' H ', 155.282, 102.482, 84.859], ['B', ' HA ', 155.72, 101.408, 87.634], ['B', ' HB ', 156.293, 104.163, 86.473], ['B', ' HB ', 156.698, 103.611, 88.087], ['B', ' HG ', 157.936, 102.598, 85.498], ['B', ' HD1', 159.938, 103.747, 86.331], ['B', ' HD1', 158.587, 104.877, 86.113], ['B', ' HD1', 159.028, 104.325, 87.736], ['B', ' HD2', 159.466, 101.37, 86.986], ['B', ' HD2', 158.553, 101.895, 88.397], ['B', ' HD2', 157.812, 100.82, 87.21]]
[['B', ' N ', 153.575, 102.207, 88.405], ['B', ' CA ', 152.243, 102.633, 88.793], ['B', ' C ', 152.273, 103.332, 90.152], ['B', ' O ', 152.714, 102.78, 91.162], ['B', ' CB ', 151.297, 101.43, 88.699], ['B', ' CG1', 151.279, 100.922, 87.283], ['B', ' CG2', 151.729, 100.286, 89.607], ['B', ' H ', 154.068, 101.442, 88.887], ['B', ' HA ', 151.885, 103.364, 88.07], ['B', ' HB ', 150.311, 101.772, 88.924], ['B', ' HG1', 150.579, 100.095, 87.203], ['B', ' HG1', 150.976, 101.711, 86.63], ['B', ' HG1', 152.272, 100.579, 86.993], ['B', ' HG2', 151.04, 99.457, 89.506], ['B', ' HG2', 152.718, 99.956, 89.329], ['B', ' HG2', 151.733, 100.616, 90.622]]
[['B', ' N ', 151.792, 104.569, 90.163], ['B', ' CA ', 151.91, 105.477, 91.309], ['B', ' C ', 151.143, 105.039, 92.554], ['B', ' O ', 151.612, 105.233, 93.667], ['B', ' CB ', 151.405, 106.848, 90.89], ['B', ' CG ', 152.228, 107.575, 89.748], ['B', ' CD ', 153.555, 107.981, 90.105], ['B', ' OE1', 153.744, 108.303, 91.225], ['B', ' OE2', 154.399, 108.0, 89.248], ['B', ' H ', 151.364, 104.923, 89.302], ['B', ' HA ', 152.968, 105.553, 91.575], ['B', ' HB ', 150.381, 106.746, 90.587], ['B', ' HB ', 151.402, 107.511, 91.761], ['B', ' HG ', 152.306, 106.898, 88.899], ['B', ' HG ', 151.688, 108.447, 89.417]]
[['B', ' N ', 149.978, 104.431, 92.386], ['B', ' CA ', 149.23, 103.966, 93.554], ['B', ' C ', 147.928, 104.635, 93.901], ['B', ' O ', 147.416, 105.45, 93.146], ['B', ' H ', 149.635, 104.308, 91.447], ['B', ' HA ', 149.018, 102.917, 93.411], ['B', ' HA ', 149.878, 104.038, 94.418]]
[['B', ' N ', 147.379, 104.224, 95.052], ['B', ' CA ', 146.099, 104.688, 95.572], ['B', ' C ', 144.939, 104.52, 94.619], ['B', ' O ', 144.385, 105.503, 94.128], ['B', ' CB ', 146.209, 106.127, 96.019], ['B', ' OG ', 147.153, 106.246, 97.039], ['B', ' H ', 147.9, 103.558, 95.62], ['B', ' HA ', 145.873, 104.089, 96.457], ['B', ' HB ', 146.497, 106.754, 95.181], ['B', ' HB ', 145.242, 106.477, 96.373], ['B', ' HG ', 147.105, 107.154, 97.339]]
[['B', ' N ', 144.578, 103.28, 94.318], ['B', ' CA ', 143.52, 103.069, 93.355], ['B', ' C ', 142.212, 103.281, 94.018], ['B', ' O ', 141.914, 102.636, 95.013], ['B', ' CB ', 143.517, 101.636, 92.854], ['B', ' CG1', 142.361, 101.39, 91.857], ['B', ' CG2', 144.779, 101.365, 92.305], ['B', ' H ', 145.002, 102.489, 94.808], ['B', ' HA ', 143.632, 103.77, 92.529], ['B', ' HB ', 143.36, 100.975, 93.679], ['B', ' HG1', 142.392, 100.354, 91.533], ['B', ' HG1', 141.396, 101.58, 92.327], ['B', ' HG1', 142.473, 102.04, 90.991], ['B', ' HG2', 144.793, 100.338, 91.965], ['B', ' HG2', 144.953, 102.045, 91.491], ['B', ' HG2', 145.543, 101.509, 93.061]]
[['B', ' N ', 141.403, 104.154, 93.481], ['B', ' CA ', 140.146, 104.373, 94.13], ['B', ' C ', 139.125, 103.461, 93.512], ['B', ' O ', 139.065, 103.31, 92.296], ['B', ' CB ', 139.671, 105.783, 93.992], ['B', ' SG ', 138.285, 106.092, 95.03], ['B', ' H ', 141.68, 104.687, 92.669], ['B', ' HA ', 140.227, 104.145, 95.188], ['B', ' HB ', 140.446, 106.466, 94.204], ['B', ' HB ', 139.363, 105.953, 92.968], ['B', ' HG ', 137.543, 105.047, 94.626]]
[['B', ' N ', 138.32, 102.858, 94.344], ['B', ' CA ', 137.25, 102.013, 93.881], ['B', ' C ', 136.154, 102.984, 93.549], ['B', ' O ', 136.325, 104.172, 93.794], ['B', ' CB ', 136.822, 101.022, 94.945], ['B', ' CG ', 137.921, 100.094, 95.466], ['B', ' CD1', 137.316, 99.185, 96.489], ['B', ' CD2', 138.576, 99.324, 94.335], ['B', ' H ', 138.438, 103.015, 95.35], ['B', ' HA ', 137.539, 101.5, 92.968], ['B', ' HB ', 136.445, 101.59, 95.799], ['B', ' HB ', 136.016, 100.407, 94.553], ['B', ' HG ', 138.685, 100.69, 95.974], ['B', ' HD1', 138.085, 98.538, 96.904], ['B', ' HD1', 136.881, 99.777, 97.282], ['B', ' HD1', 136.542, 98.575, 96.029], ['B', ' HD2', 139.343, 98.679, 94.748], ['B', ' HD2', 137.835, 98.718, 93.815], ['B', ' HD2', 139.04, 100.014, 93.642]]
[['B', ' N ', 135.096, 102.553, 92.879], ['B', ' CA ', 133.994, 103.44, 92.448], ['B', ' C ', 134.384, 104.201, 91.174], ['B', ' O ', 133.627, 104.24, 90.209], ['B', ' CB ', 133.59, 104.48, 93.518], ['B', ' CG ', 133.147, 103.906, 94.856], ['B', ' CD ', 131.964, 103.021, 94.725], ['B', ' OE1', 130.997, 103.346, 94.032], ['B', ' NE2', 132.013, 101.873, 95.387], ['B', ' H ', 135.016, 101.565, 92.682], ['B', ' HA ', 133.124, 102.826, 92.213], ['B', ' HB ', 134.333, 105.251, 93.665], ['B', ' HB ', 132.717, 105.006, 93.141], ['B', ' HG ', 133.962, 103.339, 95.301], ['B', ' HG ', 132.883, 104.737, 95.517], ['B', ' HE2', 131.242, 101.233, 95.339], ['B', ' HE2', 132.81, 101.651, 95.946]]
[['B', ' N ', 135.577, 104.774, 91.181], ['B', ' CA ', 136.14, 105.555, 90.094], ['B', ' C ', 136.586, 104.673, 88.945], ['B', ' O ', 137.596, 103.956, 89.028], ['B', ' CB ', 137.347, 106.321, 90.618], ['B', ' CG ', 138.02, 107.232, 89.612], ['B', ' OD1', 137.835, 107.047, 88.418], ['B', ' OD2', 138.751, 108.088, 90.032], ['B', ' H ', 136.091, 104.695, 92.051], ['B', ' HA ', 135.381, 106.251, 89.729], ['B', ' HB ', 137.041, 106.905, 91.452], ['B', ' HB ', 138.083, 105.6, 90.981]]
[['B', ' N ', 135.823, 104.747, 87.866], ['B', ' CA ', 136.02, 103.91, 86.713], ['B', ' C ', 137.244, 104.276, 85.913], ['B', ' O ', 137.665, 103.494, 85.062], ['B', ' CB ', 134.79, 103.97, 85.8], ['B', ' CG ', 134.566, 105.313, 85.042], ['B', ' CD ', 133.841, 106.374, 85.843], ['B', ' OE1', 133.852, 106.303, 87.05], ['B', ' OE2', 133.274, 107.253, 85.243], ['B', ' H ', 135.023, 105.39, 87.872], ['B', ' HA ', 136.136, 102.887, 87.062], ['B', ' HB ', 134.863, 103.18, 85.052], ['B', ' HB ', 133.897, 103.773, 86.393], ['B', ' HG ', 135.51, 105.724, 84.698], ['B', ' HG ', 133.974, 105.095, 84.155]]
[['B', ' N ', 137.825, 105.457, 86.126], ['B', ' CA ', 138.949, 105.792, 85.28], ['B', ' C ', 140.146, 105.002, 85.722], ['B', ' O ', 140.787, 104.334, 84.913], ['B', ' CB ', 139.306, 107.279, 85.345], ['B', ' CG ', 138.315, 108.208, 84.721], ['B', ' ND1', 137.971, 108.143, 83.39], ['B', ' CD2', 137.618, 109.253, 85.244], ['B', ' CE1', 137.098, 109.098, 83.114], ['B', ' NE2', 136.867, 109.798, 84.219], ['B', ' H ', 137.512, 106.084, 86.884], ['B', ' HA ', 138.731, 105.531, 84.246], ['B', ' HB ', 139.418, 107.572, 86.394], ['B', ' HB ', 140.272, 107.436, 84.862], ['B', ' HD1', 138.32, 107.486, 82.72], ['B', ' HD2', 137.579, 109.685, 86.248], ['B', ' HE1', 136.701, 109.207, 82.105]]
[['B', ' N ', 140.398, 104.984, 87.025], ['B', ' CA ', 141.554, 104.271, 87.514], ['B', ' C ', 141.367, 102.781, 87.371], ['B', ' O ', 142.305, 102.07, 87.002], ['B', ' CB ', 141.823, 104.62, 88.962], ['B', ' OG ', 142.208, 105.964, 89.091], ['B', ' H ', 139.83, 105.539, 87.661], ['B', ' HA ', 142.419, 104.569, 86.919], ['B', ' HB ', 140.92, 104.437, 89.554], ['B', ' HB ', 142.608, 103.975, 89.35], ['B', ' HG ', 142.438, 106.085, 90.016]]
[['B', ' N ', 140.153, 102.292, 87.606], ['B', ' CA ', 139.955, 100.864, 87.51], ['B', ' C ', 140.129, 100.403, 86.071], ['B', ' O ', 140.771, 99.379, 85.806], ['B', ' CB ', 138.538, 100.552, 87.979], ['B', ' CG ', 138.244, 100.814, 89.479], ['B', ' CD1', 136.753, 100.73, 89.713], ['B', ' CD2', 138.966, 99.816, 90.336], ['B', ' H ', 139.384, 102.9, 87.915], ['B', ' HA ', 140.698, 100.362, 88.122], ['B', ' HB ', 137.849, 101.158, 87.398], ['B', ' HB ', 138.331, 99.505, 87.772], ['B', ' HG ', 138.576, 101.817, 89.753], ['B', ' HD1', 136.544, 100.932, 90.757], ['B', ' HD1', 136.251, 101.478, 89.099], ['B', ' HD1', 136.391, 99.739, 89.452], ['B', ' HD2', 138.743, 100.025, 91.368], ['B', ' HD2', 138.646, 98.806, 90.09], ['B', ' HD2', 140.023, 99.909, 90.184]]
[['B', ' N ', 139.6, 101.179, 85.126], ['B', ' CA ', 139.689, 100.814, 83.734], ['B', ' C ', 141.112, 100.861, 83.239], ['B', ' O ', 141.596, 99.914, 82.602], ['B', ' CB ', 138.858, 101.755, 82.873], ['B', ' CG ', 138.884, 101.357, 81.485], ['B', ' ND1', 138.113, 100.324, 80.996], ['B', ' CD2', 139.636, 101.783, 80.461], ['B', ' CE1', 138.391, 100.147, 79.724], ['B', ' NE2', 139.311, 101.012, 79.383], ['B', ' H ', 139.065, 102.021, 85.349], ['B', ' HA ', 139.318, 99.801, 83.598], ['B', ' HB ', 137.825, 101.754, 83.215], ['B', ' HB ', 139.24, 102.775, 82.962], ['B', ' HD2', 140.391, 102.57, 80.488], ['B', ' HE1', 137.955, 99.395, 79.071], ['B', ' HE2', 139.762, 101.081, 78.461]]
[['B', ' N ', 141.792, 101.97, 83.525], ['B', ' CA ', 143.127, 102.162, 83.026], ['B', ' C ', 144.065, 101.099, 83.559], ['B', ' O ', 144.847, 100.546, 82.786], ['B', ' CB ', 143.6, 103.56, 83.396], ['B', ' CG ', 142.905, 104.694, 82.641], ['B', ' CD ', 143.332, 106.092, 83.119], ['B', ' OE1', 144.247, 106.189, 83.905], ['B', ' OE2', 142.743, 107.072, 82.688], ['B', ' H ', 141.355, 102.72, 84.071], ['B', ' HA ', 143.101, 102.079, 81.937], ['B', ' HB ', 143.426, 103.721, 84.462], ['B', ' HB ', 144.637, 103.646, 83.227], ['B', ' HG ', 143.162, 104.599, 81.585], ['B', ' HG ', 141.829, 104.588, 82.72]]
[['B', ' N ', 143.938, 100.714, 84.832], ['B', ' CA ', 144.809, 99.667, 85.324], ['B', ' C ', 144.575, 98.345, 84.656], ['B', ' O ', 145.533, 97.6, 84.431], ['B', ' CB ', 144.669, 99.477, 86.815], ['B', ' CG ', 145.266, 100.52, 87.677], ['B', ' CD1', 144.836, 100.301, 89.034], ['B', ' CD2', 146.833, 100.431, 87.624], ['B', ' H ', 143.278, 101.178, 85.466], ['B', ' HA ', 145.824, 99.963, 85.1], ['B', ' HB ', 143.599, 99.428, 87.044], ['B', ' HB ', 145.105, 98.556, 87.072], ['B', ' HG ', 144.925, 101.493, 87.37], ['B', ' HD1', 145.285, 101.062, 89.616], ['B', ' HD1', 143.749, 100.373, 89.094], ['B', ' HD1', 145.16, 99.327, 89.38], ['B', ' HD2', 147.258, 101.192, 88.28], ['B', ' HD2', 147.158, 99.449, 87.955], ['B', ' HD2', 147.204, 100.603, 86.625]]
[['B', ' N ', 143.333, 98.002, 84.346], ['B', ' CA ', 143.158, 96.729, 83.687], ['B', ' C ', 143.862, 96.749, 82.33], ['B', ' O ', 144.568, 95.793, 81.985], ['B', ' CB ', 141.68, 96.408, 83.565], ['B', ' CG ', 141.04, 96.073, 84.908], ['B', ' CD ', 139.557, 95.799, 84.776], ['B', ' CE ', 138.927, 95.512, 86.132], ['B', ' NZ ', 137.457, 95.256, 86.018], ['B', ' H ', 142.531, 98.593, 84.601], ['B', ' HA ', 143.627, 95.956, 84.293], ['B', ' HB ', 141.156, 97.275, 83.148], ['B', ' HB ', 141.538, 95.57, 82.885], ['B', ' HG ', 141.531, 95.193, 85.328], ['B', ' HG ', 141.192, 96.901, 85.597], ['B', ' HD ', 139.071, 96.675, 84.337], ['B', ' HD ', 139.397, 94.945, 84.119], ['B', ' HE ', 139.407, 94.64, 86.574], ['B', ' HE ', 139.087, 96.373, 86.787], ['B', ' HZ ', 137.073, 95.072, 86.935], ['B', ' HZ ', 137.003, 96.067, 85.62], ['B', ' HZ ', 137.297, 94.456, 85.422]]
[['B', ' N ', 143.753, 97.865, 81.597], ['B', ' CA ', 144.43, 97.947, 80.303], ['B', ' C ', 145.944, 97.912, 80.476], ['B', ' O ', 146.649, 97.262, 79.698], ['B', ' CB ', 144.022, 99.207, 79.545], ['B', ' CG ', 142.589, 99.191, 79.016], ['B', ' CD ', 142.217, 100.472, 78.336], ['B', ' OE1', 142.912, 101.422, 78.536], ['B', ' OE2', 141.231, 100.505, 77.614], ['B', ' H ', 143.144, 98.628, 81.925], ['B', ' HA ', 144.137, 97.079, 79.709], ['B', ' HB ', 144.124, 100.073, 80.205], ['B', ' HB ', 144.694, 99.36, 78.698], ['B', ' HG ', 142.479, 98.368, 78.311], ['B', ' HG ', 141.908, 99.016, 79.853]]
[['B', ' N ', 146.438, 98.563, 81.523], ['B', ' CA ', 147.855, 98.597, 81.799], ['B', ' C ', 148.381, 97.206, 82.004], ['B', ' O ', 149.407, 96.852, 81.431], ['B', ' CB ', 148.123, 99.429, 83.057], ['B', ' CG ', 149.581, 99.667, 83.46], ['B', ' CD1', 149.692, 101.036, 84.089], ['B', ' CD2', 150.004, 98.615, 84.497], ['B', ' H ', 145.799, 99.106, 82.11], ['B', ' HA ', 148.364, 99.046, 80.948], ['B', ' HB ', 147.612, 100.373, 82.983], ['B', ' HB ', 147.67, 98.901, 83.886], ['B', ' HG ', 150.228, 99.62, 82.591], ['B', ' HD1', 150.708, 101.223, 84.384], ['B', ' HD1', 149.398, 101.797, 83.385], ['B', ' HD1', 149.047, 101.088, 84.96], ['B', ' HD2', 151.012, 98.802, 84.805], ['B', ' HD2', 149.352, 98.68, 85.367], ['B', ' HD2', 149.95, 97.62, 84.095]]
[['B', ' N ', 147.7, 96.405, 82.82], ['B', ' CA ', 148.182, 95.061, 83.081], ['B', ' C ', 148.223, 94.209, 81.845], ['B', ' O ', 149.135, 93.392, 81.7], ['B', ' CB ', 147.346, 94.372, 84.116], ['B', ' CG ', 147.723, 92.876, 84.406], ['B', ' CD ', 149.064, 92.667, 85.087], ['B', ' NE ', 150.17, 92.561, 84.13], ['B', ' CZ ', 151.474, 92.36, 84.451], ['B', ' NH1', 151.862, 92.207, 85.729], ['B', ' NH2', 152.363, 92.318, 83.476], ['B', ' H ', 146.864, 96.763, 83.299], ['B', ' HA ', 149.195, 95.147, 83.47], ['B', ' HB ', 147.411, 94.95, 85.006], ['B', ' HB ', 146.301, 94.397, 83.797], ['B', ' HG ', 146.968, 92.467, 85.071], ['B', ' HG ', 147.718, 92.296, 83.485], ['B', ' HD ', 149.276, 93.502, 85.746], ['B', ' HD ', 149.027, 91.748, 85.672], ['B', ' HE ', 149.945, 92.67, 83.122], ['B', ' HH1', 151.175, 92.216, 86.501], ['B', ' HH1', 152.86, 92.079, 85.979], ['B', ' HH2', 152.086, 92.462, 82.488], ['B', ' HH2', 153.353, 92.143, 83.67]]
[['B', ' N ', 147.241, 94.374, 80.967], ['B', ' CA ', 147.208, 93.611, 79.736], ['B', ' C ', 148.379, 93.953, 78.825], ['B', ' O ', 148.886, 93.091, 78.104], ['B', ' CB ', 145.908, 93.863, 78.978], ['B', ' CG ', 144.669, 93.288, 79.626], ['B', ' CD ', 143.417, 93.646, 78.876], ['B', ' OE1', 143.513, 94.412, 77.946], ['B', ' OE2', 142.37, 93.16, 79.228], ['B', ' H ', 146.47, 95.017, 81.19], ['B', ' HA ', 147.268, 92.553, 79.989], ['B', ' HB ', 145.759, 94.938, 78.876], ['B', ' HB ', 145.989, 93.45, 77.974], ['B', ' HG ', 144.763, 92.204, 79.659], ['B', ' HG ', 144.599, 93.648, 80.647]]
[['B', ' N ', 148.795, 95.215, 78.835], ['B', ' CA ', 149.847, 95.665, 77.944], ['B', ' C ', 151.269, 95.59, 78.516], ['B', ' O ', 152.221, 95.357, 77.77], ['B', ' CB ', 149.48, 97.073, 77.544], ['B', ' CG ', 148.195, 97.053, 76.732], ['B', ' CD ', 147.65, 98.389, 76.452], ['B', ' CE ', 148.372, 99.049, 75.36], ['B', ' NZ ', 147.71, 100.245, 74.997], ['B', ' H ', 148.309, 95.893, 79.432], ['B', ' HA ', 149.822, 95.035, 77.057], ['B', ' HB ', 149.309, 97.668, 78.448], ['B', ' HB ', 150.289, 97.533, 76.993], ['B', ' HG ', 148.386, 96.54, 75.787], ['B', ' HG ', 147.432, 96.492, 77.267], ['B', ' HD ', 146.597, 98.302, 76.186], ['B', ' HD ', 147.724, 99.009, 77.35], ['B', ' HE ', 149.388, 99.289, 75.662], ['B', ' HE ', 148.407, 98.392, 74.489], ['B', ' HZ ', 148.226, 100.658, 74.233], ['B', ' HZ ', 146.775, 100.05, 74.702], ['B', ' HZ ', 147.673, 100.878, 75.783]]
[['B', ' N ', 151.416, 95.762, 79.825], ['B', ' CA ', 152.707, 95.734, 80.501], ['B', ' C ', 153.213, 94.314, 80.61], ['B', ' O ', 152.437, 93.36, 80.713], ['B', ' CB ', 152.588, 96.336, 81.888], ['B', ' H ', 150.59, 95.964, 80.385], ['B', ' HA ', 153.428, 96.299, 79.912], ['B', ' HB ', 153.557, 96.316, 82.373], ['B', ' HB ', 152.235, 97.357, 81.821], ['B', ' HB ', 151.875, 95.749, 82.458]]
[['B', ' N ', 154.524, 94.154, 80.656], ['B', ' CA ', 155.068, 92.841, 80.903], ['B', ' C ', 155.361, 92.817, 82.376], ['B', ' O ', 155.053, 91.86, 83.087], ['B', ' CB ', 156.315, 92.63, 80.079], ['B', ' CG ', 156.025, 92.567, 78.613], ['B', ' CD ', 157.278, 92.443, 77.824], ['B', ' CE ', 156.996, 92.46, 76.338], ['B', ' NZ ', 158.243, 92.555, 75.57], ['B', ' H ', 155.161, 94.947, 80.574], ['B', ' HA ', 154.33, 92.073, 80.671], ['B', ' HB ', 157.013, 93.452, 80.255], ['B', ' HB ', 156.806, 91.705, 80.382], ['B', ' HG ', 155.381, 91.712, 78.409], ['B', ' HG ', 155.497, 93.475, 78.309], ['B', ' HD ', 157.943, 93.272, 78.064], ['B', ' HD ', 157.781, 91.512, 78.079], ['B', ' HE ', 156.471, 91.55, 76.056], ['B', ' HE ', 156.371, 93.323, 76.101], ['B', ' HZ ', 158.05, 92.586, 74.585], ['B', ' HZ ', 158.695, 93.438, 75.867], ['B', ' HZ ', 158.845, 91.777, 75.773]]
[['B', ' N ', 155.858, 93.937, 82.846], ['B', ' CA ', 156.178, 94.107, 84.233], ['B', ' C ', 155.378, 95.247, 84.777], ['B', ' O ', 155.295, 96.306, 84.145], ['B', ' CB ', 157.64, 94.487, 84.381], ['B', ' CG ', 158.666, 93.543, 83.854], ['B', ' CD1', 159.976, 94.237, 83.928], ['B', ' CD2', 158.692, 92.28, 84.692], ['B', ' H ', 156.073, 94.694, 82.199], ['B', ' HA ', 155.933, 93.206, 84.797], ['B', ' HB ', 157.788, 95.42, 83.87], ['B', ' HB ', 157.839, 94.639, 85.442], ['B', ' HG ', 158.454, 93.294, 82.815], ['B', ' HD1', 160.762, 93.582, 83.554], ['B', ' HD1', 159.948, 95.147, 83.328], ['B', ' HD1', 160.166, 94.49, 84.966], ['B', ' HD2', 159.46, 91.607, 84.317], ['B', ' HD2', 158.906, 92.529, 85.735], ['B', ' HD2', 157.725, 91.777, 84.644]]
[['B', ' N ', 154.795, 95.046, 85.931], ['B', ' CA ', 154.116, 96.134, 86.588], ['B', ' C ', 154.793, 96.279, 87.916], ['B', ' O ', 154.901, 95.312, 88.677], ['B', ' CB ', 152.612, 95.881, 86.737], ['B', ' CG1', 151.955, 97.035, 87.479], ['B', ' CG2', 152.008, 95.75, 85.364], ['B', ' H ', 154.859, 94.114, 86.38], ['B', ' HA ', 154.261, 97.057, 86.027], ['B', ' HB ', 152.45, 94.967, 87.307], ['B', ' HG1', 150.887, 96.847, 87.572], ['B', ' HG1', 152.384, 97.141, 88.474], ['B', ' HG1', 152.114, 97.958, 86.924], ['B', ' HG2', 150.941, 95.566, 85.448], ['B', ' HG2', 152.18, 96.664, 84.815], ['B', ' HG2', 152.473, 94.934, 84.837]]
[['B', ' N ', 155.275, 97.473, 88.186], ['B', ' CA ', 155.945, 97.69, 89.428], ['B', ' C ', 155.269, 98.729, 90.251], ['B', ' O ', 155.164, 99.895, 89.851], ['B', ' CB ', 157.387, 98.121, 89.207], ['B', ' SG ', 158.332, 98.358, 90.732], ['B', ' H ', 155.182, 98.236, 87.508], ['B', ' HA ', 155.929, 96.773, 89.988], ['B', ' HB ', 157.899, 97.389, 88.603], ['B', ' HB ', 157.39, 99.056, 88.662], ['B', ' HG ', 157.447, 99.185, 91.348]]
[['B', ' N ', 154.829, 98.32, 91.421], ['B', ' CA ', 154.218, 99.283, 92.288], ['B', ' C ', 155.306, 100.304, 92.434], ['B', ' O ', 156.454, 99.926, 92.67], ['B', ' CB ', 153.799, 98.632, 93.579], ['B', ' H ', 154.948, 97.33, 91.669], ['B', ' HA ', 153.368, 99.743, 91.807], ['B', ' HB ', 153.4, 99.326, 94.258], ['B', ' HB ', 153.053, 97.869, 93.366], ['B', ' HB ', 154.633, 98.194, 94.025]]
[['B', ' N ', 155.008, 101.579, 92.311], ['B', ' CA ', 156.084, 102.541, 92.345], ['B', ' C ', 155.963, 103.524, 93.458], ['B', ' O ', 155.992, 104.728, 93.253], ['B', ' CB ', 156.143, 103.241, 91.013], ['B', ' CG ', 157.347, 103.996, 90.817], ['B', ' CD1', 158.566, 103.35, 90.788], ['B', ' CD2', 157.303, 105.344, 90.631], ['B', ' CE1', 159.703, 104.046, 90.584], ['B', ' CE2', 158.442, 106.037, 90.429], ['B', ' CZ ', 159.635, 105.396, 90.405], ['B', ' H ', 154.057, 101.902, 92.125], ['B', ' HA ', 157.016, 102.007, 92.495], ['B', ' HB ', 156.066, 102.5, 90.218], ['B', ' HB ', 155.289, 103.917, 90.919], ['B', ' HD1', 158.611, 102.268, 90.926], ['B', ' HD2', 156.335, 105.871, 90.655], ['B', ' HE1', 160.664, 103.533, 90.558], ['B', ' HE2', 158.398, 107.115, 90.287], ['B', ' HZ ', 160.524, 105.969, 90.239]]
[['B', ' N ', 155.819, 102.984, 94.631], ['B', ' CA ', 155.725, 103.728, 95.86], ['B', ' C ', 154.921, 102.901, 96.802], ['B', ' O ', 154.222, 101.975, 96.389], ['B', ' H ', 155.761, 101.973, 94.652], ['B', ' HA ', 156.719, 103.91, 96.272], ['B', ' HA ', 155.244, 104.689, 95.689]]
[['B', ' N ', 154.936, 103.244, 98.07], ['B', ' CA ', 154.163, 102.442, 99.009], ['B', ' C ', 152.673, 102.466, 98.73], ['B', ' O ', 152.025, 101.44, 98.858], ['B', ' CB ', 154.428, 102.876, 100.433], ['B', ' OG ', 155.743, 102.573, 100.819], ['B', ' H ', 155.494, 104.035, 98.406], ['B', ' HA ', 154.484, 101.404, 98.914], ['B', ' HB ', 154.268, 103.947, 100.522], ['B', ' HB ', 153.72, 102.383, 101.101], ['B', ' HG ', 155.845, 102.947, 101.704]]
[['B', ' N ', 152.125, 103.579, 98.217], ['B', ' CA ', 150.709, 103.762, 97.958], ['B', ' C ', 150.184, 102.803, 96.886], ['B', ' O ', 148.978, 102.596, 96.752], ['B', ' CB ', 150.401, 105.228, 97.615], ['B', ' SG ', 150.412, 106.392, 99.069], ['B', ' H ', 152.75, 104.369, 98.066], ['B', ' HA ', 150.189, 103.543, 98.882], ['B', ' HB ', 151.127, 105.604, 96.879], ['B', ' HB ', 149.419, 105.308, 97.147]]
[['B', ' N ', 151.093, 102.217, 96.116], ['B', ' CA ', 150.762, 101.266, 95.078], ['B', ' C ', 150.777, 99.809, 95.567], ['B', ' O ', 150.195, 98.936, 94.917], ['B', ' CB ', 151.738, 101.484, 93.945], ['B', ' H ', 152.087, 102.395, 96.281], ['B', ' HA ', 149.753, 101.449, 94.745], ['B', ' HB ', 151.527, 100.81, 93.134], ['B', ' HB ', 151.678, 102.494, 93.592], ['B', ' HB ', 152.735, 101.326, 94.308]]
[['B', ' N ', 151.414, 99.544, 96.703], ['B', ' CA ', 151.58, 98.218, 97.296], ['B', ' C ', 151.699, 98.446, 98.783], ['B', ' O ', 152.798, 98.68, 99.282], ['B', ' CB ', 152.778, 97.466, 96.751], ['B', ' H ', 151.79, 100.316, 97.262], ['B', ' HA ', 150.693, 97.623, 97.107], ['B', ' HB ', 152.849, 96.492, 97.259], ['B', ' HB ', 152.654, 97.307, 95.696], ['B', ' HB ', 153.679, 98.038, 96.94]]
[['B', ' N ', 150.552, 98.371, 99.451], ['B', ' CA ', 150.314, 98.782, 100.826], ['B', ' C ', 149.978, 100.236, 100.818], ['B', ' O ', 150.817, 101.09, 101.082], ['B', ' CB ', 151.484, 98.536, 101.779], ['B', ' OG1', 151.802, 97.137, 101.816], ['B', ' CG2', 151.078, 98.976, 103.13], ['B', ' H ', 149.753, 98.079, 98.922], ['B', ' HA ', 149.45, 98.261, 101.209], ['B', ' HB ', 152.353, 99.113, 101.502], ['B', ' HG1', 152.048, 96.811, 100.91], ['B', ' HG2', 151.86, 98.816, 103.798], ['B', ' HG2', 150.833, 100.02, 103.161], ['B', ' HG2', 150.224, 98.424, 103.423]]
[['B', ' N ', 148.714, 100.519, 100.545], ['B', ' CA ', 148.323, 101.885, 100.38], ['B', ' C ', 148.773, 102.654, 101.605], ['B', ' O ', 148.398, 102.282, 102.714], ['B', ' H ', 148.046, 99.784, 100.418], ['B', ' HA ', 148.711, 102.263, 99.45], ['B', ' HA ', 147.241, 101.934, 100.295]]
[['B', ' N ', 149.52, 103.744, 101.402], ['B', ' CA ', 150.062, 104.59, 102.428], ['B', ' C ', 149.132, 105.758, 102.472], ['B', ' O ', 148.628, 106.184, 101.437], ['B', ' CB ', 151.542, 104.952, 102.092], ['B', ' SG ', 152.036, 106.001, 100.493], ['B', ' H ', 149.743, 104.001, 100.457], ['B', ' HA ', 150.052, 104.068, 103.387], ['B', ' HB ', 151.965, 105.479, 102.958], ['B', ' HB ', 152.1, 104.015, 102.031]]
[['B', ' N ', 148.867, 106.289, 103.656], ['B', ' CA ', 147.98, 107.442, 103.863], ['B', ' C ', 146.516, 107.1, 103.522], ['B', ' O ', 145.647, 107.09, 104.38], ['B', ' CB ', 148.438, 108.641, 103.025], ['B', ' CG ', 149.784, 109.181, 103.418], ['B', ' CD1', 150.946, 108.645, 102.893], ['B', ' CD2', 149.9, 110.248, 104.251], ['B', ' CE1', 152.191, 109.163, 103.209], ['B', ' CE2', 151.145, 110.773, 104.575], ['B', ' CZ ', 152.289, 110.235, 104.059], ['B', ' H ', 149.343, 105.876, 104.457], ['B', ' HA ', 148.027, 107.724, 104.917], ['B', ' HB ', 148.458, 108.427, 101.969], ['B', ' HB ', 147.715, 109.446, 103.161], ['B', ' HD1', 150.871, 107.821, 102.214], ['B', ' HD2', 149.0, 110.692, 104.651], ['B', ' HE1', 153.086, 108.719, 102.774], ['B', ' HE2', 151.214, 111.617, 105.231], ['B', ' HZ ', 153.26, 110.658, 104.314]]
[['B', ' N ', 146.274, 106.681, 102.294], ['B', ' CA ', 144.99, 106.38, 101.703], ['B', ' C ', 144.213, 105.305, 102.432], ['B', ' O ', 142.985, 105.325, 102.439], ['B', ' CB ', 145.21, 105.992, 100.232], ['B', ' OG1', 143.986, 106.007, 99.561], ['B', ' CG2', 145.818, 104.601, 100.104], ['B', ' H ', 147.06, 106.662, 101.672], ['B', ' HA ', 144.39, 107.292, 101.723], ['B', ' HB ', 145.889, 106.714, 99.773], ['B', ' HG1', 143.663, 106.912, 99.498], ['B', ' HG2', 145.97, 104.377, 99.049], ['B', ' HG2', 146.77, 104.582, 100.615], ['B', ' HG2', 145.16, 103.851, 100.527]]
[['B', ' N ', 144.879, 104.402, 103.133], ['B', ' CA ', 144.158, 103.373, 103.858], ['B', ' C ', 143.398, 103.937, 105.059], ['B', ' O ', 142.601, 103.223, 105.674], ['B', ' CB ', 145.08, 102.251, 104.279], ['B', ' CG ', 145.603, 101.353, 103.155], ['B', ' CD ', 144.567, 100.416, 102.623], ['B', ' NE ', 144.034, 99.556, 103.681], ['B', ' CZ ', 144.574, 98.386, 104.119], ['B', ' NH1', 145.663, 97.892, 103.575], ['B', ' NH2', 143.987, 97.738, 105.12], ['B', ' H ', 145.892, 104.386, 103.13], ['B', ' HA ', 143.418, 102.954, 103.18], ['B', ' HB ', 145.968, 102.7, 104.704], ['B', ' HB ', 144.617, 101.639, 105.048], ['B', ' HG ', 145.904, 101.987, 102.333], ['B', ' HG ', 146.46, 100.776, 103.508], ['B', ' HD ', 143.741, 100.969, 102.18], ['B', ' HD ', 145.013, 99.789, 101.857], ['B', ' HE ', 143.19, 99.876, 104.142], ['B', ' HH1', 146.115, 98.362, 102.812], ['B', ' HH1', 146.043, 97.012, 103.915], ['B', ' HH2', 143.15, 98.113, 105.543], ['B', ' HH2', 144.392, 96.857, 105.49]]
[['B', ' N ', 143.621, 105.218, 105.374], ['B', ' CA ', 142.924, 105.902, 106.447], ['B', ' C ', 141.741, 106.701, 105.893], ['B', ' O ', 141.063, 107.398, 106.65], ['B', ' CB ', 143.852, 106.86, 107.192], ['B', ' CG ', 144.923, 106.244, 108.008], ['B', ' CD1', 146.129, 105.953, 107.448], ['B', ' CD2', 144.72, 106.024, 109.344], ['B', ' CE1', 147.123, 105.437, 108.204], ['B', ' CE2', 145.727, 105.51, 110.111], ['B', ' CZ ', 146.927, 105.214, 109.541], ['B', ' OH ', 147.951, 104.707, 110.307], ['B', ' H ', 144.316, 105.747, 104.843], ['B', ' HA ', 142.541, 105.165, 107.147], ['B', ' HB ', 144.334, 107.504, 106.49], ['B', ' HB ', 143.26, 107.497, 107.843], ['B', ' HD1', 146.305, 106.131, 106.405], ['B', ' HD2', 143.761, 106.267, 109.798], ['B', ' HE1', 148.074, 105.211, 107.75], ['B', ' HE2', 145.574, 105.34, 111.176], ['B', ' HH ', 147.739, 104.8, 111.238]]
[['B', ' N ', 141.479, 106.608, 104.583], ['B', ' CA ', 140.344, 107.292, 103.97], ['B', ' C ', 139.046, 106.7, 104.45], ['B', ' O ', 138.876, 105.477, 104.451], ['B', ' CB ', 140.402, 107.197, 102.47], ['B', ' OG ', 139.229, 107.71, 101.902], ['B', ' H ', 142.072, 106.038, 103.978], ['B', ' HA ', 140.354, 108.335, 104.246], ['B', ' HB ', 141.263, 107.769, 102.113], ['B', ' HB ', 140.543, 106.162, 102.157], ['B', ' HG ', 138.707, 106.923, 101.613]]
[['B', ' N ', 138.101, 107.557, 104.842], ['B', ' CA ', 136.812, 107.075, 105.303], ['B', ' C ', 135.642, 107.693, 104.552], ['B', ' O ', 134.501, 107.609, 104.999], ['B', ' CB ', 136.683, 107.298, 106.802], ['B', ' CG ', 137.7, 106.477, 107.654], ['B', ' CD ', 137.457, 104.992, 107.605], ['B', ' NE ', 138.425, 104.24, 108.405], ['B', ' CZ ', 139.615, 103.742, 107.955], ['B', ' NH1', 140.019, 103.908, 106.708], ['B', ' NH2', 140.384, 103.068, 108.796], ['B', ' H ', 138.272, 108.553, 104.836], ['B', ' HA ', 136.76, 106.008, 105.108], ['B', ' HB ', 136.83, 108.354, 107.029], ['B', ' HB ', 135.68, 107.027, 107.128], ['B', ' HG ', 138.707, 106.665, 107.306], ['B', ' HG ', 137.622, 106.789, 108.693], ['B', ' HD ', 136.463, 104.787, 108.002], ['B', ' HD ', 137.512, 104.62, 106.594], ['B', ' HE ', 138.187, 104.071, 109.372], ['B', ' HH1', 139.463, 104.432, 106.013], ['B', ' HH1', 140.926, 103.517, 106.398], ['B', ' HH2', 140.089, 102.93, 109.751], ['B', ' HH2', 141.268, 102.684, 108.485]]
[['B', ' N ', 135.922, 108.328, 103.427], ['B', ' CA ', 134.869, 108.928, 102.619], ['B', ' C ', 134.492, 110.294, 103.098], ['B', ' O ', 135.165, 110.887, 103.944], ['B', ' H ', 136.883, 108.367, 103.115], ['B', ' HA ', 135.195, 109.026, 101.591], ['B', ' HA ', 133.991, 108.282, 102.619]]
[['B', ' N ', 133.435, 110.833, 102.515], ['B', ' CA ', 133.074, 112.187, 102.837], ['B', ' C ', 134.013, 112.987, 101.987], ['B', ' O ', 134.646, 112.403, 101.113], ['B', ' H ', 132.922, 110.332, 101.784], ['B', ' HA ', 132.037, 112.388, 102.573], ['B', ' HA ', 133.226, 112.389, 103.895]]
[['B', ' N ', 134.158, 114.277, 102.28], ['B', ' CA ', 134.954, 115.215, 101.485], ['B', ' C ', 134.137, 115.694, 100.328], ['B', ' O ', 133.819, 114.941, 99.419], ['B', ' CB ', 136.261, 114.596, 100.967], ['B', ' CG ', 137.15, 115.494, 100.156], ['B', ' CD ', 137.702, 116.522, 100.876], ['B', ' OE1', 138.556, 116.282, 101.758], ['B', ' NE2', 137.205, 117.718, 100.571], ['B', ' H ', 133.616, 114.639, 103.048], ['B', ' HA ', 135.2, 116.078, 102.107], ['B', ' HB ', 136.805, 114.207, 101.812], ['B', ' HB ', 136.087, 113.821, 100.274], ['B', ' HG ', 137.976, 114.908, 99.797], ['B', ' HG ', 136.588, 115.912, 99.311], ['B', ' HE2', 137.498, 118.542, 101.103], ['B', ' HE2', 136.489, 117.795, 99.809]]
[['B', ' N ', 133.814, 116.97, 100.348], ['B', ' CA ', 132.958, 117.481, 99.321], ['B', ' C ', 133.62, 117.482, 98.003], ['B', ' O ', 134.85, 117.561, 97.907], ['B', ' CB ', 132.422, 118.855, 99.644], ['B', ' CG ', 131.443, 118.841, 100.757], ['B', ' CD ', 130.242, 117.994, 100.367], ['B', ' OE1', 129.779, 118.056, 99.221], ['B', ' NE2', 129.739, 117.199, 101.305], ['B', ' H ', 134.142, 117.566, 101.095], ['B', ' HA ', 132.109, 116.806, 99.228], ['B', ' HB ', 133.243, 119.516, 99.917], ['B', ' HB ', 131.952, 119.269, 98.767], ['B', ' HG ', 131.9, 118.406, 101.641], ['B', ' HG ', 131.105, 119.859, 100.962], ['B', ' HE2', 128.946, 116.62, 101.103], ['B', ' HE2', 130.144, 117.179, 102.219]]
[['B', ' N ', 132.74, 117.41, 97.008], ['B', ' CA ', 133.003, 117.271, 95.596], ['B', ' C ', 133.354, 115.832, 95.333], ['B', ' O ', 134.511, 115.477, 95.218], ['B', ' CB ', 134.09, 118.178, 95.11], ['B', ' H ', 131.768, 117.407, 97.293], ['B', ' HA ', 132.086, 117.511, 95.054], ['B', ' HB ', 134.186, 118.013, 94.051], ['B', ' HB ', 133.806, 119.201, 95.289], ['B', ' HB ', 135.034, 117.97, 95.593]]
[['B', ' N ', 132.298, 115.022, 95.23], ['B', ' CA ', 132.3, 113.564, 95.079], ['B', ' C ', 132.738, 112.74, 96.323], ['B', ' O ', 133.576, 111.833, 96.196], ['B', ' CB ', 133.217, 113.178, 93.945], ['B', ' CG ', 132.924, 113.757, 92.631], ['B', ' CD ', 131.772, 113.236, 92.006], ['B', ' OE1', 131.489, 112.036, 92.059], ['B', ' NE2', 131.083, 114.099, 91.339], ['B', ' H ', 131.397, 115.475, 95.291], ['B', ' HA ', 131.295, 113.255, 94.795], ['B', ' HB ', 134.235, 113.362, 94.164], ['B', ' HB ', 133.099, 112.121, 93.818], ['B', ' HG ', 132.797, 114.83, 92.72], ['B', ' HG ', 133.736, 113.557, 91.977], ['B', ' HE2', 130.292, 113.799, 90.779], ['B', ' HE2', 131.38, 115.064, 91.308]]
[['B', ' N ', 132.021, 112.879, 97.466], ['B', ' CA ', 132.22, 112.225, 98.763], ['B', ' C ', 132.013, 110.708, 98.738], ['B', ' O ', 132.298, 109.989, 99.709], ['B', ' CB ', 131.155, 112.892, 99.641], ['B', ' CG ', 130.111, 113.358, 98.697], ['B', ' CD ', 130.863, 113.792, 97.478], ['B', ' HA ', 133.231, 112.472, 99.12], ['B', ' HB ', 130.774, 112.171, 100.374], ['B', ' HB ', 131.611, 113.719, 100.203], ['B', ' HG ', 129.388, 112.551, 98.495], ['B', ' HG ', 129.544, 114.185, 99.153], ['B', ' HD ', 130.21, 113.676, 96.617], ['B', ' HD ', 131.2, 114.828, 97.63]]
[['B', ' N ', 131.435, 110.225, 97.646], ['B', ' CA ', 131.139, 108.824, 97.449], ['B', ' C ', 132.361, 107.964, 97.148], ['B', ' O ', 132.266, 106.742, 97.2], ['B', ' CB ', 130.15, 108.677, 96.321], ['B', ' OG ', 130.723, 109.062, 95.105], ['B', ' H ', 131.188, 110.839, 96.886], ['B', ' HA ', 130.681, 108.448, 98.363], ['B', ' HB ', 129.822, 107.637, 96.259], ['B', ' HB ', 129.272, 109.288, 96.524], ['B', ' HG ', 130.053, 108.9, 94.43]]
[['B', ' N ', 133.515, 108.566, 96.845], ['B', ' CA ', 134.68, 107.741, 96.499], ['B', ' C ', 135.113, 106.786, 97.615], ['B', ' O ', 135.129, 105.565, 97.432], ['B', ' CB ', 135.853, 108.639, 96.127], ['B', ' CG ', 135.792, 109.166, 94.741], ['B', ' ND1', 135.082, 110.268, 94.391], ['B', ' CD2', 136.365, 108.723, 93.613], ['B', ' CE1', 135.229, 110.478, 93.092], ['B', ' NE2', 136.0, 109.56, 92.611], ['B', ' H ', 133.552, 109.588, 96.811], ['B', ' HA ', 134.436, 107.135, 95.626], ['B', ' HB ', 135.853, 109.494, 96.797], ['B', ' HB ', 136.786, 108.126, 96.284], ['B', ' HD1', 134.522, 110.872, 95.008], ['B', ' HD2', 137.007, 107.904, 93.394], ['B', ' HE1', 134.76, 111.304, 92.582]]
[['B', ' N ', 135.452, 107.338, 98.773], ['B', ' CA ', 135.794, 106.593, 99.99], ['B', ' C ', 136.91, 105.55, 99.985], ['B', ' O ', 137.899, 105.69, 100.711], ['B', ' CB ', 134.53, 105.893, 100.52], ['B', ' CG ', 134.731, 105.101, 101.827], ['B', ' CD ', 133.474, 104.483, 102.383], ['B', ' OE1', 132.418, 104.695, 101.841], ['B', ' OE2', 133.582, 103.777, 103.355], ['B', ' H ', 135.431, 108.347, 98.818], ['B', ' HA ', 136.106, 107.32, 100.719], ['B', ' HB ', 133.751, 106.636, 100.689], ['B', ' HB ', 134.149, 105.198, 99.775], ['B', ' HG ', 135.439, 104.297, 101.669], ['B', ' HG ', 135.158, 105.754, 102.566]]
[['B', ' N ', 136.719, 104.474, 99.246], ['B', ' CA ', 137.584, 103.315, 99.378], ['B', ' C ', 138.679, 103.204, 98.354], ['B', ' O ', 138.431, 103.226, 97.15], ['B', ' CB ', 136.762, 102.059, 99.379], ['B', ' OG ', 137.595, 100.941, 99.427], ['B', ' H ', 135.933, 104.481, 98.603], ['B', ' HA ', 138.065, 103.381, 100.355], ['B', ' HB ', 136.094, 102.062, 100.241], ['B', ' HB ', 136.145, 102.024, 98.482], ['B', ' HG ', 137.018, 100.184, 99.566]]
[['B', ' N ', 139.897, 103.094, 98.864], ['B', ' CA ', 141.103, 102.967, 98.072], ['B', ' C ', 141.819, 101.666, 98.35], ['B', ' O ', 141.76, 101.142, 99.465], ['B', ' CB ', 142.036, 104.114, 98.361], ['B', ' CG ', 141.589, 105.427, 97.85], ['B', ' CD1', 140.629, 106.195, 98.479], ['B', ' CD2', 142.201, 105.926, 96.751], ['B', ' CE1', 140.3, 107.419, 97.974], ['B', ' CE2', 141.891, 107.143, 96.258], ['B', ' CZ ', 140.936, 107.891, 96.86], ['B', ' H ', 139.985, 103.094, 99.872], ['B', ' HA ', 140.821, 102.987, 97.032], ['B', ' HB ', 142.174, 104.2, 99.439], ['B', ' HB ', 143.014, 103.899, 97.927], ['B', ' HD1', 140.128, 105.83, 99.378], ['B', ' HD2', 142.961, 105.332, 96.268], ['B', ' HE1', 139.535, 108.029, 98.463], ['B', ' HE2', 142.408, 107.511, 95.368], ['B', ' HZ ', 140.68, 108.864, 96.455]]
[['B', ' N ', 142.478, 101.133, 97.333], ['B', ' CA ', 143.23, 99.905, 97.479], ['B', ' C ', 144.629, 100.008, 96.85], ['B', ' O ', 144.906, 100.933, 96.079], ['B', ' CB ', 142.445, 98.741, 96.827], ['B', ' CG1', 141.094, 98.579, 97.504], ['B', ' CG2', 142.277, 98.994, 95.35], ['B', ' H ', 142.445, 101.621, 96.435], ['B', ' HA ', 143.298, 99.707, 98.54], ['B', ' HB ', 142.984, 97.817, 96.966], ['B', ' HG1', 140.564, 97.742, 97.054], ['B', ' HG1', 141.242, 98.385, 98.566], ['B', ' HG1', 140.499, 99.479, 97.382], ['B', ' HG2', 141.736, 98.166, 94.9], ['B', ' HG2', 141.717, 99.921, 95.194], ['B', ' HG2', 143.254, 99.07, 94.881]]
[['B', ' N ', 145.548, 99.109, 97.203], ['B', ' CA ', 146.806, 98.888, 96.54], ['B', ' C ', 146.502, 98.415, 95.139], ['B', ' O ', 145.496, 97.753, 94.913], ['B', ' CB ', 147.429, 97.753, 97.344], ['B', ' CG ', 146.774, 97.824, 98.681], ['B', ' CD ', 145.386, 98.324, 98.427], ['B', ' HA ', 147.414, 99.804, 96.539], ['B', ' HB ', 147.248, 96.788, 96.84], ['B', ' HB ', 148.494, 97.895, 97.375], ['B', ' HG ', 146.749, 96.816, 99.135], ['B', ' HG ', 147.33, 98.444, 99.354], ['B', ' HD ', 144.714, 97.483, 98.285], ['B', ' HD ', 145.109, 98.944, 99.285]]
[['B', ' N ', 147.389, 98.665, 94.209], ['B', ' CA ', 147.176, 98.217, 92.856], ['B', ' C ', 147.143, 96.723, 92.842], ['B', ' O ', 146.309, 96.131, 92.162], ['B', ' CB ', 148.209, 98.806, 91.909], ['B', ' CG1', 147.899, 100.277, 91.831], ['B', ' CG2', 148.133, 98.123, 90.545], ['B', ' CD1', 148.859, 101.101, 91.209], ['B', ' H ', 148.259, 99.143, 94.44], ['B', ' HA ', 146.202, 98.565, 92.524], ['B', ' HB ', 149.213, 98.693, 92.329], ['B', ' HG1', 147.004, 100.382, 91.263], ['B', ' HG1', 147.737, 100.656, 92.837], ['B', ' HG2', 148.847, 98.547, 89.857], ['B', ' HG2', 148.351, 97.087, 90.661], ['B', ' HG2', 147.133, 98.236, 90.14], ['B', ' HD1', 148.499, 102.126, 91.192], ['B', ' HD1', 149.787, 101.055, 91.742], ['B', ' HD1', 148.978, 100.756, 90.219]]
[['B', ' N ', 148.002, 96.133, 93.645], ['B', ' CA ', 148.163, 94.701, 93.783], ['B', ' C ', 146.863, 93.979, 94.191], ['B', ' O ', 146.776, 92.762, 94.037], ['B', ' CB ', 149.257, 94.425, 94.799], ['B', ' H ', 148.632, 96.742, 94.153], ['B', ' HA ', 148.476, 94.306, 92.825], ['B', ' HB ', 149.422, 93.348, 94.883], ['B', ' HB ', 150.181, 94.907, 94.479], ['B', ' HB ', 148.956, 94.821, 95.764]]
[['B', ' N ', 145.868, 94.669, 94.76], ['B', ' CA ', 144.639, 93.963, 95.124], ['B', ' C ', 143.67, 93.863, 93.947], ['B', ' O ', 142.637, 93.197, 94.036], ['B', ' CB ', 143.907, 94.624, 96.287], ['B', ' CG ', 144.575, 94.489, 97.654], ['B', ' OD1', 145.393, 93.617, 97.858], ['B', ' OD2', 144.181, 95.222, 98.524], ['B', ' H ', 145.92, 95.683, 94.882], ['B', ' HA ', 144.905, 92.95, 95.427], ['B', ' HB ', 143.814, 95.692, 96.065], ['B', ' HB ', 142.898, 94.224, 96.354]]
[['B', ' N ', 143.967, 94.576, 92.869], ['B', ' CA ', 143.13, 94.606, 91.672], ['B', ' C ', 143.832, 93.914, 90.517], ['B', ' O ', 143.231, 93.195, 89.717], ['B', ' CB ', 142.868, 96.065, 91.261], ['B', ' CG ', 142.01, 96.31, 89.976], ['B', ' CD1', 140.587, 95.824, 90.182], ['B', ' CD2', 142.063, 97.778, 89.625], ['B', ' H ', 144.849, 95.087, 92.855], ['B', ' HA ', 142.199, 94.089, 91.886], ['B', ' HB ', 142.36, 96.557, 92.088], ['B', ' HB ', 143.83, 96.561, 91.127], ['B', ' HG ', 142.427, 95.742, 89.145], ['B', ' HD1', 140.014, 95.998, 89.274], ['B', ' HD1', 140.584, 94.759, 90.405], ['B', ' HD1', 140.132, 96.369, 91.009], ['B', ' HD2', 141.485, 97.967, 88.714], ['B', ' HD2', 141.655, 98.354, 90.442], ['B', ' HD2', 143.093, 98.057, 89.463]]
[['B', ' N ', 145.113, 94.203, 90.431], ['B', ' CA ', 146.015, 93.803, 89.386], ['B', ' C ', 147.06, 92.867, 89.908], ['B', ' O ', 147.612, 93.098, 90.971], ['B', ' CB ', 146.714, 95.046, 88.823], ['B', ' CG1', 145.679, 96.06, 88.299], ['B', ' CG2', 147.752, 94.711, 87.812], ['B', ' CD1', 144.751, 95.601, 87.166], ['B', ' H ', 145.511, 94.794, 91.158], ['B', ' HA ', 145.46, 93.286, 88.608], ['B', ' HB ', 147.199, 95.534, 89.637], ['B', ' HG1', 145.068, 96.369, 89.129], ['B', ' HG1', 146.233, 96.917, 87.951], ['B', ' HG2', 148.232, 95.624, 87.465], ['B', ' HG2', 148.512, 94.069, 88.232], ['B', ' HG2', 147.278, 94.212, 87.011], ['B', ' HD1', 144.081, 96.414, 86.899], ['B', ' HD1', 145.328, 95.321, 86.292], ['B', ' HD1', 144.153, 94.755, 87.489]]
[['B', ' N ', 147.371, 91.835, 89.155], ['B', ' CA ', 148.443, 90.965, 89.582], ['B', ' C ', 149.754, 91.685, 89.251], ['B', ' O ', 150.103, 91.854, 88.077], ['B', ' CB ', 148.348, 89.619, 88.853], ['B', ' CG ', 149.372, 88.591, 89.308], ['B', ' OD1', 150.261, 88.954, 90.029], ['B', ' OD2', 149.244, 87.446, 88.934], ['B', ' H ', 146.868, 91.659, 88.299], ['B', ' HA ', 148.384, 90.809, 90.659], ['B', ' HB ', 147.354, 89.199, 88.999], ['B', ' HB ', 148.48, 89.779, 87.782]]
[['B', ' N ', 150.408, 92.199, 90.293], ['B', ' CA ', 151.621, 93.004, 90.2], ['B', ' C ', 152.816, 92.171, 90.62], ['B', ' O ', 152.829, 91.629, 91.725], ['B', ' CB ', 151.494, 94.237, 91.125], ['B', ' CG1', 152.73, 95.061, 91.107], ['B', ' CG2', 150.355, 95.093, 90.677], ['B', ' H ', 150.023, 91.994, 91.207], ['B', ' HA ', 151.759, 93.33, 89.168], ['B', ' HB ', 151.33, 93.897, 92.146], ['B', ' HG1', 152.616, 95.914, 91.772], ['B', ' HG1', 153.57, 94.467, 91.439], ['B', ' HG1', 152.913, 95.414, 90.106], ['B', ' HG2', 150.274, 95.949, 91.343], ['B', ' HG2', 150.531, 95.434, 89.663], ['B', ' HG2', 149.449, 94.539, 90.701]]
[['B', ' N ', 153.793, 92.015, 89.729], ['B', ' CA ', 154.948, 91.2, 90.036], ['B', ' C ', 156.055, 91.882, 90.854], ['B', ' O ', 156.754, 91.216, 91.635], ['B', ' CB ', 155.469, 90.639, 88.721], ['B', ' CG ', 155.707, 91.739, 87.681], ['B', ' OD1', 154.734, 92.41, 87.27], ['B', ' OD2', 156.809, 91.894, 87.273], ['B', ' H ', 153.745, 92.452, 88.803], ['B', ' HA ', 154.594, 90.352, 90.625], ['B', ' HB ', 156.409, 90.11, 88.898], ['B', ' HB ', 154.75, 89.918, 88.324]]
[['B', ' N ', 156.176, 93.2, 90.733], ['B', ' CA ', 157.225, 93.946, 91.409], ['B', ' C ', 156.684, 95.04, 92.301], ['B', ' O ', 155.636, 95.617, 92.01], ['B', ' CB ', 158.092, 94.63, 90.359], ['B', ' CG ', 158.849, 93.792, 89.354], ['B', ' CD1', 159.414, 94.719, 88.292], ['B', ' CD2', 159.962, 93.046, 90.035], ['B', ' H ', 155.562, 93.721, 90.096], ['B', ' HA ', 157.807, 93.27, 92.025], ['B', ' HB ', 157.44, 95.222, 89.765], ['B', ' HB ', 158.767, 95.274, 90.856], ['B', ' HG ', 158.175, 93.086, 88.872], ['B', ' HD1', 159.959, 94.136, 87.553], ['B', ' HD1', 158.596, 95.245, 87.8], ['B', ' HD1', 160.081, 95.437, 88.756], ['B', ' HD2', 160.507, 92.456, 89.3], ['B', ' HD2', 160.644, 93.742, 90.515], ['B', ' HD2', 159.544, 92.399, 90.758]]
[['B', ' N ', 157.383, 95.346, 93.385], ['B', ' CA ', 156.971, 96.521, 94.126], ['B', ' C ', 158.121, 97.234, 94.739], ['B', ' O ', 158.928, 96.667, 95.464], ['B', ' CB ', 156.01, 96.175, 95.223], ['B', ' H ', 158.19, 94.785, 93.684], ['B', ' HA ', 156.511, 97.207, 93.424], ['B', ' HB ', 155.715, 97.082, 95.747], ['B', ' HB ', 155.148, 95.711, 94.786], ['B', ' HB ', 156.487, 95.513, 95.913]]
[['B', ' N ', 158.093, 98.525, 94.565], ['B', ' CA ', 159.078, 99.417, 95.09], ['B', ' C ', 158.447, 100.322, 96.127], ['B', ' O ', 157.908, 101.359, 95.762], ['B', ' CB ', 159.666, 100.222, 93.921], ['B', ' CG ', 160.917, 101.109, 94.165], ['B', ' CD1', 161.682, 101.203, 92.892], ['B', ' CD2', 160.491, 102.522, 94.572], ['B', ' H ', 157.371, 98.922, 93.958], ['B', ' HA ', 159.878, 98.833, 95.505], ['B', ' HB ', 159.922, 99.516, 93.137], ['B', ' HB ', 158.881, 100.868, 93.533], ['B', ' HG ', 161.559, 100.673, 94.923], ['B', ' HD1', 162.568, 101.817, 93.035], ['B', ' HD1', 161.976, 100.203, 92.609], ['B', ' HD1', 161.057, 101.638, 92.119], ['B', ' HD2', 161.354, 103.14, 94.696], ['B', ' HD2', 159.853, 102.955, 93.798], ['B', ' HD2', 159.955, 102.502, 95.499]]
[['B', ' N ', 158.415, 99.939, 97.403], ['B', ' CA ', 157.834, 100.703, 98.462], ['B', ' C ', 158.704, 101.904, 98.727], ['B', ' O ', 159.876, 101.947, 98.342], ['B', ' CB ', 157.796, 99.719, 99.626], ['B', ' CG ', 158.91, 98.764, 99.343], ['B', ' CD ', 158.914, 98.622, 97.844], ['B', ' HA ', 156.819, 101.011, 98.179], ['B', ' HB ', 157.906, 100.258, 100.576], ['B', ' HB ', 156.81, 99.231, 99.655], ['B', ' HG ', 159.865, 99.157, 99.721], ['B', ' HG ', 158.739, 97.804, 99.858], ['B', ' HD ', 159.916, 98.417, 97.543], ['B', ' HD ', 158.224, 97.825, 97.547]]
[['B', ' N ', 158.131, 102.853, 99.418], ['B', ' CA ', 158.788, 104.072, 99.835], ['B', ' C ', 157.696, 105.054, 100.133], ['B', ' O ', 156.656, 105.005, 99.458], ['B', ' H ', 157.165, 102.72, 99.701], ['B', ' HA ', 159.443, 103.917, 100.673], ['B', ' HA ', 159.387, 104.43, 99.023]]
[['B', ' N ', 157.895, 105.965, 101.123], ['B', ' CA ', 156.855, 106.929, 101.472], ['B', ' C ', 156.916, 107.963, 100.343], ['B', ' O ', 155.937, 108.164, 99.632], ['B', ' CB ', 157.04, 107.446, 102.914], ['B', ' SG ', 156.953, 106.125, 104.242], ['B', ' H ', 158.768, 105.993, 101.646], ['B', ' HA ', 155.875, 106.436, 101.437], ['B', ' HB ', 157.982, 107.909, 103.05], ['B', ' HB ', 156.28, 108.195, 103.143]]
[['B', ' N ', 158.003, 108.748, 100.181], ['B', ' CA ', 158.48, 109.181, 98.904], ['B', ' C ', 159.605, 108.187, 98.588], ['B', ' O ', 160.596, 108.209, 99.319], ['B', ' CB ', 159.01, 110.563, 99.146], ['B', ' CG ', 159.488, 110.536, 100.57], ['B', ' CD ', 158.661, 109.469, 101.275], ['B', ' HA ', 157.655, 109.181, 98.181], ['B', ' HB ', 159.811, 110.741, 98.434], ['B', ' HB ', 158.238, 111.292, 98.933], ['B', ' HG ', 160.565, 110.32, 100.605], ['B', ' HG ', 159.356, 111.522, 101.038], ['B', ' HD ', 159.392, 108.845, 101.768], ['B', ' HD ', 157.947, 109.945, 101.964]]
[['B', ' N ', 159.524, 107.269, 97.639], ['B', ' CA ', 160.602, 106.347, 97.37], ['B', ' C ', 161.804, 107.171, 97.0], ['B', ' O ', 161.671, 108.206, 96.349], ['B', ' CB ', 160.051, 105.497, 96.24], ['B', ' CG ', 158.932, 106.322, 95.654], ['B', ' CD ', 158.38, 107.133, 96.812], ['B', ' HA ', 160.831, 105.765, 98.264], ['B', ' HB ', 160.851, 105.299, 95.514], ['B', ' HB ', 159.706, 104.528, 96.625], ['B', ' HG ', 159.305, 106.974, 94.853], ['B', ' HG ', 158.163, 105.674, 95.188], ['B', ' HD ', 158.064, 108.093, 96.42], ['B', ' HD ', 157.564, 106.608, 97.341]]
[['B', ' N ', 162.967, 106.74, 97.463], ['B', ' CA ', 164.19, 107.475, 97.242], ['B', ' C ', 164.595, 107.431, 95.793], ['B', ' O ', 164.402, 106.409, 95.136], ['B', ' CB ', 165.289, 106.827, 98.069], ['B', ' OG ', 165.575, 105.542, 97.583], ['B', ' H ', 163.008, 105.879, 97.974], ['B', ' HA ', 164.015, 108.5, 97.565], ['B', ' HB ', 166.193, 107.427, 98.064], ['B', ' HB ', 164.956, 106.749, 99.099], ['B', ' HG ', 166.039, 105.066, 98.314]]
[['B', ' N ', 165.264, 108.464, 95.275], ['B', ' CA ', 165.749, 108.479, 93.927], ['B', ' C ', 166.79, 107.417, 93.681], ['B', ' O ', 166.87, 106.868, 92.588], ['B', ' CB ', 166.361, 109.872, 93.829], ['B', ' CG ', 166.632, 110.294, 95.247], ['B', ' CD ', 165.548, 109.675, 96.051], ['B', ' HA ', 164.906, 108.38, 93.229], ['B', ' HB ', 167.285, 109.834, 93.255], ['B', ' HB ', 165.693, 110.533, 93.286], ['B', ' HG ', 167.63, 109.966, 95.55], ['B', ' HG ', 166.627, 111.394, 95.309], ['B', ' HD ', 165.948, 109.473, 97.048], ['B', ' HD ', 164.662, 110.335, 96.072]]
[['B', ' N ', 167.505, 107.014, 94.725], ['B', ' CA ', 168.525, 106.017, 94.531], ['B', ' C ', 167.933, 104.653, 94.312], ['B', ' O ', 168.421, 103.909, 93.464], ['B', ' CB ', 169.491, 106.025, 95.701], ['B', ' CG ', 170.333, 107.302, 95.748], ['B', ' CD ', 171.273, 107.376, 96.902], ['B', ' OE1', 171.244, 106.496, 97.722], ['B', ' OE2', 172.034, 108.318, 96.957], ['B', ' H ', 167.431, 107.456, 95.629], ['B', ' HA ', 169.089, 106.282, 93.637], ['B', ' HB ', 168.934, 105.944, 96.639], ['B', ' HB ', 170.16, 105.167, 95.636], ['B', ' HG ', 170.908, 107.372, 94.825], ['B', ' HG ', 169.663, 108.161, 95.785]]
[['B', ' N ', 166.862, 104.309, 95.026], ['B', ' CA ', 166.315, 102.99, 94.788], ['B', ' C ', 165.659, 103.006, 93.438], ['B', ' O ', 165.656, 101.999, 92.742], ['B', ' CB ', 165.33, 102.495, 95.87], ['B', ' CG1', 165.066, 100.99, 95.732], ['B', ' CG2', 164.006, 103.185, 95.814], ['B', ' CD1', 166.21, 100.065, 96.014], ['B', ' H ', 166.466, 104.937, 95.729], ['B', ' HA ', 167.143, 102.297, 94.746], ['B', ' HB ', 165.77, 102.671, 96.844], ['B', ' HG1', 164.3, 100.759, 96.4], ['B', ' HG1', 164.712, 100.785, 94.725], ['B', ' HG2', 163.364, 102.802, 96.6], ['B', ' HG2', 164.133, 104.23, 95.948], ['B', ' HG2', 163.541, 102.995, 94.871], ['B', ' HD1', 165.874, 99.034, 95.908], ['B', ' HD1', 167.036, 100.228, 95.335], ['B', ' HD1', 166.523, 100.233, 97.024]]
[['B', ' N ', 165.08, 104.141, 93.061], ['B', ' CA ', 164.434, 104.188, 91.781], ['B', ' C ', 165.465, 104.023, 90.695], ['B', ' O ', 165.263, 103.236, 89.778], ['B', ' CB ', 163.717, 105.523, 91.598], ['B', ' CG1', 162.533, 105.589, 92.59], ['B', ' CG2', 163.275, 105.667, 90.136], ['B', ' CD1', 161.906, 106.981, 92.751], ['B', ' H ', 165.07, 104.949, 93.691], ['B', ' HA ', 163.72, 103.377, 91.707], ['B', ' HB ', 164.387, 106.34, 91.851], ['B', ' HG1', 161.779, 104.894, 92.275], ['B', ' HG1', 162.885, 105.273, 93.566], ['B', ' HG2', 162.771, 106.6, 90.019], ['B', ' HG2', 164.128, 105.649, 89.461], ['B', ' HG2', 162.606, 104.852, 89.872], ['B', ' HD1', 161.107, 106.925, 93.471], ['B', ' HD1', 162.655, 107.681, 93.115], ['B', ' HD1', 161.507, 107.341, 91.819]]
[['B', ' N ', 166.576, 104.748, 90.759], ['B', ' CA ', 167.555, 104.595, 89.71], ['B', ' C ', 168.097, 103.18, 89.684], ['B', ' O ', 168.246, 102.59, 88.616], ['B', ' CB ', 168.695, 105.561, 89.902], ['B', ' H ', 166.726, 105.415, 91.518], ['B', ' HA ', 167.072, 104.805, 88.76], ['B', ' HB ', 169.414, 105.445, 89.096], ['B', ' HB ', 168.315, 106.563, 89.907], ['B', ' HB ', 169.179, 105.356, 90.859]]
[['B', ' N ', 168.329, 102.584, 90.85], ['B', ' CA ', 168.88, 101.252, 90.855], ['B', ' C ', 167.958, 100.227, 90.259], ['B', ' O ', 168.427, 99.369, 89.511], ['B', ' CB ', 169.249, 100.824, 92.264], ['B', ' CG ', 170.472, 101.498, 92.84], ['B', ' CD ', 170.685, 101.049, 94.278], ['B', ' CE ', 171.901, 101.676, 94.918], ['B', ' NZ ', 173.164, 101.109, 94.374], ['B', ' H ', 168.188, 103.076, 91.736], ['B', ' HA ', 169.787, 101.263, 90.253], ['B', ' HB ', 168.408, 101.032, 92.929], ['B', ' HB ', 169.417, 99.75, 92.285], ['B', ' HG ', 171.334, 101.224, 92.24], ['B', ' HG ', 170.358, 102.575, 92.801], ['B', ' HD ', 169.804, 101.308, 94.869], ['B', ' HD ', 170.807, 99.967, 94.304], ['B', ' HE ', 171.886, 102.753, 94.746], ['B', ' HE ', 171.863, 101.489, 95.994], ['B', ' HZ ', 173.957, 101.532, 94.83], ['B', ' HZ ', 173.159, 100.111, 94.554], ['B', ' HZ ', 173.224, 101.271, 93.384]]
[['B', ' N ', 166.657, 100.312, 90.52], ['B', ' CA ', 165.79, 99.294, 89.984], ['B', ' C ', 165.385, 99.553, 88.551], ['B', ' O ', 165.181, 98.597, 87.801], ['B', ' CB ', 164.532, 99.18, 90.819], ['B', ' OG1', 163.851, 100.423, 90.771], ['B', ' CG2', 164.923, 98.849, 92.253], ['B', ' H ', 166.28, 101.022, 91.16], ['B', ' HA ', 166.319, 98.348, 90.029], ['B', ' HB ', 163.883, 98.41, 90.42], ['B', ' HG1', 162.961, 100.313, 91.097], ['B', ' HG2', 164.056, 98.798, 92.871], ['B', ' HG2', 165.43, 97.896, 92.264], ['B', ' HG2', 165.579, 99.602, 92.651]]
[['B', ' N ', 165.323, 100.805, 88.096], ['B', ' CA ', 164.938, 100.944, 86.7], ['B', ' C ', 166.135, 100.562, 85.853], ['B', ' O ', 165.969, 99.956, 84.795], ['B', ' CB ', 164.371, 102.338, 86.327], ['B', ' CG1', 163.138, 102.635, 87.211], ['B', ' CG2', 165.42, 103.417, 86.444], ['B', ' H ', 165.454, 101.607, 88.725], ['B', ' HA ', 164.14, 100.232, 86.493], ['B', ' HB ', 164.018, 102.308, 85.297], ['B', ' HG1', 162.702, 103.595, 86.933], ['B', ' HG1', 162.398, 101.848, 87.069], ['B', ' HG1', 163.43, 102.663, 88.257], ['B', ' HG2', 164.981, 104.369, 86.168], ['B', ' HG2', 165.773, 103.465, 87.447], ['B', ' HG2', 166.244, 103.21, 85.784]]
[['B', ' N ', 167.34, 100.883, 86.325], ['B', ' CA ', 168.533, 100.513, 85.616], ['B', ' C ', 168.737, 99.01, 85.709], ['B', ' O ', 169.059, 98.375, 84.709], ['B', ' CB ', 169.743, 101.278, 86.127], ['B', ' CG1', 171.013, 100.752, 85.459], ['B', ' CG2', 169.526, 102.753, 85.808], ['B', ' H ', 167.433, 101.417, 87.194], ['B', ' HA ', 168.402, 100.783, 84.571], ['B', ' HB ', 169.844, 101.139, 87.207], ['B', ' HG1', 171.871, 101.315, 85.825], ['B', ' HG1', 171.155, 99.699, 85.694], ['B', ' HG1', 170.93, 100.873, 84.378], ['B', ' HG2', 170.374, 103.337, 86.16], ['B', ' HG2', 169.42, 102.857, 84.746], ['B', ' HG2', 168.625, 103.113, 86.288]]
[['B', ' N ', 168.543, 98.404, 86.882], ['B', ' CA ', 168.69, 96.971, 86.948], ['B', ' C ', 167.712, 96.321, 85.977], ['B', ' O ', 168.062, 95.348, 85.315], ['B', ' CB ', 168.458, 96.48, 88.362], ['B', ' H ', 168.329, 98.917, 87.737], ['B', ' HA ', 169.702, 96.711, 86.641], ['B', ' HB ', 168.57, 95.403, 88.41], ['B', ' HB ', 169.174, 96.948, 89.035], ['B', ' HB ', 167.466, 96.747, 88.659]]
[['B', ' N ', 166.493, 96.846, 85.83], ['B', ' CA ', 165.609, 96.252, 84.84], ['B', ' C ', 166.127, 96.496, 83.431], ['B', ' O ', 166.142, 95.578, 82.617], ['B', ' CB ', 164.172, 96.766, 85.018], ['B', ' CG ', 163.416, 96.207, 86.256], ['B', ' CD1', 162.177, 96.966, 86.513], ['B', ' CD2', 163.003, 94.754, 85.961], ['B', ' H ', 166.164, 97.613, 86.423], ['B', ' HA ', 165.612, 95.18, 84.996], ['B', ' HB ', 164.217, 97.851, 85.126], ['B', ' HB ', 163.597, 96.531, 84.125], ['B', ' HG ', 164.047, 96.278, 87.133], ['B', ' HD1', 161.67, 96.549, 87.375], ['B', ' HD1', 162.421, 98.012, 86.71], ['B', ' HD1', 161.545, 96.883, 85.654], ['B', ' HD2', 162.451, 94.349, 86.808], ['B', ' HD2', 162.386, 94.75, 85.092], ['B', ' HD2', 163.86, 94.129, 85.769]]
[['B', ' N ', 166.671, 97.681, 83.165], ['B', ' CA ', 167.195, 98.032, 81.848], ['B', ' C ', 168.295, 97.063, 81.433], ['B', ' O ', 168.376, 96.648, 80.275], ['B', ' CB ', 167.775, 99.459, 81.911], ['B', ' CG ', 168.329, 100.12, 80.639], ['B', ' CD1', 167.23, 100.275, 79.596], ['B', ' CD2', 168.913, 101.487, 81.034], ['B', ' H ', 166.623, 98.415, 83.874], ['B', ' HA ', 166.381, 97.976, 81.132], ['B', ' HB ', 167.015, 100.117, 82.329], ['B', ' HB ', 168.603, 99.438, 82.597], ['B', ' HG ', 169.119, 99.495, 80.209], ['B', ' HD1', 167.64, 100.757, 78.705], ['B', ' HD1', 166.835, 99.301, 79.321], ['B', ' HD1', 166.429, 100.893, 79.997], ['B', ' HD2', 169.322, 101.981, 80.148], ['B', ' HD2', 168.127, 102.102, 81.461], ['B', ' HD2', 169.704, 101.345, 81.772]]
[['B', ' N ', 169.123, 96.684, 82.399], ['B', ' CA ', 170.239, 95.78, 82.184], ['B', ' C ', 169.959, 94.32, 82.564], ['B', ' O ', 170.888, 93.512, 82.616], ['B', ' CB ', 171.43, 96.284, 82.956], ['B', ' CG ', 171.937, 97.573, 82.414], ['B', ' OD1', 171.912, 97.828, 81.203], ['B', ' ND2', 172.417, 98.407, 83.291], ['B', ' H ', 168.994, 97.122, 83.316], ['B', ' HA ', 170.479, 95.791, 81.122], ['B', ' HB ', 171.141, 96.432, 84.001], ['B', ' HB ', 172.229, 95.547, 82.933], ['B', ' HD2', 172.78, 99.291, 82.995], ['B', ' HD2', 172.425, 98.161, 84.261]]
[['B', ' N ', 168.7, 93.99, 82.854], ['B', ' CA ', 168.247, 92.657, 83.254], ['B', ' C ', 168.953, 92.071, 84.488], ['B', ' O ', 169.136, 90.849, 84.601], ['B', ' CB ', 168.385, 91.705, 82.084], ['B', ' CG ', 167.53, 92.113, 80.93], ['B', ' OD1', 166.338, 92.408, 81.09], ['B', ' ND2', 168.114, 92.147, 79.759], ['B', ' H ', 167.97, 94.704, 82.772], ['B', ' HA ', 167.189, 92.74, 83.512], ['B', ' HB ', 169.421, 91.645, 81.758], ['B', ' HB ', 168.084, 90.707, 82.396], ['B', ' HD2', 167.594, 92.42, 78.95], ['B', ' HD2', 169.081, 91.908, 79.676]]
[['B', ' N ', 169.287, 92.899, 85.467], ['B', ' CA ', 169.946, 92.377, 86.65], ['B', ' C ', 168.936, 91.899, 87.659], ['B', ' O ', 168.53, 92.621, 88.58], ['B', ' CB ', 170.887, 93.406, 87.277], ['B', ' CG ', 171.663, 92.843, 88.488], ['B', ' OD1', 171.228, 91.838, 89.051], ['B', ' OD2', 172.684, 93.389, 88.825], ['B', ' H ', 169.08, 93.889, 85.38], ['B', ' HA ', 170.551, 91.523, 86.352], ['B', ' HB ', 171.603, 93.755, 86.521], ['B', ' HB ', 170.323, 94.26, 87.596]]
[['B', ' N ', 168.522, 90.657, 87.494], ['B', ' CA ', 167.486, 90.183, 88.367], ['B', ' C ', 167.999, 89.586, 89.653], ['B', ' O ', 167.209, 89.194, 90.507], ['B', ' CB ', 166.494, 89.307, 87.646], ['B', ' CG ', 165.724, 90.117, 86.591], ['B', ' SD ', 164.454, 89.21, 85.738], ['B', ' CE ', 163.159, 89.251, 87.005], ['B', ' H ', 168.893, 90.108, 86.712], ['B', ' HA ', 166.92, 91.046, 88.655], ['B', ' HB ', 167.016, 88.486, 87.151], ['B', ' HB ', 165.799, 88.88, 88.362], ['B', ' HG ', 165.251, 90.958, 87.082], ['B', ' HG ', 166.424, 90.511, 85.851], ['B', ' HE ', 162.272, 88.733, 86.638], ['B', ' HE ', 163.507, 88.762, 87.913], ['B', ' HE ', 162.901, 90.289, 87.23]]
[['B', ' N ', 169.312, 89.539, 89.839], ['B', ' CA ', 169.788, 89.046, 91.116], ['B', ' C ', 169.505, 90.169, 92.094], ['B', ' O ', 169.027, 89.947, 93.208], ['B', ' CB ', 171.289, 88.773, 91.099], ['B', ' CG ', 171.733, 87.576, 90.255], ['B', ' OD1', 170.929, 86.742, 89.907], ['B', ' OD2', 172.913, 87.519, 89.963], ['B', ' H ', 169.957, 89.867, 89.123], ['B', ' HA ', 169.236, 88.154, 91.407], ['B', ' HB ', 171.794, 89.662, 90.712], ['B', ' HB ', 171.636, 88.636, 92.125]]
[['B', ' N ', 169.73, 91.398, 91.62], ['B', ' CA ', 169.458, 92.592, 92.393], ['B', ' C ', 167.973, 92.769, 92.636], ['B', ' O ', 167.554, 93.085, 93.745], ['B', ' CB ', 169.983, 93.845, 91.713], ['B', ' CG ', 169.687, 95.066, 92.539], ['B', ' CD1', 170.448, 95.323, 93.657], ['B', ' CD2', 168.646, 95.914, 92.202], ['B', ' CE1', 170.176, 96.401, 94.438], ['B', ' CE2', 168.379, 96.998, 92.993], ['B', ' CZ ', 169.135, 97.239, 94.108], ['B', ' OH ', 168.847, 98.314, 94.91], ['B', ' H ', 170.175, 91.494, 90.693], ['B', ' HA ', 169.95, 92.49, 93.36], ['B', ' HB ', 171.063, 93.769, 91.565], ['B', ' HB ', 169.518, 93.959, 90.731], ['B', ' HD1', 171.268, 94.659, 93.928], ['B', ' HD2', 168.038, 95.718, 91.319], ['B', ' HE1', 170.777, 96.592, 95.324], ['B', ' HE2', 167.569, 97.668, 92.747], ['B', ' HH ', 169.51, 98.38, 95.627]]
[['B', ' N ', 167.176, 92.597, 91.586], ['B', ' CA ', 165.738, 92.809, 91.646], ['B', ' C ', 164.916, 91.698, 92.283], ['B', ' O ', 163.86, 91.99, 92.836], ['B', ' CB ', 165.236, 92.974, 90.238], ['B', ' CG ', 165.75, 94.168, 89.506], ['B', ' CD1', 165.485, 93.964, 88.1], ['B', ' CD2', 165.024, 95.426, 89.97], ['B', ' H ', 167.604, 92.368, 90.683], ['B', ' HA ', 165.567, 93.715, 92.219], ['B', ' HB ', 165.445, 92.096, 89.689], ['B', ' HB ', 164.151, 93.071, 90.285], ['B', ' HG ', 166.82, 94.275, 89.656], ['B', ' HD1', 165.834, 94.807, 87.546], ['B', ' HD1', 165.995, 93.079, 87.748], ['B', ' HD1', 164.436, 93.843, 87.988], ['B', ' HD2', 165.378, 96.274, 89.403], ['B', ' HD2', 163.957, 95.312, 89.797], ['B', ' HD2', 165.201, 95.605, 91.026]]
[['B', ' N ', 165.349, 90.441, 92.244], ['B', ' CA ', 164.536, 89.383, 92.837], ['B', ' C ', 164.026, 89.676, 94.254], ['B', ' O ', 162.933, 89.24, 94.569], ['B', ' CB ', 165.225, 88.016, 92.755], ['B', ' CG ', 164.451, 86.876, 93.425], ['B', ' CD ', 163.1, 86.575, 92.796], ['B', ' OE1', 162.984, 86.355, 91.586], ['B', ' NE2', 162.069, 86.561, 93.628], ['B', ' H ', 166.202, 90.184, 91.74], ['B', ' HA ', 163.654, 89.286, 92.207], ['B', ' HB ', 165.303, 87.749, 91.701], ['B', ' HB ', 166.235, 88.038, 93.125], ['B', ' HG ', 165.057, 85.978, 93.334], ['B', ' HG ', 164.3, 87.098, 94.481], ['B', ' HE2', 161.149, 86.369, 93.291], ['B', ' HE2', 162.209, 86.768, 94.602]]
[['B', ' N ', 164.79, 90.256, 95.184], ['B', ' CA ', 164.321, 90.658, 96.5], ['B', ' C ', 163.201, 91.725, 96.476], ['B', ' O ', 162.486, 91.88, 97.462], ['B', ' CB ', 165.608, 91.18, 97.136], ['B', ' CG ', 166.698, 90.476, 96.397], ['B', ' CD ', 166.221, 90.367, 95.017], ['B', ' HA ', 163.968, 89.76, 97.03], ['B', ' HB ', 165.684, 92.265, 97.009], ['B', ' HB ', 165.616, 90.967, 98.217], ['B', ' HG ', 167.607, 91.05, 96.42], ['B', ' HG ', 166.921, 89.504, 96.852], ['B', ' HD ', 166.462, 91.251, 94.511], ['B', ' HD ', 166.682, 89.509, 94.571]]
[['B', ' N ', 163.063, 92.478, 95.368], ['B', ' CA ', 162.028, 93.506, 95.218], ['B', ' C ', 160.802, 92.828, 94.632], ['B', ' O ', 159.638, 93.248, 94.781], ['B', ' CB ', 162.488, 94.637, 94.307], ['B', ' CG ', 161.462, 95.735, 94.203], ['B', ' SD ', 161.896, 97.09, 93.171], ['B', ' CE ', 161.596, 96.465, 91.541], ['B', ' H ', 163.664, 92.321, 94.572], ['B', ' HA ', 161.782, 93.904, 96.191], ['B', ' HB ', 163.418, 95.054, 94.68], ['B', ' HB ', 162.683, 94.239, 93.312], ['B', ' HG ', 160.529, 95.337, 93.835], ['B', ' HG ', 161.285, 96.119, 95.2], ['B', ' HE ', 161.825, 97.23, 90.803], ['B', ' HE ', 162.208, 95.59, 91.362], ['B', ' HE ', 160.57, 96.202, 91.464]]
[['B', ' N ', 161.081, 91.782, 93.895], ['B', ' CA ', 160.065, 90.998, 93.272], ['B', ' C ', 159.382, 90.33, 94.433], ['B', ' O ', 160.012, 89.975, 95.424], ['B', ' CB ', 160.695, 90.014, 92.278], ['B', ' CG ', 159.782, 89.359, 91.219], ['B', ' CD1', 160.636, 89.066, 89.99], ['B', ' CD2', 159.165, 88.07, 91.739], ['B', ' H ', 162.058, 91.535, 93.73], ['B', ' HA ', 159.348, 91.633, 92.774], ['B', ' HB ', 161.496, 90.533, 91.758], ['B', ' HB ', 161.136, 89.208, 92.849], ['B', ' HG ', 158.988, 90.052, 90.936], ['B', ' HD1', 160.017, 88.616, 89.212], ['B', ' HD1', 161.067, 89.993, 89.614], ['B', ' HD1', 161.441, 88.375, 90.26], ['B', ' HD2', 158.543, 87.63, 90.961], ['B', ' HD2', 159.952, 87.377, 91.999], ['B', ' HD2', 158.556, 88.255, 92.604]]
[['B', ' N ', 158.08, 90.238, 94.359], ['B', ' CA ', 157.274, 89.66, 95.428], ['B', ' C ', 157.142, 90.572, 96.672], ['B', ' O ', 156.408, 90.237, 97.598], ['B', ' CB ', 157.846, 88.293, 95.86], ['B', ' CG ', 156.775, 87.298, 96.368], ['B', ' OD1', 155.687, 87.302, 95.826], ['B', ' OD2', 157.063, 86.53, 97.267], ['B', ' H ', 157.622, 90.559, 93.495], ['B', ' HA ', 156.272, 89.492, 95.031], ['B', ' HB ', 158.379, 87.837, 95.028], ['B', ' HB ', 158.57, 88.441, 96.665]]
[['B', ' N ', 157.629, 91.833, 96.631], ['B', ' CA ', 157.304, 92.743, 97.742], ['B', ' C ', 155.919, 93.286, 97.457], ['B', ' O ', 155.285, 93.944, 98.273], ['B', ' CB ', 158.264, 93.931, 97.927], ['B', ' CG ', 159.699, 93.665, 98.38], ['B', ' CD1', 160.472, 95.01, 98.371], ['B', ' CD2', 159.72, 93.068, 99.776], ['B', ' H ', 158.256, 92.155, 95.88], ['B', ' HA ', 157.263, 92.173, 98.663], ['B', ' HB ', 158.348, 94.441, 96.965], ['B', ' HB ', 157.815, 94.625, 98.638], ['B', ' HG ', 160.177, 92.979, 97.685], ['B', ' HD1', 161.507, 94.838, 98.676], ['B', ' HD1', 160.453, 95.439, 97.368], ['B', ' HD1', 160.004, 95.705, 99.061], ['B', ' HD2', 160.75, 92.907, 100.073], ['B', ' HD2', 159.245, 93.752, 100.478], ['B', ' HD2', 159.199, 92.118, 99.787]]
[['B', ' N ', 155.408, 92.926, 96.289], ['B', ' CA ', 154.083, 93.26, 95.829], ['B', ' C ', 153.083, 92.471, 96.662], ['B', ' O ', 151.892, 92.772, 96.671], ['B', ' CB ', 153.947, 92.972, 94.346], ['B', ' H ', 156.006, 92.404, 95.669], ['B', ' HA ', 153.898, 94.315, 96.013], ['B', ' HB ', 152.944, 93.228, 94.012], ['B', ' HB ', 154.667, 93.554, 93.783], ['B', ' HB ', 154.124, 91.913, 94.159]]
[['B', ' N ', 153.58, 91.456, 97.388], ['B', ' CA ', 152.77, 90.636, 98.254], ['B', ' C ', 152.407, 91.386, 99.538], ['B', ' O ', 151.586, 90.904, 100.32], ['B', ' H ', 154.573, 91.222, 97.353], ['B', ' HA ', 151.864, 90.333, 97.73], ['B', ' HA ', 153.322, 89.728, 98.501]]
[['B', ' N ', 153.009, 92.556, 99.77], ['B', ' CA ', 152.67, 93.341, 100.936], ['B', ' C ', 151.622, 94.345, 100.542], ['B', ' O ', 151.906, 95.369, 99.916], ['B', ' CB ', 153.875, 94.1, 101.485], ['B', ' CG ', 154.872, 93.27, 102.152], ['B', ' CD1', 155.797, 92.581, 101.417], ['B', ' CD2', 154.883, 93.216, 103.532], ['B', ' CE1', 156.734, 91.811, 102.043], ['B', ' CE2', 155.824, 92.451, 104.172], ['B', ' CZ ', 156.748, 91.743, 103.427], ['B', ' OH ', 157.684, 90.964, 104.058], ['B', ' H ', 153.7, 92.928, 99.114], ['B', ' HA ', 152.258, 92.691, 101.707], ['B', ' HB ', 154.368, 94.626, 100.665], ['B', ' HB ', 153.53, 94.856, 102.194], ['B', ' HD1', 155.779, 92.64, 100.342], ['B', ' HD2', 154.144, 93.78, 104.11], ['B', ' HE1', 157.464, 91.256, 101.455], ['B', ' HE2', 155.841, 92.399, 105.261], ['B', ' HH ', 158.248, 90.542, 103.403]]
[['B', ' N ', 150.408, 94.081, 100.97], ['B', ' CA ', 149.279, 94.911, 100.639], ['B', ' C ', 148.812, 95.643, 101.883], ['B', ' O ', 147.945, 96.521, 101.839], ['B', ' CB ', 148.178, 94.042, 100.041], ['B', ' OG1', 147.789, 93.047, 100.997], ['B', ' CG2', 148.718, 93.36, 98.776], ['B', ' H ', 150.23, 93.227, 101.487], ['B', ' HA ', 149.583, 95.646, 99.897], ['B', ' HB ', 147.313, 94.652, 99.786], ['B', ' HG1', 146.979, 92.619, 100.684], ['B', ' HG2', 147.934, 92.738, 98.34], ['B', ' HG2', 149.014, 94.119, 98.06], ['B', ' HG2', 149.578, 92.737, 99.015]]
[['B', ' N ', 149.413, 95.282, 102.998], ['B', ' CA ', 149.12, 95.874, 104.276], ['B', ' C ', 150.402, 95.873, 105.084], ['B', ' O ', 151.107, 94.861, 105.123], ['B', ' CB ', 148.018, 95.093, 104.976], ['B', ' CG ', 147.541, 95.693, 106.274], ['B', ' CD ', 146.374, 94.941, 106.849], ['B', ' OE1', 146.597, 93.946, 107.493], ['B', ' OE2', 145.246, 95.354, 106.629], ['B', ' H ', 150.124, 94.574, 102.936], ['B', ' HA ', 148.786, 96.898, 104.136], ['B', ' HB ', 147.157, 95.005, 104.313], ['B', ' HB ', 148.371, 94.084, 105.186], ['B', ' HG ', 148.358, 95.679, 106.997], ['B', ' HG ', 147.256, 96.731, 106.105]]
[['B', ' N ', 150.733, 97.015, 105.674], ['B', ' CA ', 151.912, 97.153, 106.516], ['B', ' C ', 151.804, 98.468, 107.297], ['B', ' O ', 151.112, 99.382, 106.844], ['B', ' CB ', 153.207, 97.081, 105.703], ['B', ' H ', 150.09, 97.794, 105.619], ['B', ' HA ', 151.91, 96.318, 107.221], ['B', ' HB ', 154.049, 97.149, 106.388], ['B', ' HB ', 153.258, 96.133, 105.176], ['B', ' HB ', 153.267, 97.871, 105.007]]
[['B', ' N ', 152.466, 98.543, 108.459], ['B', ' CA ', 152.613, 99.707, 109.345], ['B', ' C ', 153.682, 99.406, 110.382], ['B', ' O ', 154.264, 98.318, 110.415], ['B', ' CB ', 151.267, 100.068, 110.04], ['B', ' SG ', 151.256, 101.546, 111.234], ['B', ' H ', 152.958, 97.68, 108.712], ['B', ' HA ', 152.939, 100.56, 108.744], ['B', ' HB ', 150.521, 100.261, 109.283], ['B', ' HB ', 150.913, 99.196, 110.603]]
[['B', ' N ', 153.92, 100.321, 111.291], ['B', ' CA ', 154.722, 99.907, 112.393], ['B', ' C ', 153.713, 98.951, 112.989], ['B', ' O ', 152.582, 98.918, 112.527], ['B', ' H ', 153.503, 101.241, 111.245], ['B', ' HA ', 155.633, 99.404, 112.067], ['B', ' HA ', 154.96, 100.733, 113.054]]
[['B', ' N ', 154.062, 98.188, 113.99], ['B', ' CA ', 153.2, 97.114, 114.527], ['B', ' C ', 153.522, 95.821, 113.76], ['B', ' O ', 153.481, 94.746, 114.347], ['B', ' CB ', 151.682, 97.337, 114.365], ['B', ' SG ', 151.045, 98.858, 115.075], ['B', ' H ', 154.981, 98.312, 114.388], ['B', ' HA ', 153.423, 96.972, 115.582], ['B', ' HB ', 151.339, 97.219, 113.333], ['B', ' HB ', 151.194, 96.533, 114.911], ['B', ' HG ', 151.523, 99.601, 114.05]]
[['B', ' N ', 154.041, 95.914, 112.526], ['B', ' CA ', 154.529, 94.718, 111.832], ['B', ' C ', 155.805, 94.33, 112.544], ['B', ' O ', 156.126, 93.161, 112.789], ['B', ' CB ', 154.841, 95.03, 110.387], ['B', ' CG ', 153.626, 95.331, 109.615], ['B', ' OD1', 152.552, 94.949, 109.998], ['B', ' OD2', 153.762, 96.019, 108.644], ['B', ' H ', 154.047, 96.809, 112.019], ['B', ' HA ', 153.794, 93.919, 111.902], ['B', ' HB ', 155.518, 95.888, 110.327], ['B', ' HB ', 155.34, 94.178, 109.926]]
[['B', ' N ', 156.439, 95.344, 113.073], ['B', ' CA ', 157.642, 95.191, 113.824], ['B', ' C ', 157.369, 94.637, 115.205], ['B', ' O ', 158.3, 94.488, 115.962], ['B', ' CB ', 158.327, 96.535, 113.957], ['B', ' CG ', 158.842, 97.155, 112.68], ['B', ' CD1', 159.283, 98.559, 112.977], ['B', ' CD2', 160.022, 96.339, 112.155], ['B', ' H ', 156.117, 96.275, 112.851], ['B', ' HA ', 158.278, 94.483, 113.312], ['B', ' HB ', 157.635, 97.231, 114.423], ['B', ' HB ', 159.179, 96.407, 114.624], ['B', ' HG ', 158.056, 97.189, 111.926], ['B', ' HD1', 159.658, 99.017, 112.063], ['B', ' HD1', 158.438, 99.139, 113.349], ['B', ' HD1', 160.064, 98.541, 113.73], ['B', ' HD2', 160.396, 96.806, 111.26], ['B', ' HD2', 160.816, 96.315, 112.905], ['B', ' HD2', 159.731, 95.328, 111.918]]
[['B', ' N ', 156.094, 94.478, 115.589], ['B', ' CA ', 155.704, 93.871, 116.847], ['B', ' C ', 154.968, 92.561, 116.569], ['B', ' O ', 154.395, 91.97, 117.493], ['B', ' CB ', 154.778, 94.782, 117.643], ['B', ' CG ', 155.362, 96.085, 118.055], ['B', ' CD ', 156.495, 95.924, 119.002], ['B', ' OE1', 156.504, 95.003, 119.822], ['B', ' NE2', 157.443, 96.828, 118.928], ['B', ' H ', 155.33, 94.672, 114.951], ['B', ' HA ', 156.591, 93.645, 117.431], ['B', ' HB ', 153.887, 94.984, 117.052], ['B', ' HB ', 154.455, 94.263, 118.544], ['B', ' HG ', 155.738, 96.593, 117.169], ['B', ' HG ', 154.593, 96.688, 118.535], ['B', ' HE2', 158.221, 96.803, 119.553], ['B', ' HE2', 157.378, 97.567, 118.255]]
[['B', ' N ', 154.914, 92.16, 115.296], ['B', ' CA ', 154.17, 90.987, 114.866], ['B', ' C ', 155.052, 89.957, 114.192], ['B', ' O ', 154.948, 88.757, 114.473], ['B', ' CB ', 153.06, 91.387, 113.879], ['B', ' OG1', 152.177, 92.325, 114.499], ['B', ' CG2', 152.264, 90.164, 113.462], ['B', ' H ', 155.418, 92.679, 114.589], ['B', ' HA ', 153.716, 90.525, 115.74], ['B', ' HB ', 153.502, 91.846, 113.001], ['B', ' HG1', 152.624, 93.203, 114.543], ['B', ' HG2', 151.48, 90.467, 112.772], ['B', ' HG2', 152.905, 89.435, 112.971], ['B', ' HG2', 151.816, 89.711, 114.346]]
[['B', ' N ', 155.881, 90.428, 113.265], ['B', ' CA ', 156.746, 89.593, 112.454], ['B', ' C ', 158.198, 89.694, 112.93], ['B', ' O ', 158.984, 88.763, 112.773], ['B', ' CB ', 156.602, 90.06, 111.024], ['B', ' CG ', 155.211, 89.866, 110.465], ['B', ' CD ', 155.089, 90.388, 109.041], ['B', ' CE ', 153.661, 90.241, 108.528], ['B', ' NZ ', 153.507, 90.763, 107.142], ['B', ' H ', 155.879, 91.422, 113.083], ['B', ' HA ', 156.427, 88.555, 112.542], ['B', ' HB ', 156.798, 91.116, 110.992], ['B', ' HB ', 157.327, 89.556, 110.389], ['B', ' HG ', 154.96, 88.807, 110.486], ['B', ' HG ', 154.5, 90.399, 111.088], ['B', ' HD ', 155.367, 91.446, 109.015], ['B', ' HD ', 155.766, 89.838, 108.387], ['B', ' HE ', 153.382, 89.188, 108.542], ['B', ' HE ', 152.99, 90.794, 109.188], ['B', ' HZ ', 152.548, 90.651, 106.839], ['B', ' HZ ', 153.75, 91.748, 107.114], ['B', ' HZ ', 154.118, 90.241, 106.527]]
[['B', ' N ', 158.544, 90.851, 113.47], ['B', ' CA ', 159.859, 91.177, 114.007], ['B', ' C ', 159.576, 91.607, 115.433], ['B', ' O ', 158.416, 91.845, 115.744], ['B', ' CB ', 160.595, 92.2, 113.12], ['B', ' CG1', 161.91, 92.636, 113.722], ['B', ' CG2', 160.887, 91.535, 111.778], ['B', ' H ', 157.827, 91.572, 113.499], ['B', ' HA ', 160.465, 90.272, 114.042], ['B', ' HB ', 159.98, 93.07, 112.976], ['B', ' HG1', 162.386, 93.324, 113.043], ['B', ' HG1', 161.739, 93.14, 114.652], ['B', ' HG1', 162.556, 91.773, 113.873], ['B', ' HG2', 161.4, 92.239, 111.124], ['B', ' HG2', 161.517, 90.658, 111.933], ['B', ' HG2', 159.966, 91.219, 111.311]]
[['B', ' N ', 160.567, 91.522, 116.336], ['B', ' CA ', 160.442, 91.766, 117.81], ['B', ' C ', 159.741, 90.576, 118.392], ['B', ' O ', 160.274, 89.834, 119.225], ['B', ' CB ', 159.667, 93.034, 118.213], ['B', ' CG1', 159.448, 93.064, 119.705], ['B', ' CG2', 160.436, 94.265, 117.827], ['B', ' H ', 161.457, 91.26, 115.945], ['B', ' HA ', 161.429, 91.822, 118.257], ['B', ' HB ', 158.716, 93.029, 117.757], ['B', ' HG1', 158.902, 93.968, 119.965], ['B', ' HG1', 158.87, 92.206, 120.031], ['B', ' HG1', 160.401, 93.058, 120.208], ['B', ' HG2', 159.85, 95.134, 118.113], ['B', ' HG2', 161.374, 94.283, 118.334], ['B', ' HG2', 160.594, 94.278, 116.752]]
[['B', ' N ', 158.562, 90.359, 117.896], ['B', ' CA ', 157.842, 89.229, 118.255], ['B', ' C ', 158.605, 88.195, 117.495], ['B', ' O ', 159.619, 88.501, 116.849], ['B', ' CB ', 156.442, 89.389, 117.763], ['B', ' CG ', 155.486, 88.594, 118.424], ['B', ' OD1', 155.776, 87.449, 118.819], ['B', ' ND2', 154.317, 89.153, 118.568], ['B', ' H ', 158.173, 91.021, 117.242], ['B', ' HA ', 157.895, 89.035, 119.326], ['B', ' HB ', 156.18, 90.416, 117.892], ['B', ' HB ', 156.41, 89.178, 116.698], ['B', ' HD2', 153.571, 88.669, 119.022], ['B', ' HD2', 154.178, 90.102, 118.2]]
[['B', ' N ', 158.209, 86.975, 117.617], ['B', ' CA ', 158.906, 85.891, 116.963], ['B', ' C ', 160.369, 85.75, 117.449], ['B', ' O ', 161.069, 84.887, 116.926], ['B', ' CB ', 158.969, 86.103, 115.439], ['B', ' CG ', 157.68, 86.43, 114.749], ['B', ' CD ', 156.655, 85.405, 114.858], ['B', ' OE1', 156.933, 84.205, 114.98], ['B', ' NE2', 155.418, 85.856, 114.798], ['B', ' H ', 157.369, 86.801, 118.168], ['B', ' HA ', 158.381, 84.96, 117.181], ['B', ' HB ', 159.694, 86.864, 115.171], ['B', ' HB ', 159.314, 85.185, 114.98], ['B', ' HG ', 157.273, 87.353, 115.151], ['B', ' HG ', 157.899, 86.574, 113.7], ['B', ' HE2', 154.643, 85.228, 114.861], ['B', ' HE2', 155.253, 86.868, 114.681]]
[['B', ' N ', 160.841, 86.563, 118.43], ['B', ' CA ', 162.195, 86.458, 118.957], ['B', ' C ', 163.261, 87.031, 118.024], ['B', ' O ', 164.425, 86.656, 118.127], ['B', ' H ', 160.264, 87.311, 118.827], ['B', ' HA ', 162.238, 86.981, 119.912], ['B', ' HA ', 162.42, 85.414, 119.163]]
[['B', ' N ', 162.885, 87.907, 117.099], ['B', ' CA ', 163.888, 88.4, 116.159], ['B', ' C ', 164.561, 89.774, 116.331], ['B', ' O ', 165.706, 89.938, 115.918], ['B', ' CB ', 163.261, 88.348, 114.773], ['B', ' CG ', 162.86, 86.978, 114.238], ['B', ' CD1', 162.188, 87.164, 112.898], ['B', ' CD2', 164.079, 86.104, 114.074], ['B', ' H ', 161.898, 88.184, 117.032], ['B', ' HA ', 164.708, 87.695, 116.189], ['B', ' HB ', 162.366, 88.961, 114.787], ['B', ' HB ', 163.925, 88.749, 114.081], ['B', ' HG ', 162.153, 86.5, 114.914], ['B', ' HD1', 161.894, 86.189, 112.505], ['B', ' HD1', 161.301, 87.786, 113.015], ['B', ' HD1', 162.873, 87.642, 112.2], ['B', ' HD2', 163.786, 85.156, 113.658], ['B', ' HD2', 164.77, 86.588, 113.399], ['B', ' HD2', 164.57, 85.925, 115.023]]
[['B', ' N ', 163.919, 90.781, 116.894], ['B', ' CA ', 164.565, 92.106, 116.838], ['B', ' C ', 165.786, 92.158, 117.722], ['B', ' O ', 165.808, 91.561, 118.801], ['B', ' CB ', 163.661, 93.257, 117.209], ['B', ' SG ', 164.395, 94.897, 116.951], ['B', ' H ', 163.02, 90.633, 117.327], ['B', ' HA ', 164.885, 92.282, 115.811], ['B', ' HB ', 162.775, 93.206, 116.629], ['B', ' HB ', 163.397, 93.176, 118.261], ['B', ' HG ', 163.235, 95.54, 116.864]]
[['B', ' N ', 166.823, 92.821, 117.226], ['B', ' CA ', 168.071, 92.956, 117.939], ['B', ' C ', 168.447, 94.405, 118.307], ['B', ' O ', 169.606, 94.701, 118.563], ['B', ' CB ', 169.172, 92.194, 117.181], ['B', ' CG1', 170.454, 91.951, 118.085], ['B', ' CG2', 169.531, 92.938, 115.899], ['B', ' CD1', 170.206, 91.143, 119.388], ['B', ' H ', 166.712, 93.292, 116.341], ['B', ' HA ', 167.95, 92.419, 118.853], ['B', ' HB ', 168.789, 91.207, 116.909], ['B', ' HG1', 171.159, 91.378, 117.493], ['B', ' HG1', 170.926, 92.875, 118.338], ['B', ' HG2', 170.279, 92.368, 115.349], ['B', ' HG2', 168.648, 93.049, 115.281], ['B', ' HG2', 169.936, 93.927, 116.131], ['B', ' HD1', 171.143, 91.009, 119.911], ['B', ' HD1', 169.532, 91.654, 120.048], ['B', ' HD1', 169.804, 90.204, 119.149]]
[['B', ' N ', 167.512, 95.348, 118.262], ['B', ' CA ', 167.894, 96.708, 118.655], ['B', ' C ', 168.79, 97.343, 117.598], ['B', ' O ', 169.718, 98.097, 117.921], ['B', ' H ', 166.556, 95.112, 118.034], ['B', ' HA ', 167.008, 97.31, 118.819], ['B', ' HA ', 168.414, 96.674, 119.609]]
[['B', ' N ', 168.547, 96.974, 116.348], ['B', ' CA ', 169.365, 97.42, 115.248], ['B', ' C ', 169.324, 98.886, 114.869], ['B', ' O ', 170.3, 99.4, 114.349], ['B', ' CB ', 168.925, 96.66, 114.019], ['B', ' SG ', 167.246, 97.067, 113.578], ['B', ' H ', 167.784, 96.342, 116.163], ['B', ' HA ', 170.389, 97.14, 115.484], ['B', ' HB ', 169.58, 96.892, 113.175], ['B', ' HB ', 168.987, 95.589, 114.201], ['B', ' HG ', 167.539, 98.263, 112.986]]
[['B', ' N ', 168.213, 99.564, 115.061], ['B', ' CA ', 168.11, 100.981, 114.714], ['B', ' C ', 167.661, 101.267, 113.275], ['B', ' O ', 167.209, 102.374, 112.986], ['B', ' H ', 167.405, 99.115, 115.477], ['B', ' HA ', 167.434, 101.488, 115.385], ['B', ' HA ', 169.07, 101.451, 114.896]]
[['B', ' N ', 167.734, 100.285, 112.368], ['B', ' CA ', 167.339, 100.565, 110.967], ['B', ' C ', 165.827, 100.804, 110.87], ['B', ' O ', 165.355, 101.671, 110.112], ['B', ' CB ', 167.679, 99.408, 110.094], ['B', ' OG1', 166.962, 98.335, 110.56], ['B', ' CG2', 169.095, 99.098, 110.15], ['B', ' H ', 168.061, 99.361, 112.622], ['B', ' HA ', 167.868, 101.454, 110.62], ['B', ' HB ', 167.399, 99.622, 109.063], ['B', ' HG1', 166.246, 98.19, 109.906], ['B', ' HG2', 169.257, 98.247, 109.514], ['B', ' HG2', 169.66, 99.932, 109.778], ['B', ' HG2', 169.404, 98.87, 111.163]]
[['B', ' N ', 165.056, 100.071, 111.694], ['B', ' CA ', 163.659, 100.259, 111.949], ['B', ' C ', 163.602, 101.405, 112.96], ['B', ' O ', 164.03, 101.271, 114.105], ['B', ' CB ', 162.962, 98.946, 112.37], ['B', ' SG ', 163.783, 97.877, 113.688], ['B', ' H ', 165.537, 99.336, 112.214], ['B', ' HA ', 163.169, 100.591, 111.023], ['B', ' HB ', 161.974, 99.182, 112.734], ['B', ' HB ', 162.825, 98.362, 111.502]]
[['B', ' N ', 163.071, 102.51, 112.472], ['B', ' CA ', 163.117, 103.862, 113.024], ['B', ' C ', 164.007, 104.73, 112.113], ['B', ' O ', 163.512, 105.747, 111.621], ['B', ' CB ', 163.628, 103.906, 114.459], ['B', ' H ', 162.685, 102.413, 111.551], ['B', ' HA ', 162.13, 104.272, 112.993], ['B', ' HB ', 163.617, 104.941, 114.8], ['B', ' HB ', 162.981, 103.315, 115.096], ['B', ' HB ', 164.651, 103.528, 114.518]]
[['B', ' N ', 165.241, 104.326, 111.751], ['B', ' CA ', 166.04, 105.182, 110.854], ['B', ' C ', 165.317, 105.446, 109.547], ['B', ' O ', 165.39, 106.539, 108.987], ['B', ' CB ', 167.358, 104.535, 110.451], ['B', ' CG ', 168.32, 105.485, 109.709], ['B', ' SD ', 169.894, 104.725, 109.379], ['B', ' CE ', 170.629, 105.668, 108.072], ['B', ' H ', 165.691, 103.486, 112.131], ['B', ' HA ', 166.234, 106.128, 111.349], ['B', ' HB ', 167.837, 104.053, 111.26], ['B', ' HB ', 167.126, 103.734, 109.751], ['B', ' HG ', 167.888, 105.846, 108.78], ['B', ' HG ', 168.503, 106.334, 110.353], ['B', ' HE ', 171.614, 105.262, 107.835], ['B', ' HE ', 169.998, 105.602, 107.192], ['B', ' HE ', 170.732, 106.706, 108.378]]
[['B', ' N ', 164.624, 104.428, 109.061], ['B', ' CA ', 163.901, 104.448, 107.8], ['B', ' C ', 162.417, 104.787, 107.897], ['B', ' O ', 161.679, 104.571, 106.936], ['B', ' CB ', 164.013, 103.098, 107.166], ['B', ' H ', 164.676, 103.543, 109.577], ['B', ' HA ', 164.378, 105.193, 107.163], ['B', ' HB ', 163.535, 103.129, 106.205], ['B', ' HB ', 165.036, 102.842, 107.047], ['B', ' HB ', 163.531, 102.359, 107.805]]
[['B', ' N ', 161.928, 105.237, 109.041], ['B', ' CA ', 160.486, 105.457, 109.14], ['B', ' C ', 159.892, 106.484, 108.17], ['B', ' O ', 158.747, 106.326, 107.757], ['B', ' CB ', 160.07, 105.794, 110.544], ['B', ' SG ', 158.278, 105.878, 110.714], ['B', ' H ', 162.553, 105.421, 109.836], ['B', ' HA ', 160.01, 104.505, 108.912], ['B', ' HB ', 160.442, 105.026, 111.209], ['B', ' HB ', 160.508, 106.73, 110.851], ['B', ' HG ', 157.999, 105.072, 109.686]]
[['B', ' N ', 160.613, 107.581, 107.903], ['B', ' CA ', 160.221, 108.692, 106.996], ['B', ' C ', 159.052, 109.583, 107.424], ['B', ' O ', 158.67, 110.489, 106.692], ['B', ' CB ', 159.865, 108.121, 105.627], ['B', ' CG ', 160.976, 107.387, 104.941], ['B', ' CD ', 160.427, 106.522, 103.884], ['B', ' OE1', 160.158, 106.805, 102.699], ['B', ' NE2', 160.202, 105.351, 104.349], ['B', ' H ', 161.54, 107.632, 108.315], ['B', ' HA ', 161.095, 109.335, 106.873], ['B', ' HB ', 159.014, 107.481, 105.696], ['B', ' HB ', 159.588, 108.941, 104.969], ['B', ' HG ', 161.65, 108.113, 104.482], ['B', ' HG ', 161.523, 106.77, 105.644], ['B', ' HE2', 159.801, 104.666, 103.766], ['B', ' HE2', 160.473, 105.121, 105.319]]
[['B', ' N ', 158.52, 109.372, 108.613], ['B', ' CA ', 157.547, 110.266, 109.22], ['B', ' C ', 158.11, 110.498, 110.596], ['B', ' O ', 157.708, 111.384, 111.354], ['B', ' CB ', 156.15, 109.674, 109.358], ['B', ' OG1', 156.18, 108.594, 110.284], ['B', ' CG2', 155.666, 109.173, 108.049], ['B', ' H ', 158.828, 108.583, 109.158], ['B', ' HA ', 157.507, 111.214, 108.68], ['B', ' HB ', 155.465, 110.442, 109.727], ['B', ' HG1', 155.228, 108.393, 110.506], ['B', ' HG2', 154.671, 108.766, 108.188], ['B', ' HG2', 155.63, 109.992, 107.335], ['B', ' HG2', 156.33, 108.394, 107.675]]
[['B', ' N ', 159.074, 109.64, 110.899], ['B', ' CA ', 159.712, 109.495, 112.187], ['B', ' C ', 158.735, 109.116, 113.292], ['B', ' O ', 158.917, 109.496, 114.446], ['B', ' CB ', 160.495, 110.74, 112.539], ['B', ' CG ', 161.611, 111.019, 111.555], ['B', ' CD ', 162.421, 112.197, 111.929], ['B', ' NE ', 163.541, 112.399, 110.986], ['B', ' CZ ', 164.442, 113.412, 111.033], ['B', ' NH1', 164.37, 114.339, 111.959], ['B', ' NH2', 165.412, 113.471, 110.138], ['B', ' H ', 159.358, 109.025, 110.153], ['B', ' HA ', 160.438, 108.687, 112.111], ['B', ' HB ', 159.846, 111.609, 112.588], ['B', ' HB ', 160.948, 110.614, 113.523], ['B', ' HG ', 162.266, 110.157, 111.517], ['B', ' HG ', 161.197, 111.178, 110.571], ['B', ' HD ', 161.792, 113.086, 111.918], ['B', ' HD ', 162.826, 112.054, 112.927], ['B', ' HE ', 163.655, 111.714, 110.251], ['B', ' HH1', 163.641, 114.322, 112.654], ['B', ' HH1', 165.051, 115.091, 111.975], ['B', ' HH2', 165.485, 112.764, 109.423], ['B', ' HH2', 166.093, 114.224, 110.182]]
[['B', ' N ', 157.731, 108.3, 112.941], ['B', ' CA ', 156.797, 107.753, 113.906], ['B', ' C ', 157.508, 106.81, 114.858], ['B', ' O ', 157.133, 106.683, 116.021], ['B', ' CB ', 155.682, 107.005, 113.212], ['B', ' H ', 157.581, 108.075, 111.958], ['B', ' HA ', 156.379, 108.579, 114.476], ['B', ' HB ', 154.978, 106.635, 113.948], ['B', ' HB ', 155.189, 107.67, 112.553], ['B', ' HB ', 156.083, 106.176, 112.652]]
[['B', ' N ', 158.506, 106.099, 114.362], ['B', ' CA ', 159.231, 105.156, 115.183], ['B', ' C ', 160.456, 105.742, 115.83], ['B', ' O ', 161.241, 106.459, 115.206], ['B', ' CB ', 159.672, 103.988, 114.341], ['B', ' CG ', 158.652, 103.092, 113.789], ['B', ' CD1', 159.304, 102.198, 112.835], ['B', ' CD2', 158.066, 102.256, 114.886], ['B', ' H ', 158.769, 106.209, 113.394], ['B', ' HA ', 158.573, 104.822, 115.975], ['B', ' HB ', 160.127, 104.417, 113.496], ['B', ' HB ', 160.407, 103.402, 114.895], ['B', ' HG ', 157.874, 103.664, 113.282], ['B', ' HD1', 158.546, 101.529, 112.441], ['B', ' HD1', 159.742, 102.78, 112.029], ['B', ' HD1', 160.083, 101.621, 113.335], ['B', ' HD2', 157.334, 101.565, 114.474], ['B', ' HD2', 158.853, 101.7, 115.361], ['B', ' HD2', 157.598, 102.868, 115.605]]
[['B', ' N ', 160.651, 105.345, 117.07], ['B', ' CA ', 161.784, 105.737, 117.889], ['B', ' C ', 162.114, 104.537, 118.759], ['B', ' O ', 161.216, 104.014, 119.412], ['B', ' CB ', 161.418, 106.965, 118.727], ['B', ' CG ', 162.594, 107.604, 119.439], ['B', ' OD1', 163.658, 107.06, 119.365], ['B', ' OD2', 162.417, 108.643, 120.045], ['B', ' H ', 159.908, 104.774, 117.491], ['B', ' HA ', 162.641, 105.963, 117.254], ['B', ' HB ', 160.953, 107.711, 118.078], ['B', ' HB ', 160.675, 106.676, 119.473]]
[['B', ' N ', 163.303, 103.961, 118.663], ['B', ' CA ', 163.506, 102.77, 119.469], ['B', ' C ', 163.787, 103.14, 120.904], ['B', ' O ', 164.637, 103.982, 121.189], ['B', ' CB ', 164.634, 101.902, 118.932], ['B', ' CG ', 164.379, 101.365, 117.555], ['B', ' SD ', 165.617, 100.283, 116.961], ['B', ' CE ', 165.073, 98.687, 117.376], ['B', ' H ', 164.043, 104.387, 118.118], ['B', ' HA ', 162.594, 102.204, 119.474], ['B', ' HB ', 165.54, 102.492, 118.886], ['B', ' HB ', 164.808, 101.068, 119.613], ['B', ' HG ', 163.474, 100.833, 117.535], ['B', ' HG ', 164.294, 102.191, 116.857], ['B', ' HE ', 165.782, 97.958, 117.017], ['B', ' HE ', 164.951, 98.6, 118.448], ['B', ' HE ', 164.141, 98.524, 116.877]]
[['B', ' N ', 163.096, 102.473, 121.815], ['B', ' CA ', 163.255, 102.703, 123.229], ['B', ' C ', 163.608, 101.384, 123.86], ['B', ' O ', 163.04, 100.349, 123.536], ['B', ' CB ', 161.957, 103.293, 123.819], ['B', ' OG1', 160.87, 102.369, 123.622], ['B', ' CG2', 161.629, 104.589, 123.075], ['B', ' H ', 162.42, 101.775, 121.506], ['B', ' HA ', 164.073, 103.402, 123.395], ['B', ' HB ', 162.084, 103.488, 124.883], ['B', ' HG1', 160.006, 102.796, 123.855], ['B', ' HG2', 160.709, 105.012, 123.48], ['B', ' HG2', 162.444, 105.3, 123.2], ['B', ' HG2', 161.487, 104.388, 122.017]]
[['B', ' N ', 164.607, 101.394, 124.72], ['B', ' CA ', 165.053, 100.183, 125.39], ['B', ' C ', 165.373, 99.074, 124.385], ['B', ' O ', 165.128, 97.899, 124.65], ['B', ' CB ', 164.006, 99.718, 126.369], ['B', ' CG ', 163.776, 100.71, 127.424], ['B', ' OD1', 164.72, 101.226, 128.037], ['B', ' ND2', 162.532, 101.018, 127.648], ['B', ' H ', 165.044, 102.276, 124.937], ['B', ' HA ', 165.973, 100.403, 125.933], ['B', ' HB ', 163.066, 99.51, 125.862], ['B', ' HB ', 164.332, 98.788, 126.833], ['B', ' HD2', 162.295, 101.691, 128.348], ['B', ' HD2', 161.817, 100.583, 127.1]]
[['B', ' N ', 165.925, 99.44, 123.23], ['B', ' CA ', 166.284, 98.457, 122.223], ['B', ' C ', 165.109, 97.941, 121.375], ['B', ' O ', 165.264, 96.93, 120.687], ['B', ' H ', 166.134, 100.414, 123.063], ['B', ' HA ', 167.034, 98.893, 121.562], ['B', ' HA ', 166.763, 97.611, 122.715]]
[['B', ' N ', 163.939, 98.577, 121.424], ['B', ' CA ', 162.798, 98.099, 120.65], ['B', ' C ', 162.066, 99.246, 119.997], ['B', ' O ', 161.876, 100.282, 120.617], ['B', ' CB ', 161.766, 97.45, 121.545], ['B', ' CG ', 162.177, 96.274, 122.278], ['B', ' CD ', 162.428, 95.129, 121.431], ['B', ' NE ', 162.707, 94.023, 122.251], ['B', ' CZ ', 163.894, 93.769, 122.798], ['B', ' NH1', 164.933, 94.562, 122.592], ['B', ' NH2', 164.02, 92.717, 123.581], ['B', ' H ', 163.812, 99.365, 122.063], ['B', ' HA ', 163.162, 97.406, 119.9], ['B', ' HB ', 161.472, 98.183, 122.299], ['B', ' HB ', 160.87, 97.2, 120.988], ['B', ' HG ', 163.065, 96.51, 122.856], ['B', ' HG ', 161.379, 96.0, 122.965], ['B', ' HD ', 161.542, 94.921, 120.852], ['B', ' HD ', 163.267, 95.289, 120.764], ['B', ' HE ', 161.948, 93.384, 122.452], ['B', ' HH1', 164.881, 95.383, 121.974], ['B', ' HH1', 165.829, 94.332, 123.046], ['B', ' HH2', 163.227, 92.114, 123.753], ['B', ' HH2', 164.916, 92.526, 124.015]]
[['B', ' N ', 161.545, 99.1, 118.793], ['B', ' CA ', 160.825, 100.159, 118.157], ['B', ' C ', 159.562, 100.444, 118.93], ['B', ' O ', 158.812, 99.517, 119.235], ['B', ' CB ', 160.547, 99.564, 116.78], ['B', ' CG ', 160.573, 98.066, 116.981], ['B', ' CD ', 161.522, 97.816, 118.108], ['B', ' HA ', 161.42, 101.066, 118.069], ['B', ' HB ', 159.571, 99.894, 116.429], ['B', ' HB ', 161.298, 99.924, 116.05], ['B', ' HG ', 159.559, 97.688, 117.186], ['B', ' HG ', 160.906, 97.576, 116.049], ['B', ' HD ', 161.085, 97.051, 118.742], ['B', ' HD ', 162.48, 97.518, 117.734]]
[['B', ' N ', 159.284, 101.716, 119.155], ['B', ' CA ', 158.069, 102.169, 119.791], ['B', ' C ', 157.39, 103.034, 118.758], ['B', ' O ', 158.039, 103.887, 118.144], ['B', ' CB ', 158.374, 102.926, 121.082], ['B', ' CG ', 157.156, 103.418, 121.832], ['B', ' CD ', 157.485, 104.084, 123.149], ['B', ' OE1', 158.4, 103.655, 123.835], ['B', ' OE2', 156.813, 105.032, 123.472], ['B', ' H ', 159.983, 102.431, 118.947], ['B', ' HA ', 157.429, 101.315, 120.018], ['B', ' HB ', 158.942, 102.278, 121.749], ['B', ' HB ', 159.002, 103.789, 120.858], ['B', ' HG ', 156.624, 104.136, 121.206], ['B', ' HG ', 156.493, 102.576, 122.013]]
[['B', ' N ', 156.114, 102.784, 118.497], ['B', ' CA ', 155.451, 103.527, 117.444], ['B', ' C ', 154.524, 104.638, 117.872], ['B', ' O ', 153.486, 104.414, 118.507], ['B', ' CB ', 154.617, 102.551, 116.601], ['B', ' CG ', 153.824, 103.159, 115.43], ['B', ' CD1', 154.798, 103.673, 114.374], ['B', ' CD2', 152.86, 102.133, 114.879], ['B', ' H ', 155.613, 102.081, 119.023], ['B', ' HA ', 156.217, 103.99, 116.836], ['B', ' HB ', 155.28, 101.793, 116.196], ['B', ' HB ', 153.901, 102.058, 117.259], ['B', ' HG ', 153.261, 103.995, 115.775], ['B', ' HD1', 154.265, 104.114, 113.563], ['B', ' HD1', 155.456, 104.419, 114.794], ['B', ' HD1', 155.385, 102.858, 113.998], ['B', ' HD2', 152.289, 102.56, 114.058], ['B', ' HD2', 153.391, 101.283, 114.534], ['B', ' HD2', 152.175, 101.824, 115.667]]
[['B', ' N ', 154.804, 105.833, 117.391], ['B', ' CA ', 153.924, 106.938, 117.631], ['B', ' C ', 152.894, 106.804, 116.548], ['B', ' O ', 153.055, 107.356, 115.462], ['B', ' CB ', 154.659, 108.256, 117.518], ['B', ' CG ', 153.821, 109.424, 117.865], ['B', ' OD1', 152.598, 109.306, 117.939], ['B', ' ND2', 154.44, 110.556, 118.082], ['B', ' H ', 155.68, 105.998, 116.891], ['B', ' HA ', 153.44, 106.838, 118.603], ['B', ' HB ', 155.537, 108.24, 118.165], ['B', ' HB ', 155.016, 108.38, 116.499], ['B', ' HD2', 153.919, 111.379, 118.327], ['B', ' HD2', 155.439, 110.6, 118.011]]
[['B', ' N ', 151.825, 106.089, 116.854], ['B', ' CA ', 150.843, 105.704, 115.855], ['B', ' C ', 150.166, 106.875, 115.186], ['B', ' O ', 149.799, 106.774, 114.018], ['B', ' CB ', 149.812, 104.806, 116.483], ['B', ' OG ', 149.049, 105.507, 117.415], ['B', ' H ', 151.787, 105.685, 117.792], ['B', ' HA ', 151.356, 105.135, 115.081], ['B', ' HB ', 149.166, 104.393, 115.711], ['B', ' HB ', 150.317, 103.971, 116.973], ['B', ' HG ', 148.438, 104.868, 117.795]]
[['B', ' N ', 150.152, 108.031, 115.836], ['B', ' CA ', 149.566, 109.245, 115.278], ['B', ' C ', 150.322, 109.686, 114.025], ['B', ' O ', 149.819, 110.473, 113.225], ['B', ' CB ', 149.606, 110.37, 116.309], ['B', ' CG ', 148.625, 110.182, 117.473], ['B', ' OD1', 147.708, 109.402, 117.366], ['B', ' OD2', 148.831, 110.809, 118.481], ['B', ' H ', 150.463, 108.044, 116.801], ['B', ' HA ', 148.53, 109.042, 115.005], ['B', ' HB ', 150.612, 110.45, 116.711], ['B', ' HB ', 149.385, 111.315, 115.817]]
[['B', ' N ', 151.56, 109.231, 113.882], ['B', ' CA ', 152.381, 109.564, 112.733], ['B', ' C ', 152.657, 108.385, 111.767], ['B', ' O ', 153.539, 108.524, 110.905], ['B', ' CB ', 153.704, 110.135, 113.191], ['B', ' CG ', 153.602, 111.418, 113.938], ['B', ' CD ', 154.934, 111.961, 114.267], ['B', ' NE ', 155.636, 112.348, 113.065], ['B', ' CZ ', 155.461, 113.495, 112.398], ['B', ' NH1', 154.606, 114.413, 112.803], ['B', ' NH2', 156.172, 113.682, 111.317], ['B', ' H ', 151.935, 108.568, 114.564], ['B', ' HA ', 151.862, 110.337, 112.166], ['B', ' HB ', 154.167, 109.429, 113.869], ['B', ' HB ', 154.372, 110.272, 112.341], ['B', ' HG ', 153.055, 112.137, 113.335], ['B', ' HG ', 153.063, 111.251, 114.873], ['B', ' HD ', 154.841, 112.828, 114.918], ['B', ' HD ', 155.524, 111.191, 114.77], ['B', ' HE ', 156.342, 111.7, 112.675], ['B', ' HH1', 154.072, 114.299, 113.673], ['B', ' HH1', 154.504, 115.267, 112.28], ['B', ' HH2', 156.828, 112.94, 111.054], ['B', ' HH2', 156.093, 114.536, 110.776]]
[['B', ' N ', 151.954, 107.216, 111.913], ['B', ' CA ', 152.128, 106.065, 111.03], ['B', ' C ', 151.169, 106.306, 109.893], ['B', ' O ', 150.036, 106.754, 110.063], ['B', ' CB ', 151.854, 104.676, 111.652], ['B', ' SG ', 152.309, 103.214, 110.482], ['B', ' H ', 151.231, 107.161, 112.643], ['B', ' HA ', 153.151, 106.05, 110.646], ['B', ' HB ', 152.412, 104.574, 112.562], ['B', ' HB ', 150.791, 104.577, 111.937]]
[['B', ' N ', 151.653, 106.042, 108.728], ['B', ' CA ', 150.912, 106.226, 107.52], ['B', ' C ', 150.729, 104.942, 106.777], ['B', ' O ', 150.398, 104.948, 105.6], ['B', ' CB ', 151.639, 107.25, 106.689], ['B', ' CG1', 153.031, 106.739, 106.501], ['B', ' CG2', 151.605, 108.575, 107.381], ['B', ' CD1', 153.81, 107.413, 105.533], ['B', ' H ', 152.587, 105.664, 108.678], ['B', ' HA ', 149.931, 106.621, 107.773], ['B', ' HB ', 151.174, 107.336, 105.708], ['B', ' HG1', 153.554, 106.851, 107.442], ['B', ' HG1', 153.003, 105.703, 106.244], ['B', ' HG2', 152.125, 109.305, 106.801], ['B', ' HG2', 150.577, 108.888, 107.499], ['B', ' HG2', 152.071, 108.506, 108.359], ['B', ' HD1', 154.767, 106.979, 105.541], ['B', ' HD1', 153.355, 107.274, 104.579], ['B', ' HD1', 153.905, 108.461, 105.76]]
[['B', ' N ', 150.922, 103.83, 107.454], ['B', ' CA ', 150.805, 102.537, 106.794], ['B', ' C ', 151.703, 102.423, 105.549], ['B', ' O ', 151.256, 102.054, 104.474], ['B', ' CB ', 149.339, 102.223, 106.487], ['B', ' CG ', 148.466, 102.094, 107.751], ['B', ' CD ', 147.024, 101.75, 107.41], ['B', ' CE ', 146.124, 101.609, 108.64], ['B', ' NZ ', 146.541, 100.496, 109.52], ['B', ' H ', 151.157, 103.88, 108.438], ['B', ' HA ', 151.142, 101.78, 107.499], ['B', ' HB ', 148.906, 102.985, 105.839], ['B', ' HB ', 149.287, 101.277, 105.944], ['B', ' HG ', 148.862, 101.297, 108.34], ['B', ' HG ', 148.523, 102.993, 108.335], ['B', ' HD ', 146.626, 102.568, 106.825], ['B', ' HD ', 146.985, 100.84, 106.811], ['B', ' HE ', 146.149, 102.527, 109.206], ['B', ' HE ', 145.102, 101.43, 108.306], ['B', ' HZ ', 145.921, 100.439, 110.318], ['B', ' HZ ', 146.516, 99.622, 109.011], ['B', ' HZ ', 147.477, 100.689, 109.829]]
[['B', ' N ', 152.974, 102.82, 105.702], ['B', ' CA ', 154.047, 102.759, 104.737], ['B', ' C ', 154.888, 101.624, 105.296], ['B', ' O ', 155.335, 101.67, 106.447], ['B', ' CB ', 154.765, 104.124, 104.675], ['B', ' SG ', 156.138, 104.308, 103.587], ['B', ' H ', 153.234, 103.156, 106.622], ['B', ' HA ', 153.664, 102.496, 103.748], ['B', ' HB ', 154.037, 104.864, 104.346], ['B', ' HB ', 155.102, 104.427, 105.676]]
[['B', ' N ', 155.134, 100.611, 104.486], ['B', ' CA ', 155.808, 99.409, 104.96], ['B', ' C ', 157.322, 99.49, 105.026], ['B', ' O ', 157.977, 98.501, 105.365], ['B', ' H ', 154.762, 100.632, 103.543], ['B', ' HA ', 155.424, 99.169, 105.953], ['B', ' HA ', 155.525, 98.577, 104.317]]
[['B', ' N ', 157.895, 100.646, 104.75], ['B', ' CA ', 159.338, 100.748, 104.77], ['B', ' C ', 159.928, 100.422, 106.098], ['B', ' O ', 160.954, 99.745, 106.19], ['B', ' CB ', 159.844, 102.104, 104.35], ['B', ' CG1', 159.558, 102.346, 102.898], ['B', ' CG2', 161.356, 102.229, 104.666], ['B', ' CD1', 160.216, 101.393, 101.943], ['B', ' H ', 157.319, 101.44, 104.497], ['B', ' HA ', 159.701, 100.02, 104.089], ['B', ' HB ', 159.297, 102.868, 104.902], ['B', ' HG1', 158.483, 102.331, 102.726], ['B', ' HG1', 159.925, 103.305, 102.668], ['B', ' HG2', 161.728, 103.203, 104.374], ['B', ' HG2', 161.536, 102.116, 105.725], ['B', ' HG2', 161.918, 101.481, 104.14], ['B', ' HD1', 160.005, 101.677, 100.968], ['B', ' HD1', 161.27, 101.425, 102.075], ['B', ' HD1', 159.879, 100.386, 102.066]]
[['B', ' N ', 159.281, 100.844, 107.146], ['B', ' CA ', 159.806, 100.571, 108.451], ['B', ' C ', 159.975, 99.071, 108.716], ['B', ' O ', 160.665, 98.694, 109.657], ['B', ' CB ', 158.913, 101.23, 109.479], ['B', ' SG ', 157.203, 100.699, 109.462], ['B', ' H ', 158.427, 101.379, 107.025], ['B', ' HA ', 160.789, 101.04, 108.519], ['B', ' HB ', 159.317, 100.988, 110.432], ['B', ' HB ', 158.939, 102.31, 109.363], ['B', ' HG ', 157.457, 99.391, 109.456]]
[['B', ' N ', 159.329, 98.219, 107.917], ['B', ' CA ', 159.456, 96.788, 108.041], ['B', ' C ', 160.51, 96.258, 107.07], ['B', ' O ', 161.361, 95.444, 107.452], ['B', ' CB ', 158.135, 96.1, 107.767], ['B', ' CG ', 158.244, 94.658, 107.923], ['B', ' CD1', 158.264, 94.132, 109.176], ['B', ' CD2', 158.354, 93.847, 106.82], ['B', ' CE1', 158.386, 92.805, 109.339], ['B', ' CE2', 158.481, 92.508, 106.989], ['B', ' CZ ', 158.494, 91.982, 108.238], ['B', ' OH ', 158.626, 90.629, 108.404], ['B', ' H ', 158.772, 98.577, 107.142], ['B', ' HA ', 159.779, 96.551, 109.05], ['B', ' HB ', 157.372, 96.47, 108.454], ['B', ' HB ', 157.802, 96.316, 106.753], ['B', ' HD1', 158.182, 94.783, 110.048], ['B', ' HD2', 158.346, 94.274, 105.817], ['B', ' HE1', 158.403, 92.404, 110.335], ['B', ' HE2', 158.574, 91.86, 106.129], ['B', ' HH ', 158.865, 90.221, 107.564]]
[['B', ' N ', 160.487, 96.748, 105.811], ['B', ' CA ', 161.388, 96.226, 104.77], ['B', ' C ', 162.805, 96.607, 105.108], ['B', ' O ', 163.724, 96.082, 104.512], ['B', ' CB ', 161.094, 96.734, 103.334], ['B', ' CG1', 161.661, 98.118, 103.097], ['B', ' CG2', 161.651, 95.745, 102.284], ['B', ' H ', 159.763, 97.434, 105.572], ['B', ' HA ', 161.317, 95.138, 104.764], ['B', ' HB ', 160.009, 96.817, 103.232], ['B', ' HG1', 161.383, 98.455, 102.1], ['B', ' HG1', 161.296, 98.776, 103.813], ['B', ' HG1', 162.748, 98.105, 103.162], ['B', ' HG2', 161.401, 96.097, 101.286], ['B', ' HG2', 162.731, 95.656, 102.363], ['B', ' HG2', 161.206, 94.762, 102.439]]
[['B', ' N ', 162.982, 97.594, 105.983], ['B', ' CA ', 164.299, 97.994, 106.449], ['B', ' C ', 164.781, 97.469, 107.831], ['B', ' O ', 165.821, 97.95, 108.27], ['B', ' CB ', 164.458, 99.517, 106.448], ['B', ' CG ', 164.423, 100.179, 105.093], ['B', ' CD ', 165.521, 99.753, 104.197], ['B', ' OE1', 166.472, 99.074, 104.583], ['B', ' NE2', 165.44, 100.181, 102.969], ['B', ' H ', 162.153, 98.083, 106.325], ['B', ' HA ', 164.994, 97.614, 105.724], ['B', ' HB ', 163.654, 99.952, 107.042], ['B', ' HB ', 165.4, 99.792, 106.923], ['B', ' HG ', 163.491, 99.911, 104.622], ['B', ' HG ', 164.485, 101.247, 105.19], ['B', ' HE2', 166.17, 99.934, 102.309], ['B', ' HE2', 164.668, 100.797, 102.688]]
[['B', ' N ', 164.084, 96.515, 108.542], ['B', ' CA ', 164.568, 96.001, 109.859], ['B', ' C ', 165.272, 94.659, 109.475], ['B', ' O ', 164.567, 93.691, 109.161], ['B', ' CB ', 163.424, 95.787, 110.909], ['B', ' SG ', 164.0, 95.71, 112.779], ['B', ' H ', 163.2, 96.144, 108.155], ['B', ' HA ', 165.244, 96.707, 110.306], ['B', ' HB ', 162.643, 96.488, 110.779], ['B', ' HB ', 162.924, 94.828, 110.716]]
[['B', ' N ', 166.627, 94.511, 109.567], ['B', ' CA ', 167.487, 93.428, 109.059], ['B', ' C ', 167.361, 92.086, 109.744], ['B', ' O ', 168.352, 91.479, 110.152], ['B', ' CB ', 168.868, 94.009, 109.312], ['B', ' CG ', 168.687, 94.81, 110.509], ['B', ' CD ', 167.362, 95.461, 110.293], ['B', ' HA ', 167.397, 93.315, 108.005], ['B', ' HB ', 169.62, 93.221, 109.431], ['B', ' HB ', 169.163, 94.62, 108.446], ['B', ' HG ', 168.713, 94.171, 111.406], ['B', ' HG ', 169.499, 95.536, 110.619], ['B', ' HD ', 166.888, 95.678, 111.233], ['B', ' HD ', 167.511, 96.319, 109.651]]
[['B', ' N ', 166.12, 91.654, 109.865], ['B', ' CA ', 165.656, 90.403, 110.364], ['B', ' C ', 164.735, 89.847, 109.321], ['B', ' O ', 164.6, 88.65, 109.143], ['B', ' CB ', 164.88, 90.624, 111.639], ['B', ' CG ', 165.595, 90.446, 112.93], ['B', ' CD ', 166.749, 91.268, 113.126], ['B', ' NE ', 167.962, 90.574, 112.751], ['B', ' CZ ', 168.606, 89.62, 113.499], ['B', ' NH1', 168.14, 89.226, 114.687], ['B', ' NH2', 169.719, 89.087, 113.033], ['B', ' H ', 165.387, 92.243, 109.502], ['B', ' HA ', 166.491, 89.724, 110.52], ['B', ' HB ', 164.472, 91.637, 111.633], ['B', ' HB ', 164.029, 89.942, 111.654], ['B', ' HG ', 164.904, 90.738, 113.698], ['B', ' HG ', 165.879, 89.403, 113.048], ['B', ' HD ', 166.672, 92.18, 112.538], ['B', ' HD ', 166.82, 91.537, 114.176], ['B', ' HE ', 168.352, 90.821, 111.832], ['B', ' HH1', 167.265, 89.6, 115.075], ['B', ' HH1', 168.65, 88.535, 115.261], ['B', ' HH2', 170.084, 89.38, 112.137], ['B', ' HH2', 170.207, 88.386, 113.57]]
[['B', ' N ', 164.07, 90.755, 108.639], ['B', ' CA ', 162.958, 90.387, 107.763], ['B', ' C ', 163.153, 89.99, 106.302], ['B', ' O ', 162.21, 89.47, 105.705], ['B', ' CB ', 162.007, 91.552, 107.728], ['B', ' OG ', 162.628, 92.648, 107.132], ['B', ' H ', 164.27, 91.753, 108.809], ['B', ' HA ', 162.455, 89.55, 108.249], ['B', ' HB ', 161.129, 91.28, 107.159], ['B', ' HB ', 161.687, 91.809, 108.734], ['B', ' HG ', 162.013, 93.404, 107.205]]
[['B', ' N ', 164.289, 90.265, 105.68], ['B', ' CA ', 164.29, 90.115, 104.224], ['B', ' C ', 165.56, 89.819, 103.386], ['B', ' O ', 165.456, 89.29, 102.282], ['B', ' CB ', 163.542, 91.353, 103.709], ['B', ' CG ', 163.545, 91.589, 102.284], ['B', ' CD1', 162.818, 90.982, 101.33], ['B', ' CD2', 164.269, 92.61, 101.633], ['B', ' NE1', 163.086, 91.551, 100.126], ['B', ' CE2', 163.967, 92.546, 100.309], ['B', ' CE3', 165.104, 93.549, 102.058], ['B', ' CZ2', 164.513, 93.409, 99.412], ['B', ' CZ3', 165.661, 94.408, 101.165], ['B', ' CH2', 165.376, 94.327, 99.88], ['B', ' H ', 165.073, 90.637, 106.182], ['B', ' HA ', 163.631, 89.274, 104.021], ['B', ' HB ', 162.496, 91.284, 104.001], ['B', ' HB ', 163.933, 92.234, 104.203], ['B', ' HD1', 162.127, 90.163, 101.499], ['B', ' HE1', 162.69, 91.319, 99.19], ['B', ' HE3', 165.314, 93.618, 103.084], ['B', ' HZ2', 164.275, 93.383, 98.365], ['B', ' HZ3', 166.337, 95.168, 101.53], ['B', ' HH2', 165.829, 95.016, 99.203]]
[['B', ' N ', 166.715, 90.285, 103.817], ['B', ' CA ', 167.84, 90.517, 102.923], ['B', ' C ', 168.731, 89.446, 102.316], ['B', ' O ', 169.179, 88.506, 102.979], ['B', ' CB ', 168.832, 91.418, 103.605], ['B', ' CG ', 168.424, 92.761, 103.669], ['B', ' CD1', 168.863, 93.769, 102.881], ['B', ' CD2', 167.472, 93.322, 104.528], ['B', ' NE1', 168.287, 94.904, 103.241], ['B', ' CE2', 167.42, 94.648, 104.239], ['B', ' CE3', 166.661, 92.817, 105.517], ['B', ' CZ2', 166.626, 95.447, 104.892], ['B', ' CZ3', 165.845, 93.616, 106.116], ['B', ' CH2', 165.828, 94.864, 105.842], ['B', ' H ', 166.783, 90.582, 104.764], ['B', ' HA ', 167.359, 91.094, 102.155], ['B', ' HB ', 168.986, 91.064, 104.616], ['B', ' HB ', 169.797, 91.377, 103.095], ['B', ' HD1', 169.596, 93.678, 102.101], ['B', ' HE1', 168.48, 95.854, 102.855], ['B', ' HE3', 166.67, 91.806, 105.813], ['B', ' HZ2', 166.579, 96.51, 104.672], ['B', ' HZ3', 165.188, 93.212, 106.875], ['B', ' HH2', 165.152, 95.428, 106.375]]
[['B', ' N ', 169.141, 89.698, 101.052], ['B', ' CA ', 170.077, 88.968, 100.248], ['B', ' C ', 171.473, 89.331, 100.668], ['B', ' O ', 172.117, 90.168, 100.025], ['B', ' CB ', 169.797, 89.462, 98.842], ['B', ' CG ', 169.374, 90.867, 99.042], ['B', ' CD ', 168.589, 90.874, 100.297], ['B', ' HA ', 169.902, 87.886, 100.345], ['B', ' HB ', 170.686, 89.344, 98.218], ['B', ' HB ', 169.014, 88.84, 98.383], ['B', ' HG ', 170.257, 91.498, 99.132], ['B', ' HG ', 168.827, 91.24, 98.196], ['B', ' HD ', 168.805, 91.83, 100.776], ['B', ' HD ', 167.515, 90.738, 100.047]]
[['B', ' N ', 171.95, 88.734, 101.732], ['B', ' CA ', 173.272, 89.097, 102.218], ['B', ' C ', 174.319, 88.894, 101.134], ['B', ' O ', 175.315, 89.623, 101.092], ['B', ' CB ', 173.619, 88.31, 103.463], ['B', ' CG ', 172.823, 88.745, 104.652], ['B', ' CD ', 173.09, 87.948, 105.864], ['B', ' OE1', 173.797, 86.953, 105.775], ['B', ' OE2', 172.593, 88.335, 106.904], ['B', ' H ', 171.365, 88.053, 102.231], ['B', ' HA ', 173.263, 90.15, 102.481], ['B', ' HB ', 173.429, 87.251, 103.289], ['B', ' HB ', 174.679, 88.427, 103.69], ['B', ' HG ', 173.084, 89.778, 104.853], ['B', ' HG ', 171.759, 88.705, 104.41]]
[['B', ' N ', 174.112, 87.913, 100.262], ['B', ' CA ', 175.042, 87.681, 99.186], ['B', ' C ', 175.085, 88.837, 98.173], ['B', ' O ', 176.132, 89.048, 97.561], ['B', ' CB ', 174.675, 86.373, 98.468], ['B', ' CG ', 173.283, 86.345, 97.755], ['B', ' CD ', 172.123, 86.002, 98.669], ['B', ' OE1', 172.292, 86.074, 99.866], ['B', ' OE2', 171.07, 85.689, 98.173], ['B', ' H ', 173.302, 87.296, 100.362], ['B', ' HA ', 176.036, 87.571, 99.617], ['B', ' HB ', 175.429, 86.157, 97.713], ['B', ' HB ', 174.694, 85.555, 99.187], ['B', ' HG ', 173.074, 87.28, 97.261], ['B', ' HG ', 173.335, 85.585, 96.978]]
[['B', ' N ', 173.987, 89.604, 98.002], ['B', ' CA ', 173.987, 90.723, 97.064], ['B', ' C ', 174.792, 91.832, 97.669], ['B', ' O ', 175.533, 92.541, 96.99], ['B', ' CB ', 172.577, 91.239, 96.789], ['B', ' CG ', 172.472, 92.33, 95.72], ['B', ' CD ', 172.875, 91.851, 94.35], ['B', ' OE1', 172.6, 90.7, 93.991], ['B', ' NE2', 173.497, 92.717, 93.559], ['B', ' H ', 173.143, 89.434, 98.547], ['B', ' HA ', 174.454, 90.41, 96.131], ['B', ' HB ', 171.945, 90.412, 96.478], ['B', ' HB ', 172.161, 91.64, 97.71], ['B', ' HG ', 171.45, 92.663, 95.668], ['B', ' HG ', 173.116, 93.174, 95.988], ['B', ' HE2', 173.765, 92.461, 92.632], ['B', ' HE2', 173.694, 93.678, 93.863]]
[['B', ' N ', 174.647, 91.954, 98.975], ['B', ' CA ', 175.333, 92.995, 99.701], ['B', ' C ', 176.81, 92.755, 99.643], ['B', ' O ', 177.582, 93.689, 99.44], ['B', ' CB ', 174.852, 93.037, 101.142], ['B', ' CG1', 173.424, 93.522, 101.109], ['B', ' CG2', 175.759, 93.925, 101.989], ['B', ' CD1', 172.698, 93.373, 102.347], ['B', ' H ', 173.983, 91.325, 99.439], ['B', ' HA ', 175.118, 93.951, 99.236], ['B', ' HB ', 174.85, 92.037, 101.556], ['B', ' HG1', 173.424, 94.575, 100.845], ['B', ' HG1', 172.881, 92.97, 100.342], ['B', ' HG2', 175.404, 93.946, 103.007], ['B', ' HG2', 176.778, 93.544, 101.992], ['B', ' HG2', 175.755, 94.936, 101.573], ['B', ' HD1', 171.717, 93.753, 102.189], ['B', ' HD1', 172.643, 92.333, 102.632], ['B', ' HD1', 173.177, 93.939, 103.131]]
[['B', ' N ', 177.225, 91.519, 99.848], ['B', ' CA ', 178.632, 91.23, 99.757], ['B', ' C ', 179.119, 91.405, 98.318], ['B', ' O ', 180.159, 92.014, 98.092], ['B', ' CB ', 178.908, 89.838, 100.3], ['B', ' CG ', 178.731, 89.77, 101.813], ['B', ' CD ', 178.961, 88.382, 102.377], ['B', ' CE ', 178.745, 88.371, 103.902], ['B', ' NZ ', 178.924, 87.015, 104.493], ['B', ' H ', 176.548, 90.785, 100.082], ['B', ' HA ', 179.169, 91.945, 100.379], ['B', ' HB ', 178.218, 89.126, 99.84], ['B', ' HB ', 179.922, 89.534, 100.048], ['B', ' HG ', 179.427, 90.466, 102.281], ['B', ' HG ', 177.717, 90.086, 102.063], ['B', ' HD ', 178.262, 87.683, 101.913], ['B', ' HD ', 179.978, 88.059, 102.158], ['B', ' HE ', 179.459, 89.052, 104.369], ['B', ' HE ', 177.733, 88.716, 104.12], ['B', ' HZ ', 178.772, 87.066, 105.522], ['B', ' HZ ', 178.261, 86.375, 104.09], ['B', ' HZ ', 179.861, 86.685, 104.323]]
[['B', ' N ', 178.327, 90.985, 97.323], ['B', ' CA ', 178.727, 91.118, 95.924], ['B', ' C ', 179.062, 92.564, 95.575], ['B', ' O ', 180.041, 92.833, 94.875], ['B', ' CB ', 177.608, 90.611, 95.008], ['B', ' CG ', 177.919, 90.603, 93.516], ['B', ' CD ', 176.74, 90.01, 92.723], ['B', ' CE ', 177.028, 89.949, 91.225], ['B', ' NZ ', 175.868, 89.387, 90.452], ['B', ' H ', 177.463, 90.478, 97.527], ['B', ' HA ', 179.619, 90.515, 95.762], ['B', ' HB ', 177.335, 89.599, 95.302], ['B', ' HB ', 176.727, 91.233, 95.145], ['B', ' HG ', 178.101, 91.626, 93.177], ['B', ' HG ', 178.816, 90.012, 93.335], ['B', ' HD ', 176.53, 89.002, 93.084], ['B', ' HD ', 175.852, 90.624, 92.891], ['B', ' HE ', 177.247, 90.95, 90.857], ['B', ' HE ', 177.899, 89.314, 91.062], ['B', ' HZ ', 176.092, 89.353, 89.467], ['B', ' HZ ', 175.65, 88.446, 90.778], ['B', ' HZ ', 175.067, 89.987, 90.587]]
[['B', ' N ', 178.27, 93.497, 96.086], ['B', ' CA ', 178.472, 94.923, 95.825], ['B', ' C ', 179.411, 95.698, 96.791], ['B', ' O ', 179.543, 96.917, 96.621], ['B', ' CB ', 177.118, 95.647, 95.816], ['B', ' CG ', 176.172, 95.195, 94.721], ['B', ' CD ', 174.897, 96.013, 94.621], ['B', ' OE1', 174.813, 97.083, 95.185], ['B', ' OE2', 173.976, 95.532, 94.008], ['B', ' H ', 177.442, 93.196, 96.612], ['B', ' HA ', 178.902, 95.006, 94.829], ['B', ' HB ', 176.618, 95.477, 96.775], ['B', ' HB ', 177.273, 96.719, 95.712], ['B', ' HG ', 176.697, 95.243, 93.769], ['B', ' HG ', 175.912, 94.151, 94.903]]
[['B', ' N ', 180.005, 95.034, 97.818], ['B', ' CA ', 180.842, 95.643, 98.876], ['B', ' C ', 182.32, 95.187, 98.771], ['B', ' O ', 182.718, 94.15, 99.315], ['B', ' OXT', 183.156, 95.998, 98.358], ['B', ' CB ', 180.194, 95.308, 100.274], ['B', ' CG ', 180.899, 95.829, 101.648], ['B', ' CD1', 180.867, 97.411, 101.727], ['B', ' CD2', 180.135, 95.185, 102.889], ['B', ' H ', 179.889, 94.016, 97.865], ['B', ' HA ', 180.831, 96.723, 98.756], ['B', ' HB ', 179.159, 95.68, 100.265], ['B', ' HB ', 180.134, 94.212, 100.341], ['B', ' HG ', 181.96, 95.508, 101.664], ['B', ' HD1', 181.352, 97.747, 102.65], ['B', ' HD1', 181.406, 97.838, 100.878], ['B', ' HD1', 179.835, 97.773, 101.715], ['B', ' HD2', 180.602, 95.509, 103.824], ['B', ' HD2', 179.087, 95.492, 102.891], ['B', ' HD2', 180.185, 94.096, 102.832]]
[['B', ' N ', 145.2, 100.621, 69.368], ['B', ' CA ', 145.368, 100.212, 70.775], ['B', ' C ', 145.026, 101.428, 71.689], ['B', ' O ', 145.19, 102.544, 71.198], ['B', ' CB ', 146.822, 99.703, 71.016], ['B', ' CG ', 147.23, 98.353, 70.244], ['B', ' CD ', 148.751, 97.944, 70.501], ['B', ' CE ', 149.204, 96.622, 69.728], ['B', ' NZ ', 148.617, 95.362, 70.319], ['B', ' H ', 145.976, 100.286, 68.816], ['B', ' H ', 144.338, 100.245, 68.998], ['B', ' H ', 145.172, 101.636, 69.325], ['B', ' HA ', 144.669, 99.39, 70.96], ['B', ' HB ', 147.551, 100.491, 70.737], ['B', ' HB ', 146.985, 99.513, 72.085], ['B', ' HG ', 146.577, 97.54, 70.587], ['B', ' HG ', 147.077, 98.475, 69.163], ['B', ' HD ', 149.399, 98.758, 70.162], ['B', ' HD ', 148.932, 97.807, 71.58], ['B', ' HE ', 148.899, 96.696, 68.682], ['B', ' HE ', 150.294, 96.545, 69.771], ['B', ' HZ ', 148.94, 94.561, 69.804], ['B', ' HZ ', 148.938, 95.285, 71.303], ['B', ' HZ ', 147.615, 95.398, 70.292]] AA_SCO= -0.9559999999999998 CA_SCO= -1.2446000000000004
[['B', ' N ', 144.516, 101.247, 72.971], ['B', ' CA ', 144.144, 102.294, 73.944], ['B', ' C ', 145.322, 102.999, 74.613], ['B', ' O ', 146.466, 102.525, 74.549], ['B', ' CB ', 143.316, 101.52, 74.981], ['B', ' CG ', 143.848, 100.118, 74.968], ['B', ' CD ', 144.203, 99.842, 73.525], ['B', ' HA ', 143.506, 103.043, 73.442], ['B', ' HB ', 143.44, 101.989, 75.98], ['B', ' HB ', 142.248, 101.578, 74.739], ['B', ' HG ', 144.693, 100.046, 75.665], ['B', ' HG ', 143.072, 99.438, 75.36], ['B', ' HD ', 145.078, 99.173, 73.485], ['B', ' HD ', 143.328, 99.402, 73.015]] AA_SCO= -0.7081818181818181 CA_SCO= -1.1869090909090911
[['B', ' N ', 145.024, 104.12, 75.264], ['B', ' CA ', 146.0, 104.831, 76.069], ['B', ' C ', 146.231, 104.119, 77.366], ['B', ' O ', 145.743, 102.995, 77.414], ['B', ' CB ', 145.519, 106.242, 76.332], ['B', ' CG ', 144.314, 106.332, 77.189], ['B', ' CD ', 143.828, 107.717, 77.334], ['B', ' NE ', 142.627, 107.717, 78.132], ['B', ' CZ ', 142.602, 107.734, 79.476], ['B', ' NH1', 143.707, 107.797, 80.175], ['B', ' NH2', 141.462, 107.67, 80.127], ['B', ' H ', 144.075, 104.473, 75.204], ['B', ' HA ', 146.952, 104.85, 75.566], ['B', ' HB ', 146.312, 106.811, 76.813], ['B', ' HB ', 145.261, 106.727, 75.396], ['B', ' HG ', 143.512, 105.748, 76.741], ['B', ' HG ', 144.533, 105.935, 78.177], ['B', ' HD ', 144.576, 108.349, 77.804], ['B', ' HD ', 143.582, 108.117, 76.343], ['B', ' HE ', 141.74, 107.662, 77.643], ['B', ' HH1', 144.603, 107.842, 79.732], ['B', ' HH1', 143.629, 107.796, 81.2], ['B', ' HH2', 140.587, 107.609, 79.632], ['B', ' HH2', 141.504, 107.648, 81.155]] AA_SCO= -0.39583333333333326 CA_SCO= -1.2388333333333337
[['B', ' N ', 147.476, 104.304, 77.75], ['B', ' CA ', 147.815, 104.266, 79.147], ['B', ' C ', 149.149, 104.949, 79.363], ['B', ' O ', 149.987, 104.956, 78.47], ['B', ' CB ', 147.838, 102.779, 79.605], ['B', ' CG1', 148.031, 102.615, 81.072], ['B', ' CG2', 148.87, 101.994, 78.854], ['B', ' CD1', 146.883, 103.025, 81.909], ['B', ' H ', 148.132, 103.746, 77.236], ['B', ' HA ', 147.053, 104.807, 79.701], ['B', ' HB ', 146.87, 102.334, 79.395], ['B', ' HG1', 148.209, 101.578, 81.234], ['B', ' HG1', 148.903, 103.145, 81.394], ['B', ' HG2', 148.824, 100.955, 79.162], ['B', ' HG2', 148.67, 102.046, 77.807], ['B', ' HG2', 149.861, 102.394, 79.059], ['B', ' HD1', 147.112, 102.814, 82.949], ['B', ' HD1', 146.671, 104.081, 81.805], ['B', ' HD1', 146.012, 102.452, 81.609]] AA_SCO= -0.20769230769230765 CA_SCO= -1.0936153846153849
[['B', ' N ', 149.346, 105.566, 80.51], ['B', ' CA ', 150.663, 106.091, 80.808], ['B', ' C ', 151.408, 105.062, 81.643], ['B', ' O ', 150.775, 104.381, 82.441], ['B', ' H ', 148.615, 105.596, 81.207], ['B', ' HA ', 151.203, 106.309, 79.906], ['B', ' HA ', 150.545, 107.006, 81.372]] AA_SCO= 0.02214285714285718 CA_SCO= -0.8869285714285715
[['B', ' N ', 152.73, 104.924, 81.491], ['B', ' CA ', 153.479, 104.015, 82.345], ['B', ' C ', 154.176, 104.719, 83.469], ['B', ' O ', 155.276, 104.242, 83.759], ['B', ' CB ', 154.372, 103.094, 81.568], ['B', ' CG ', 153.649, 101.871, 80.975], ['B', ' CD1', 152.248, 101.716, 80.901], ['B', ' CD2', 154.42, 100.852, 80.584], ['B', ' CE1', 151.734, 100.568, 80.382], ['B', ' CE2', 153.899, 99.737, 80.095], ['B', ' CZ ', 152.576, 99.595, 79.965], ['B', ' OH ', 152.091, 98.481, 79.415], ['B', ' H ', 153.255, 105.494, 80.835], ['B', ' HA ', 152.764, 103.364, 82.843], ['B', ' HB ', 154.77, 103.667, 80.737], ['B', ' HB ', 155.218, 102.77, 82.143], ['B', ' HD1', 151.562, 102.466, 81.221], ['B', ' HD2', 155.487, 100.939, 80.667], ['B', ' HE1', 150.669, 100.435, 80.299], ['B', ' HE2', 154.553, 98.955, 79.801], ['B', ' HH ', 152.837, 97.899, 79.205]] AA_SCO= 0.1206666666666667 CA_SCO= -0.7406000000000001
[['B', ' N ', 154.031, 106.027, 83.358], ['B', ' CA ', 154.001, 106.648, 84.657], ['B', ' C ', 152.509, 106.716, 84.83], ['B', ' O ', 151.857, 107.595, 84.261], ['B', ' CB ', 154.599, 108.07, 84.698], ['B', ' CG1', 156.037, 108.093, 84.116], ['B', ' CG2', 154.544, 108.634, 86.117], ['B', ' CD1', 157.06, 107.18, 84.782], ['B', ' H ', 154.63, 106.464, 82.663], ['B', ' HA ', 154.427, 106.003, 85.426], ['B', ' HB ', 154.004, 108.723, 84.078], ['B', ' HG1', 155.984, 107.827, 83.068], ['B', ' HG1', 156.4, 109.11, 84.19], ['B', ' HG2', 154.936, 109.65, 86.122], ['B', ' HG2', 153.51, 108.65, 86.472], ['B', ' HG2', 155.132, 108.018, 86.794], ['B', ' HD1', 158.021, 107.3, 84.283], ['B', ' HD1', 157.173, 107.436, 85.833], ['B', ' HD1', 156.745, 106.141, 84.697]] AA_SCO= 0.28375000000000006 CA_SCO= -0.6499375000000001
[['B', ' N ', 151.952, 105.783, 85.574], ['B', ' CA ', 150.515, 105.72, 85.611], ['B', ' C ', 150.014, 106.256, 86.91], ['B', ' O ', 150.231, 105.674, 87.978], ['B', ' CB ', 149.968, 104.315, 85.504], ['B', ' CG ', 148.486, 104.325, 85.404], ['B', ' ND1', 147.696, 103.326, 85.916], ['B', ' CD2', 147.639, 105.215, 84.831], ['B', ' CE1', 146.427, 103.613, 85.671], ['B', ' NE2', 146.376, 104.747, 85.016], ['B', ' H ', 152.527, 105.09, 86.059], ['B', ' HA ', 150.101, 106.317, 84.805], ['B', ' HB ', 150.401, 103.79, 84.677], ['B', ' HB ', 150.22, 103.78, 86.398], ['B', ' HD2', 147.893, 106.136, 84.312], ['B', ' HE1', 145.567, 103.029, 85.94], ['B', ' HE2', 145.509, 105.215, 84.679]] AA_SCO= 0.3652941176470589 CA_SCO= -0.4962941176470589
[['B', ' N ', 149.337, 107.366, 86.845], ['B', ' CA ', 148.885, 107.982, 88.052], ['B', ' C ', 147.462, 107.599, 88.39], ['B', ' O ', 146.542, 107.843, 87.61], ['B', ' CB ', 149.055, 109.485, 87.885], ['B', ' CG ', 148.592, 110.389, 88.995], ['B', ' CD1', 149.351, 110.145, 90.25], ['B', ' CD2', 148.815, 111.793, 88.546], ['B', ' H ', 149.168, 107.801, 85.948], ['B', ' HA ', 149.517, 107.652, 88.851], ['B', ' HB ', 150.117, 109.685, 87.725], ['B', ' HB ', 148.523, 109.784, 86.983], ['B', ' HG ', 147.551, 110.223, 89.204], ['B', ' HD1', 148.989, 110.833, 91.01], ['B', ' HD1', 149.216, 109.135, 90.608], ['B', ' HD1', 150.412, 110.321, 90.09], ['B', ' HD2', 148.509, 112.439, 89.311], ['B', ' HD2', 149.877, 111.958, 88.341], ['B', ' HD2', 148.242, 111.982, 87.647]] AA_SCO= 0.4833333333333334 CA_SCO= -0.7045555555555557
[['B', ' N ', 147.283, 106.975, 89.558], ['B', ' CA ', 145.96, 106.577, 90.02], ['B', ' C ', 145.596, 107.422, 91.239], ['B', ' O ', 144.438, 107.512, 91.638], ['B', ' CB ', 145.892, 105.093, 90.332], ['B', ' OG ', 146.114, 104.331, 89.193], ['B', ' H ', 148.076, 106.752, 90.139], ['B', ' HA ', 145.234, 106.785, 89.234], ['B', ' HB ', 146.623, 104.835, 91.06], ['B', ' HB ', 144.918, 104.858, 90.751], ['B', ' HG ', 145.857, 103.441, 89.424]] AA_SCO= 0.5731578947368421 CA_SCO= -0.5655789473684212
[['B', ' N ', 146.596, 108.113, 91.766], ['B', ' CA ', 146.502, 108.982, 92.92], ['B', ' C ', 147.909, 109.201, 93.493], ['B', ' O ', 148.78, 108.356, 93.32], ['B', ' H ', 147.515, 107.977, 91.392], ['B', ' HA ', 146.057, 109.934, 92.634], ['B', ' HA ', 145.86, 108.524, 93.671]] AA_SCO= 0.6863157894736842 CA_SCO= -0.16715789473684212
[['B', ' N ', 148.093, 110.335, 94.191], ['B', ' CA ', 149.336, 110.792, 94.85], ['B', ' C ', 150.447, 111.174, 93.876], ['B', ' O ', 150.61, 110.573, 92.827], ['B', ' CB ', 149.894, 109.717, 95.769], ['B', ' SG ', 148.83, 109.262, 97.152], ['B', ' H ', 147.299, 110.952, 94.243], ['B', ' HA ', 149.092, 111.668, 95.454], ['B', ' HB ', 150.141, 108.812, 95.214], ['B', ' HB ', 150.811, 110.093, 96.173], ['B', ' HG ', 149.567, 108.215, 97.572]] AA_SCO= 0.9715789473684209 CA_SCO= 0.2763157894736843
[['B', ' N ', 151.258, 112.16, 94.243], ['B', ' CA ', 152.362, 112.561, 93.367], ['B', ' C ', 153.778, 112.519, 93.945], ['B', ' O ', 154.714, 112.824, 93.235], ['B', ' CB ', 152.089, 113.928, 92.769], ['B', ' OG1', 151.9, 114.878, 93.825], ['B', ' CG2', 150.846, 113.855, 91.876], ['B', ' H ', 151.079, 112.651, 95.105], ['B', ' HA ', 152.371, 111.868, 92.524], ['B', ' HB ', 152.942, 114.236, 92.159], ['B', ' HG1', 151.753, 115.751, 93.413], ['B', ' HG2', 150.666, 114.827, 91.428], ['B', ' HG2', 151.013, 113.125, 91.082], ['B', ' HG2', 149.978, 113.562, 92.449]] AA_SCO= 1.093157894736842 CA_SCO= 0.3600526315789474
[['B', ' N ', 153.977, 112.099, 95.198], ['B', ' CA ', 155.346, 112.095, 95.79], ['B', ' C ', 156.211, 110.968, 95.236], ['B', ' O ', 157.442, 110.942, 95.357], ['B', ' H ', 153.182, 111.83, 95.755], ['B', ' HA ', 155.84, 113.046, 95.592], ['B', ' HA ', 155.271, 111.992, 96.872]] AA_SCO= 1.2810526315789474 CA_SCO= 0.5744736842105262
[['B', ' N ', 155.549, 110.065, 94.568], ['B', ' CA ', 156.147, 108.909, 93.971], ['B', ' C ', 156.63, 109.28, 92.581], ['B', ' O ', 157.329, 108.527, 91.915], ['B', ' CB ', 155.087, 107.84, 93.965], ['B', ' CG ', 154.702, 107.414, 95.38], ['B', ' OD1', 155.55, 107.167, 96.188], ['B', ' OD2', 153.536, 107.411, 95.649], ['B', ' H ', 154.549, 110.174, 94.506], ['B', ' HA ', 156.996, 108.587, 94.557], ['B', ' HB ', 154.194, 108.23, 93.488], ['B', ' HB ', 155.418, 107.0, 93.382]] AA_SCO= 1.4184210526315788 CA_SCO= 0.9031578947368422
[['B', ' N ', 156.279, 110.486, 92.169], ['B', ' CA ', 156.65, 111.073, 90.913], ['B', ' C ', 157.487, 112.264, 91.297], ['B', ' O ', 157.397, 112.75, 92.415], ['B', ' CB ', 155.436, 111.472, 90.096], ['B', ' H ', 155.718, 111.08, 92.774], ['B', ' HA ', 157.261, 110.37, 90.349], ['B', ' HB ', 155.754, 111.943, 89.169], ['B', ' HB ', 154.846, 110.583, 89.869], ['B', ' HB ', 154.828, 112.175, 90.67]] AA_SCO= 1.4663157894736842 CA_SCO= 1.0994210526315789
[['B', ' N ', 158.355, 112.721, 90.424], ['B', ' CA ', 159.175, 113.883, 90.766], ['B', ' C ', 159.929, 113.649, 92.069], ['B', ' O ', 160.067, 114.541, 92.903], ['B', ' CB ', 158.324, 115.144, 90.85], ['B', ' CG ', 157.63, 115.455, 89.558], ['B', ' SD ', 158.795, 115.669, 88.212], ['B', ' CE ', 157.723, 115.973, 86.883], ['B', ' H ', 158.424, 112.299, 89.509], ['B', ' HA ', 159.911, 114.015, 89.983], ['B', ' HB ', 157.576, 115.054, 91.635], ['B', ' HB ', 158.96, 115.995, 91.103], ['B', ' HG ', 156.941, 114.65, 89.308], ['B', ' HG ', 157.051, 116.374, 89.67], ['B', ' HE ', 158.296, 116.135, 85.976], ['B', ' HE ', 157.06, 115.122, 86.747], ['B', ' HE ', 157.131, 116.859, 87.102]] AA_SCO= 1.6342105263157896 CA_SCO= 1.0950526315789475
[['B', ' N ', 160.424, 112.426, 92.184], ['B', ' CA ', 161.224, 111.877, 93.252], ['B', ' C ', 162.192, 111.024, 92.476], ['B', ' O ', 163.363, 110.886, 92.796], ['B', ' CB ', 160.324, 111.206, 94.256], ['B', ' OG ', 159.559, 110.193, 93.711], ['B', ' H ', 160.238, 111.786, 91.434], ['B', ' HA ', 161.772, 112.672, 93.759], ['B', ' HB ', 160.912, 110.813, 95.088], ['B', ' HB ', 159.656, 111.964, 94.652], ['B', ' HG ', 158.741, 110.205, 94.303]] AA_SCO= 1.8163157894736845 CA_SCO= 1.0946315789473684
[['B', ' N ', 161.723, 110.613, 91.302], ['B', ' CA ', 162.534, 109.926, 90.298], ['B', ' C ', 163.579, 110.922, 89.807], ['B', ' O ', 164.754, 110.612, 89.621], ['B', ' CB ', 161.65, 109.446, 89.132], ['B', ' CG ', 162.341, 108.657, 87.978], ['B', ' CD1', 161.332, 107.65, 87.383], ['B', ' CD2', 162.808, 109.623, 86.863], ['B', ' H ', 160.734, 110.732, 91.138], ['B', ' HA ', 163.04, 109.078, 90.758], ['B', ' HB ', 160.871, 108.805, 89.544], ['B', ' HB ', 161.172, 110.315, 88.685], ['B', ' HG ', 163.201, 108.118, 88.362], ['B', ' HD1', 161.808, 107.089, 86.577], ['B', ' HD1', 161.003, 106.956, 88.151], ['B', ' HD1', 160.468, 108.183, 86.987], ['B', ' HD2', 163.277, 109.042, 86.069], ['B', ' HD2', 161.949, 110.159, 86.46], ['B', ' HD2', 163.525, 110.337, 87.224]] AA_SCO= 1.9326315789473683 CA_SCO= 1.0808947368421051
[['B', ' N ', 163.134, 112.156, 89.627], ['B', ' CA ', 163.903, 113.255, 89.09], ['B', ' C ', 164.907, 113.788, 90.104], ['B', ' O ', 165.722, 114.658, 89.803], ['B', ' CB ', 162.972, 114.375, 88.606], ['B', ' OG1', 162.179, 114.825, 89.692], ['B', ' CG2', 162.08, 113.852, 87.489], ['B', ' H ', 162.174, 112.356, 89.846], ['B', ' HA ', 164.461, 112.886, 88.229], ['B', ' HB ', 163.551, 115.207, 88.237], ['B', ' HG1', 161.69, 115.617, 89.424], ['B', ' HG2', 161.427, 114.648, 87.144], ['B', ' HG2', 162.704, 113.514, 86.663], ['B', ' HG2', 161.479, 113.021, 87.848]] AA_SCO= 2.0026315789473688 CA_SCO= 1.0684210526315787
[['B', ' N ', 164.93, 113.237, 91.311], ['B', ' CA ', 165.901, 113.694, 92.275], ['B', ' C ', 167.201, 112.926, 92.087], ['B', ' O ', 168.156, 113.079, 92.841], ['B', ' CB ', 165.381, 113.663, 93.69], ['B', ' CG ', 164.295, 114.694, 93.945], ['B', ' CD ', 163.894, 114.677, 95.34], ['B', ' OE1', 164.351, 113.782, 96.0], ['B', ' OE2', 163.145, 115.51, 95.772], ['B', ' H ', 164.297, 112.483, 91.589], ['B', ' HA ', 166.116, 114.74, 92.067], ['B', ' HB ', 164.957, 112.687, 93.905], ['B', ' HB ', 166.198, 113.838, 94.389], ['B', ' HG ', 164.668, 115.685, 93.693], ['B', ' HG ', 163.435, 114.484, 93.308]] AA_SCO= 2.0173684210526317 CA_SCO= 1.203894736842105
[['B', ' N ', 167.263, 112.135, 91.014], ['B', ' CA ', 168.5, 111.499, 90.617], ['B', ' C ', 169.443, 112.609, 90.169], ['B', ' O ', 170.66, 112.429, 90.079], ['B', ' CB ', 168.258, 110.527, 89.502], ['B', ' CG ', 167.642, 109.33, 89.976], ['B', ' OD1', 167.939, 108.911, 91.085], ['B', ' ND2', 166.779, 108.758, 89.201], ['B', ' H ', 166.417, 111.951, 90.47], ['B', ' HA ', 168.948, 110.997, 91.475], ['B', ' HB ', 167.621, 110.984, 88.74], ['B', ' HB ', 169.188, 110.28, 89.049], ['B', ' HD2', 166.302, 107.935, 89.503], ['B', ' HD2', 166.565, 109.156, 88.312]] AA_SCO= 1.9031578947368415 CA_SCO= 1.091578947368421
[['B', ' N ', 168.855, 113.734, 89.769], ['B', ' CA ', 169.526, 114.955, 89.386], ['B', ' C ', 170.565, 114.836, 88.308], ['B', ' O ', 170.315, 115.136, 87.139], ['B', ' CB ', 170.17, 115.612, 90.624], ['B', ' CG ', 169.172, 116.173, 91.618], ['B', ' CD1', 169.109, 115.759, 92.953], ['B', ' CD2', 168.309, 117.099, 91.186], ['B', ' CE1', 168.143, 116.315, 93.804], ['B', ' CE2', 167.405, 117.621, 91.994], ['B', ' CZ ', 167.287, 117.263, 93.273], ['B', ' OH ', 166.298, 117.898, 93.985], ['B', ' H ', 167.837, 113.792, 89.835], ['B', ' HA ', 168.768, 115.63, 89.013], ['B', ' HB ', 170.791, 114.889, 91.15], ['B', ' HB ', 170.824, 116.426, 90.302], ['B', ' HD1', 169.801, 115.002, 93.328], ['B', ' HD2', 168.339, 117.435, 90.172], ['B', ' HE1', 168.068, 116.007, 94.846], ['B', ' HE2', 166.749, 118.352, 91.609], ['B', ' HH ', 166.166, 117.548, 94.878]] AA_SCO= 1.9315789473684213 CA_SCO= 1.139052631578947
[['B', ' N ', 171.709, 114.295, 88.694], ['B', ' CA ', 172.908, 114.244, 87.879], ['B', ' C ', 172.719, 113.389, 86.665], ['B', ' O ', 173.318, 113.625, 85.616], ['B', ' CB ', 174.066, 113.707, 88.707], ['B', ' CG ', 174.555, 114.693, 89.803], ['B', ' OD1', 174.194, 115.869, 89.791], ['B', ' OD2', 175.292, 114.254, 90.65], ['B', ' H ', 171.737, 113.924, 89.639], ['B', ' HA ', 173.146, 115.256, 87.551], ['B', ' HB ', 173.753, 112.78, 89.192], ['B', ' HB ', 174.9, 113.464, 88.049]] AA_SCO= 1.807894736842105 CA_SCO= 1.147421052631579
[['B', ' N ', 171.882, 112.385, 86.802], ['B', ' CA ', 171.638, 111.514, 85.676], ['B', ' C ', 170.206, 111.56, 85.208], ['B', ' O ', 169.799, 110.65, 84.492], ['B', ' CB ', 171.951, 110.04, 85.991], ['B', ' CG1', 171.025, 109.535, 87.138], ['B', ' CG2', 173.42, 109.932, 86.372], ['B', ' CD1', 171.003, 108.033, 87.346], ['B', ' H ', 171.443, 112.242, 87.719], ['B', ' HA ', 172.27, 111.826, 84.846], ['B', ' HB ', 171.761, 109.426, 85.11], ['B', ' HG1', 171.345, 110.002, 88.069], ['B', ' HG1', 170.004, 109.83, 86.929], ['B', ' HG2', 173.681, 108.902, 86.584], ['B', ' HG2', 174.028, 110.292, 85.543], ['B', ' HG2', 173.616, 110.54, 87.252], ['B', ' HD1', 170.322, 107.799, 88.164], ['B', ' HD1', 170.654, 107.548, 86.43], ['B', ' HD1', 171.995, 107.669, 87.593]] AA_SCO= 1.8605263157894734 CA_SCO= 1.1808947368421052
[['B', ' N ', 169.377, 112.525, 85.621], ['B', ' CA ', 168.004, 112.305, 85.186], ['B', ' C ', 167.87, 112.641, 83.715], ['B', ' O ', 167.071, 112.029, 83.008], ['B', ' CB ', 166.973, 113.092, 85.999], ['B', ' CG ', 166.753, 114.568, 85.703], ['B', ' CD1', 165.604, 114.702, 84.692], ['B', ' CD2', 166.392, 115.262, 86.909], ['B', ' H ', 169.68, 113.337, 86.174], ['B', ' HA ', 167.767, 111.254, 85.324], ['B', ' HB ', 166.013, 112.591, 85.896], ['B', ' HB ', 167.268, 113.026, 87.049], ['B', ' HG ', 167.654, 115.018, 85.298], ['B', ' HD1', 165.432, 115.73, 84.525], ['B', ' HD1', 165.8, 114.223, 83.75], ['B', ' HD1', 164.709, 114.263, 85.125], ['B', ' HD2', 166.217, 116.308, 86.684], ['B', ' HD2', 165.513, 114.83, 87.289], ['B', ' HD2', 167.173, 115.174, 87.623]] AA_SCO= 1.8047368421052634 CA_SCO= 1.2385263157894735
[['B', ' N ', 168.659, 113.604, 83.217], ['B', ' CA ', 168.513, 113.981, 81.822], ['B', ' C ', 168.82, 112.783, 80.952], ['B', ' O ', 168.129, 112.522, 79.969], ['B', ' CB ', 169.445, 115.135, 81.47], ['B', ' H ', 169.333, 114.072, 83.81], ['B', ' HA ', 167.48, 114.276, 81.649], ['B', ' HB ', 169.312, 115.403, 80.421], ['B', ' HB ', 169.231, 115.994, 82.088], ['B', ' HB ', 170.478, 114.834, 81.635]] AA_SCO= 1.8542105263157898 CA_SCO= 1.2389473684210526
[['B', ' N ', 169.823, 112.008, 81.353], ['B', ' CA ', 170.19, 110.825, 80.605], ['B', ' C ', 169.215, 109.694, 80.852], ['B', ' O ', 168.776, 108.999, 79.921], ['B', ' CB ', 171.586, 110.377, 81.014], ['B', ' CG ', 172.668, 111.322, 80.602], ['B', ' CD ', 172.771, 111.42, 79.12], ['B', ' OE1', 172.886, 110.394, 78.487], ['B', ' OE2', 172.709, 112.508, 78.606], ['B', ' H ', 170.36, 112.28, 82.163], ['B', ' HA ', 170.184, 111.069, 79.542], ['B', ' HB ', 171.626, 110.267, 82.103], ['B', ' HB ', 171.796, 109.398, 80.578], ['B', ' HG ', 172.456, 112.31, 81.009], ['B', ' HG ', 173.617, 110.981, 81.013]] AA_SCO= 1.8526315789473686 CA_SCO= 1.544473684210526
[['B', ' N ', 168.753, 109.564, 82.095], ['B', ' CA ', 167.894, 108.455, 82.432], ['B', ' C ', 166.604, 108.536, 81.654], ['B', ' O ', 166.127, 107.536, 81.122], ['B', ' CB ', 167.601, 108.428, 83.937], ['B', ' CG ', 166.762, 107.234, 84.489], ['B', ' CD1', 167.493, 105.899, 84.21], ['B', ' CD2', 166.544, 107.441, 86.006], ['B', ' H ', 169.078, 110.171, 82.848], ['B', ' HA ', 168.42, 107.562, 82.177], ['B', ' HB ', 168.551, 108.44, 84.469], ['B', ' HB ', 167.063, 109.34, 84.185], ['B', ' HG ', 165.791, 107.199, 83.981], ['B', ' HD1', 166.906, 105.084, 84.592], ['B', ' HD1', 167.627, 105.756, 83.149], ['B', ' HD1', 168.468, 105.906, 84.702], ['B', ' HD2', 165.949, 106.621, 86.412], ['B', ' HD2', 167.51, 107.472, 86.515], ['B', ' HD2', 166.017, 108.384, 86.167]] AA_SCO= 1.9194736842105262 CA_SCO= 1.3731052631578944
[['B', ' N ', 166.074, 109.747, 81.505], ['B', ' CA ', 164.824, 109.966, 80.797], ['B', ' C ', 164.994, 110.275, 79.309], ['B', ' O ', 164.013, 110.621, 78.646], ['B', ' CB ', 164.038, 111.106, 81.467], ['B', ' CG ', 163.552, 110.868, 82.943], ['B', ' CD1', 162.9, 112.148, 83.465], ['B', ' CD2', 162.535, 109.71, 82.989], ['B', ' H ', 166.522, 110.548, 81.965], ['B', ' HA ', 164.243, 109.048, 80.853], ['B', ' HB ', 164.685, 111.988, 81.478], ['B', ' HB ', 163.166, 111.331, 80.858], ['B', ' HG ', 164.411, 110.636, 83.579], ['B', ' HD1', 162.572, 112.0, 84.494], ['B', ' HD1', 163.628, 112.947, 83.428], ['B', ' HD1', 162.043, 112.404, 82.844], ['B', ' HD2', 162.19, 109.562, 84.003], ['B', ' HD2', 161.688, 109.959, 82.355], ['B', ' HD2', 162.988, 108.788, 82.639]] AA_SCO= 2.0126315789473685 CA_SCO= 1.3535263157894735
[['B', ' N ', 166.22, 110.201, 78.786], ['B', ' CA ', 166.445, 110.491, 77.372], ['B', ' C ', 167.061, 109.31, 76.637], ['B', ' O ', 166.548, 108.88, 75.604], ['B', ' CB ', 167.381, 111.705, 77.146], ['B', ' OG1', 166.832, 112.877, 77.75], ['B', ' CG2', 167.537, 111.965, 75.653], ['B', ' H ', 166.994, 109.883, 79.362], ['B', ' HA ', 165.488, 110.71, 76.906], ['B', ' HB ', 168.362, 111.503, 77.58], ['B', ' HG1', 167.01, 112.818, 78.712], ['B', ' HG2', 168.191, 112.821, 75.508], ['B', ' HG2', 167.966, 111.106, 75.153], ['B', ' HG2', 166.561, 112.177, 75.223]] AA_SCO= 2.0410526315789475 CA_SCO= 1.3533684210526318
[['B', ' N ', 168.204, 108.826, 77.13], ['B', ' CA ', 168.959, 107.798, 76.435], ['B', ' C ', 168.848, 106.4, 77.025], ['B', ' O ', 169.106, 105.415, 76.336], ['B', ' CB ', 170.41, 108.218, 76.377], ['B', ' CG ', 170.615, 109.444, 75.519], ['B', ' OD1', 169.953, 109.6, 74.486], ['B', ' ND2', 171.514, 110.314, 75.907], ['B', ' H ', 168.556, 109.177, 78.018], ['B', ' HA ', 168.579, 107.737, 75.415], ['B', ' HB ', 170.764, 108.438, 77.391], ['B', ' HB ', 171.014, 107.402, 75.986], ['B', ' HD2', 171.682, 111.137, 75.366], ['B', ' HD2', 172.056, 110.176, 76.762]] AA_SCO= 2.0573684210526313 CA_SCO= 1.3531578947368421
[['B', ' N ', 168.474, 106.307, 78.288], ['B', ' CA ', 168.434, 105.019, 78.963], ['B', ' C ', 167.053, 104.381, 78.993], ['B', ' O ', 166.815, 103.362, 78.343], ['B', ' CB ', 168.928, 105.223, 80.36], ['B', ' CG ', 170.39, 105.587, 80.439], ['B', ' SD ', 170.916, 106.037, 82.092], ['B', ' CE ', 170.844, 104.481, 82.932], ['B', ' H ', 168.301, 107.167, 78.81], ['B', ' HA ', 169.102, 104.336, 78.441], ['B', ' HB ', 168.359, 105.998, 80.785], ['B', ' HB ', 168.744, 104.339, 80.932], ['B', ' HG ', 170.99, 104.745, 80.098], ['B', ' HG ', 170.587, 106.432, 79.777], ['B', ' HE ', 171.154, 104.619, 83.968], ['B', ' HE ', 169.833, 104.1, 82.907], ['B', ' HE ', 171.513, 103.77, 82.447]] AA_SCO= 2.0036842105263153 CA_SCO= 1.3563684210526317
[['B', ' N ', 166.141, 104.959, 79.762], ['B', ' CA ', 164.81, 104.408, 79.891], ['B', ' C ', 163.852, 105.308, 79.139], ['B', ' O ', 163.657, 106.461, 79.503], ['B', ' CB ', 164.427, 104.325, 81.38], ['B', ' CG1', 163.013, 103.766, 81.535], ['B', ' CG2', 165.463, 103.442, 82.13], ['B', ' H ', 166.353, 105.828, 80.253], ['B', ' HA ', 164.786, 103.41, 79.454], ['B', ' HB ', 164.436, 105.335, 81.806], ['B', ' HG1', 162.752, 103.73, 82.592], ['B', ' HG1', 162.305, 104.409, 81.013], ['B', ' HG1', 162.968, 102.763, 81.115], ['B', ' HG2', 165.206, 103.396, 83.185], ['B', ' HG2', 165.456, 102.438, 81.712], ['B', ' HG2', 166.453, 103.867, 82.023]] AA_SCO= 2.0531578947368425 CA_SCO= 1.3586315789473684
[['B', ' N ', 163.224, 104.786, 78.104], ['B', ' CA ', 162.389, 105.643, 77.288], ['B', ' C ', 160.962, 105.733, 77.806], ['B', ' O ', 160.163, 104.798, 77.665], ['B', ' CB ', 162.376, 105.144, 75.843], ['B', ' CG ', 161.653, 106.085, 74.908], ['B', ' OD1', 161.253, 107.123, 75.364], ['B', ' OD2', 161.518, 105.772, 73.746], ['B', ' H ', 163.378, 103.82, 77.853], ['B', ' HA ', 162.813, 106.648, 77.299], ['B', ' HB ', 163.403, 105.025, 75.493], ['B', ' HB ', 161.894, 104.168, 75.796]] AA_SCO= 2.1552631578947374 CA_SCO= 1.360947368421053
[['B', ' N ', 160.615, 106.848, 78.427], ['B', ' CA ', 159.273, 106.926, 78.939], ['B', ' C ', 158.455, 107.398, 77.8], ['B', ' O ', 158.363, 108.59, 77.521], ['B', ' CB ', 159.115, 107.925, 80.094], ['B', ' CG1', 160.091, 107.601, 81.252], ['B', ' CG2', 157.637, 107.977, 80.545], ['B', ' CD1', 159.953, 106.217, 81.866], ['B', ' H ', 161.276, 107.609, 78.513], ['B', ' HA ', 158.918, 105.943, 79.232], ['B', ' HB ', 159.395, 108.917, 79.736], ['B', ' HG1', 161.115, 107.701, 80.882], ['B', ' HG1', 159.934, 108.331, 82.042], ['B', ' HG2', 157.524, 108.71, 81.328], ['B', ' HG2', 156.997, 108.265, 79.709], ['B', ' HG2', 157.312, 107.005, 80.912], ['B', ' HD1', 160.686, 106.107, 82.665], ['B', ' HD1', 158.955, 106.08, 82.279], ['B', ' HD1', 160.137, 105.46, 81.113]] AA_SCO= 2.022631578947369 CA_SCO= 1.2783157894736845
[['B', ' N ', 157.828, 106.445, 77.174], ['B', ' CA ', 157.031, 106.739, 76.021], ['B', ' C ', 155.693, 107.324, 76.403], ['B', ' O ', 155.175, 108.165, 75.684], ['B', ' CB ', 156.921, 105.516, 75.083], ['B', ' CG1', 158.25, 105.284, 74.417], ['B', ' CG2', 156.627, 104.241, 75.852], ['B', ' H ', 158.038, 105.499, 77.487], ['B', ' HA ', 157.562, 107.5, 75.447], ['B', ' HB ', 156.159, 105.713, 74.338], ['B', ' HG1', 158.19, 104.43, 73.747], ['B', ' HG1', 158.54, 106.169, 73.846], ['B', ' HG1', 159.006, 105.094, 75.177], ['B', ' HG2', 156.571, 103.405, 75.157], ['B', ' HG2', 157.437, 104.071, 76.531], ['B', ' HG2', 155.721, 104.286, 76.404]] AA_SCO= 1.9242105263157896 CA_SCO= 1.1746315789473685
[['B', ' N ', 155.102, 106.842, 77.486], ['B', ' CA ', 153.817, 107.356, 77.944], ['B', ' C ', 153.822, 107.555, 79.448], ['B', ' O ', 154.476, 106.818, 80.199], ['B', ' CB ', 152.671, 106.494, 77.476], ['B', ' CG ', 152.506, 106.468, 75.984], ['B', ' CD1', 153.305, 105.709, 75.214], ['B', ' CD2', 151.536, 107.204, 75.395], ['B', ' CE1', 153.201, 105.687, 73.89], ['B', ' CE2', 151.403, 107.161, 74.037], ['B', ' CZ ', 152.245, 106.412, 73.295], ['B', ' OH ', 152.078, 106.331, 71.944], ['B', ' H ', 155.588, 106.14, 78.025], ['B', ' HA ', 153.66, 108.335, 77.498], ['B', ' HB ', 152.817, 105.53, 77.829], ['B', ' HB ', 151.747, 106.872, 77.885], ['B', ' HD1', 154.032, 105.128, 75.669], ['B', ' HD2', 150.878, 107.807, 75.999], ['B', ' HE1', 153.873, 105.071, 73.304], ['B', ' HE2', 150.636, 107.726, 73.537], ['B', ' HH ', 151.11, 106.355, 71.762]] AA_SCO= 1.8968421052631583 CA_SCO= 1.1513684210526318
[['B', ' N ', 153.034, 108.516, 79.873], ['B', ' CA ', 152.865, 108.934, 81.252], ['B', ' C ', 152.733, 110.413, 81.102], ['B', ' O ', 153.749, 111.101, 80.973], ['B', ' H ', 152.538, 109.053, 79.17], ['B', ' HA ', 151.988, 108.514, 81.724], ['B', ' HA ', 153.742, 108.677, 81.837]] AA_SCO= 1.8852631578947372 CA_SCO= 1.025263157894737
[['B', ' N ', 151.503, 110.913, 81.181], ['B', ' CA ', 151.237, 112.317, 80.907], ['B', ' C ', 152.009, 113.257, 81.793], ['B', ' O ', 152.499, 114.277, 81.326], ['B', ' CB ', 149.746, 112.571, 80.947], ['B', ' CG ', 149.032, 111.858, 79.792], ['B', ' CD ', 148.689, 110.422, 80.096], ['B', ' OE1', 148.285, 110.127, 81.221], ['B', ' NE2', 148.867, 109.522, 79.133], ['B', ' H ', 150.726, 110.289, 81.371], ['B', ' HA ', 151.541, 112.514, 79.898], ['B', ' HB ', 149.336, 112.23, 81.895], ['B', ' HB ', 149.554, 113.642, 80.87], ['B', ' HG ', 148.139, 112.376, 79.573], ['B', ' HG ', 149.687, 111.864, 78.913], ['B', ' HE2', 148.651, 108.56, 79.296], ['B', ' HE2', 149.257, 109.798, 78.222]] AA_SCO= 1.868421052631579 CA_SCO= 0.7509473684210528
[['B', ' N ', 152.313, 112.827, 82.996], ['B', ' CA ', 153.09, 113.636, 83.888], ['B', ' C ', 154.383, 114.086, 83.192], ['B', ' O ', 154.846, 115.195, 83.428], ['B', ' CB ', 153.477, 112.823, 85.138], ['B', ' OG1', 152.294, 112.32, 85.782], ['B', ' CG2', 154.286, 113.664, 86.124], ['B', ' H ', 151.928, 111.958, 83.34], ['B', ' HA ', 152.506, 114.512, 84.172], ['B', ' HB ', 154.088, 111.973, 84.83], ['B', ' HG1', 151.639, 113.036, 85.945], ['B', ' HG2', 154.545, 113.054, 86.987], ['B', ' HG2', 155.195, 114.017, 85.652], ['B', ' HG2', 153.695, 114.517, 86.45]] AA_SCO= 1.8973684210526314 CA_SCO= 1.0523684210526316
[['B', ' N ', 155.044, 113.197, 82.435], ['B', ' CA ', 156.305, 113.551, 81.793], ['B', ' C ', 156.209, 113.825, 80.286], ['B', ' O ', 157.029, 114.578, 79.751], ['B', ' CB ', 157.329, 112.434, 82.027], ['B', ' CG ', 157.686, 112.107, 83.521], ['B', ' CD1', 158.669, 110.924, 83.549], ['B', ' CD2', 158.3, 113.336, 84.218], ['B', ' H ', 154.631, 112.289, 82.233], ['B', ' HA ', 156.665, 114.468, 82.245], ['B', ' HB ', 156.935, 111.522, 81.571], ['B', ' HB ', 158.249, 112.7, 81.51], ['B', ' HG ', 156.779, 111.811, 84.051], ['B', ' HD1', 158.911, 110.672, 84.581], ['B', ' HD1', 158.226, 110.065, 83.07], ['B', ' HD1', 159.58, 111.196, 83.022], ['B', ' HD2', 158.543, 113.085, 85.251], ['B', ' HD2', 159.209, 113.631, 83.695], ['B', ' HD2', 157.597, 114.165, 84.218]] AA_SCO= 1.9305263157894736 CA_SCO= 1.071
[['B', ' N ', 155.278, 113.172, 79.581], ['B', ' CA ', 155.157, 113.333, 78.125], ['B', ' C ', 153.727, 113.639, 77.68], ['B', ' O ', 152.786, 112.975, 78.092], ['B', ' CB ', 155.667, 112.069, 77.404], ['B', ' CG1', 157.146, 111.877, 77.65], ['B', ' CG2', 154.954, 110.84, 77.905], ['B', ' H ', 154.627, 112.564, 80.081], ['B', ' HA ', 155.788, 114.166, 77.823], ['B', ' HB ', 155.512, 112.187, 76.334], ['B', ' HG1', 157.488, 110.985, 77.118], ['B', ' HG1', 157.692, 112.747, 77.29], ['B', ' HG1', 157.333, 111.749, 78.711], ['B', ' HG2', 155.349, 109.992, 77.376], ['B', ' HG2', 155.139, 110.715, 78.962], ['B', ' HG2', 153.893, 110.901, 77.73]] AA_SCO= 1.9473684210526312 CA_SCO= 1.0715789473684212
[['B', ' N ', 153.534, 114.517, 76.702], ['B', ' CA ', 152.155, 114.828, 76.293], ['B', ' C ', 151.671, 113.814, 75.267], ['B', ' O ', 151.506, 114.119, 74.087], ['B', ' CB ', 152.117, 116.247, 75.72], ['B', ' CG ', 150.747, 116.859, 75.556], ['B', ' OD1', 149.809, 116.315, 76.06], ['B', ' OD2', 150.667, 117.95, 75.029], ['B', ' H ', 154.312, 115.006, 76.291], ['B', ' HA ', 151.506, 114.776, 77.168], ['B', ' HB ', 152.664, 116.888, 76.378], ['B', ' HB ', 152.618, 116.259, 74.751]] AA_SCO= 1.8552631578947365 CA_SCO= 0.7605789473684209
[['B', ' N ', 151.5, 112.591, 75.738], ['B', ' CA ', 151.145, 111.464, 74.902], ['B', ' C ', 150.135, 110.526, 75.512], ['B', ' O ', 150.212, 110.178, 76.695], ['B', ' CB ', 152.403, 110.656, 74.584], ['B', ' CG ', 153.479, 111.326, 73.732], ['B', ' CD1', 154.724, 110.484, 73.785], ['B', ' CD2', 152.987, 111.453, 72.297], ['B', ' H ', 151.674, 112.476, 76.733], ['B', ' HA ', 150.706, 111.852, 73.987], ['B', ' HB ', 152.863, 110.332, 75.517], ['B', ' HB ', 152.097, 109.783, 74.044], ['B', ' HG ', 153.719, 112.307, 74.128], ['B', ' HD1', 155.503, 110.947, 73.185], ['B', ' HD1', 155.063, 110.408, 74.809], ['B', ' HD1', 154.514, 109.484, 73.402], ['B', ' HD2', 153.763, 111.918, 71.692], ['B', ' HD2', 152.758, 110.462, 71.902], ['B', ' HD2', 152.096, 112.073, 72.26]] AA_SCO= 1.8905263157894738 CA_SCO= 0.7663684210526314
[['B', ' N ', 149.248, 110.046, 74.67], ['B', ' CA ', 148.27, 109.03, 74.991], ['B', ' C ', 148.039, 108.195, 73.747], ['B', ' O ', 148.329, 108.644, 72.64], ['B', ' CB ', 147.017, 109.638, 75.621], ['B', ' CG ', 146.464, 110.767, 74.921], ['B', ' CD1', 145.497, 110.792, 73.988], ['B', ' CD2', 146.841, 112.128, 75.15], ['B', ' NE1', 145.253, 112.086, 73.607], ['B', ' CE2', 146.07, 112.91, 74.316], ['B', ' CE3', 147.751, 112.737, 76.003], ['B', ' CZ2', 146.187, 114.278, 74.298], ['B', ' CZ3', 147.867, 114.078, 75.988], ['B', ' CH2', 147.115, 114.844, 75.16], ['B', ' H ', 149.25, 110.406, 73.722], ['B', ' HA ', 148.688, 108.369, 75.746], ['B', ' HB ', 146.242, 108.899, 75.653], ['B', ' HB ', 147.228, 109.934, 76.645], ['B', ' HD1', 144.983, 109.917, 73.596], ['B', ' HE1', 144.572, 112.374, 72.918], ['B', ' HE3', 148.357, 112.153, 76.681], ['B', ' HZ2', 145.584, 114.908, 73.644], ['B', ' HZ3', 148.586, 114.524, 76.663], ['B', ' HH2', 147.252, 115.928, 75.186]] AA_SCO= 1.8857894736842105 CA_SCO= 0.7658421052631578
[['B', ' N ', 147.557, 106.98, 73.972], ['B', ' CA ', 147.308, 105.883, 73.02], ['B', ' C ', 148.679, 105.19, 72.891], ['B', ' O ', 149.569, 105.662, 72.174], ['B', ' CB ', 146.711, 106.38, 71.708], ['B', ' CG ', 145.392, 107.195, 71.918], ['B', ' CD ', 144.276, 106.447, 72.614], ['B', ' OE1', 144.129, 105.289, 72.394], ['B', ' OE2', 143.585, 107.051, 73.404], ['B', ' H ', 147.364, 106.774, 74.935], ['B', ' HA ', 146.601, 105.173, 73.414], ['B', ' HB ', 147.427, 106.97, 71.143], ['B', ' HB ', 146.455, 105.515, 71.093], ['B', ' HG ', 145.608, 108.085, 72.473], ['B', ' HG ', 145.038, 107.507, 70.94]] AA_SCO= 1.8826315789473682 CA_SCO= 0.7873684210526315
[['B', ' N ', 148.824, 104.071, 73.636], ['B', ' CA ', 150.078, 103.323, 73.866], ['B', ' C ', 150.312, 101.974, 73.136], ['B', ' O ', 149.47, 101.082, 73.224], ['B', ' CB ', 150.081, 102.998, 75.379], ['B', ' CG ', 151.115, 101.949, 75.877], ['B', ' SD ', 152.783, 102.504, 76.036], ['B', ' CE ', 152.744, 102.892, 77.704], ['B', ' H ', 147.983, 103.716, 74.094], ['B', ' HA ', 150.87, 104.008, 73.642], ['B', ' HB ', 150.269, 103.922, 75.939], ['B', ' HB ', 149.098, 102.66, 75.651], ['B', ' HG ', 150.809, 101.633, 76.852], ['B', ' HG ', 151.092, 101.07, 75.277], ['B', ' HE ', 153.707, 103.286, 78.021], ['B', ' HE ', 151.957, 103.593, 77.907], ['B', ' HE ', 152.542, 101.997, 78.223]] AA_SCO= 1.7878947368421052 CA_SCO= 0.9587894736842106
[['B', ' N ', 151.46, 101.761, 72.441], ['B', ' CA ', 151.908, 100.492, 71.893], ['B', ' C ', 152.436, 99.806, 73.118], ['B', ' O ', 152.95, 100.506, 73.966], ['B', ' CB ', 153.006, 100.891, 70.916], ['B', ' CG ', 153.581, 102.143, 71.524], ['B', ' CD ', 152.402, 102.838, 72.219], ['B', ' HA ', 151.081, 99.942, 71.434], ['B', ' HB ', 153.744, 100.075, 70.835], ['B', ' HB ', 152.579, 101.046, 69.914], ['B', ' HG ', 154.383, 101.88, 72.238], ['B', ' HG ', 154.043, 102.768, 70.747], ['B', ' HD ', 152.78, 103.159, 73.171], ['B', ' HD ', 151.972, 103.65, 71.609]] AA_SCO= 1.7999999999999998 CA_SCO= 0.9441052631578947
[['B', ' N ', 152.493, 98.512, 73.218], ['B', ' CA ', 152.998, 98.05, 74.496], ['B', ' C ', 154.43, 98.48, 74.831], ['B', ' O ', 155.361, 98.34, 74.037], ['B', ' CB ', 152.905, 96.533, 74.544], ['B', ' CG ', 151.478, 96.007, 74.458], ['B', ' CD ', 150.981, 95.831, 73.062], ['B', ' OE1', 151.68, 96.225, 72.143], ['B', ' OE2', 149.887, 95.313, 72.899], ['B', ' H ', 152.161, 97.855, 72.508], ['B', ' HA ', 152.348, 98.455, 75.272], ['B', ' HB ', 153.489, 96.1, 73.733], ['B', ' HB ', 153.336, 96.177, 75.485], ['B', ' HG ', 151.414, 95.058, 74.99], ['B', ' HG ', 150.837, 96.712, 74.952]] AA_SCO= 1.7478947368421054 CA_SCO= 0.8886315789473684
[['B', ' N ', 154.576, 98.931, 76.07], ['B', ' CA ', 155.827, 99.297, 76.73], ['B', ' C ', 156.085, 98.154, 77.687], ['B', ' O ', 155.131, 97.531, 78.139], ['B', ' CB ', 155.766, 100.68, 77.378], ['B', ' CG ', 157.019, 101.098, 78.227], ['B', ' SD ', 156.884, 102.782, 78.938], ['B', ' CE ', 158.322, 102.919, 79.972], ['B', ' H ', 153.71, 99.017, 76.585], ['B', ' HA ', 156.635, 99.303, 75.997], ['B', ' HB ', 155.712, 101.405, 76.575], ['B', ' HB ', 154.872, 100.798, 77.915], ['B', ' HG ', 157.145, 100.405, 79.056], ['B', ' HG ', 157.914, 101.058, 77.607], ['B', ' HE ', 158.324, 103.891, 80.455], ['B', ' HE ', 158.295, 102.137, 80.737], ['B', ' HE ', 159.225, 102.812, 79.366]] AA_SCO= 1.7426315789473683 CA_SCO= 0.833421052631579
[['B', ' N ', 157.336, 97.856, 78.006], ['B', ' CA ', 157.567, 96.678, 78.824], ['B', ' C ', 157.357, 96.882, 80.325], ['B', ' O ', 156.726, 96.044, 80.982], ['B', ' CB ', 159.04, 96.333, 78.646], ['B', ' CG ', 159.412, 96.031, 77.199], ['B', ' OD1', 159.114, 94.977, 76.669], ['B', ' OD2', 159.961, 96.931, 76.609], ['B', ' H ', 158.116, 98.373, 77.616], ['B', ' HA ', 156.923, 95.875, 78.47], ['B', ' HB ', 159.658, 97.157, 79.001], ['B', ' HB ', 159.28, 95.462, 79.26]] AA_SCO= 1.7599999999999998 CA_SCO= 0.8343684210526315
[['B', ' N ', 157.779, 98.023, 80.856], ['B', ' CA ', 157.671, 98.262, 82.297], ['B', ' C ', 156.794, 99.402, 82.69], ['B', ' O ', 157.095, 100.552, 82.377], ['B', ' CB ', 159.047, 98.578, 82.882], ['B', ' CG ', 159.098, 99.019, 84.391], ['B', ' CD1', 158.637, 97.869, 85.325], ['B', ' CD2', 160.521, 99.492, 84.675], ['B', ' H ', 158.235, 98.7, 80.263], ['B', ' HA ', 157.269, 97.365, 82.756], ['B', ' HB ', 159.668, 97.691, 82.783], ['B', ' HB ', 159.493, 99.374, 82.288], ['B', ' HG ', 158.421, 99.859, 84.568], ['B', ' HD1', 158.689, 98.209, 86.356], ['B', ' HD1', 157.61, 97.589, 85.104], ['B', ' HD1', 159.276, 97.01, 85.197], ['B', ' HD2', 160.606, 99.82, 85.706], ['B', ' HD2', 161.218, 98.698, 84.491], ['B', ' HD2', 160.759, 100.324, 84.013]] AA_SCO= 1.7700000000000002 CA_SCO= 0.8313157894736842
[['B', ' N ', 155.775, 99.096, 83.468], ['B', ' CA ', 154.886, 100.118, 83.945], ['B', ' C ', 155.195, 100.498, 85.364], ['B', ' O ', 155.291, 99.635, 86.241], ['B', ' CB ', 153.462, 99.642, 83.87], ['B', ' H ', 155.598, 98.114, 83.701], ['B', ' HA ', 155.021, 100.994, 83.34], ['B', ' HB ', 152.817, 100.431, 84.218], ['B', ' HB ', 153.204, 99.384, 82.86], ['B', ' HB ', 153.351, 98.769, 84.497]] AA_SCO= 1.673157894736842 CA_SCO= 0.8365263157894737
[['B', ' N ', 155.317, 101.787, 85.615], ['B', ' CA ', 155.498, 102.246, 86.975], ['B', ' C ', 154.17, 102.805, 87.392], ['B', ' O ', 153.659, 103.738, 86.76], ['B', ' CB ', 156.6, 103.298, 87.061], ['B', ' CG ', 157.994, 102.863, 86.558], ['B', ' CD1', 158.955, 104.036, 86.696], ['B', ' CD2', 158.488, 101.653, 87.347], ['B', ' H ', 155.282, 102.482, 84.859], ['B', ' HA ', 155.72, 101.408, 87.634], ['B', ' HB ', 156.293, 104.163, 86.473], ['B', ' HB ', 156.698, 103.611, 88.087], ['B', ' HG ', 157.936, 102.598, 85.498], ['B', ' HD1', 159.938, 103.747, 86.331], ['B', ' HD1', 158.587, 104.877, 86.113], ['B', ' HD1', 159.028, 104.325, 87.736], ['B', ' HD2', 159.466, 101.37, 86.986], ['B', ' HD2', 158.553, 101.895, 88.397], ['B', ' HD2', 157.812, 100.82, 87.21]] AA_SCO= 1.8173684210526317 CA_SCO= 0.9250000000000002
[['B', ' N ', 153.575, 102.207, 88.405], ['B', ' CA ', 152.243, 102.633, 88.793], ['B', ' C ', 152.273, 103.332, 90.152], ['B', ' O ', 152.714, 102.78, 91.162], ['B', ' CB ', 151.297, 101.43, 88.699], ['B', ' CG1', 151.279, 100.922, 87.283], ['B', ' CG2', 151.729, 100.286, 89.607], ['B', ' H ', 154.068, 101.442, 88.887], ['B', ' HA ', 151.885, 103.364, 88.07], ['B', ' HB ', 150.311, 101.772, 88.924], ['B', ' HG1', 150.579, 100.095, 87.203], ['B', ' HG1', 150.976, 101.711, 86.63], ['B', ' HG1', 152.272, 100.579, 86.993], ['B', ' HG2', 151.04, 99.457, 89.506], ['B', ' HG2', 152.718, 99.956, 89.329], ['B', ' HG2', 151.733, 100.616, 90.622]] AA_SCO= 1.795263157894737 CA_SCO= 1.029157894736842
[['B', ' N ', 151.792, 104.569, 90.163], ['B', ' CA ', 151.91, 105.477, 91.309], ['B', ' C ', 151.143, 105.039, 92.554], ['B', ' O ', 151.612, 105.233, 93.667], ['B', ' CB ', 151.405, 106.848, 90.89], ['B', ' CG ', 152.228, 107.575, 89.748], ['B', ' CD ', 153.555, 107.981, 90.105], ['B', ' OE1', 153.744, 108.303, 91.225], ['B', ' OE2', 154.399, 108.0, 89.248], ['B', ' H ', 151.364, 104.923, 89.302], ['B', ' HA ', 152.968, 105.553, 91.575], ['B', ' HB ', 150.381, 106.746, 90.587], ['B', ' HB ', 151.402, 107.511, 91.761], ['B', ' HG ', 152.306, 106.898, 88.899], ['B', ' HG ', 151.688, 108.447, 89.417]] AA_SCO= 1.888947368421053 CA_SCO= 1.0660526315789474
[['B', ' N ', 149.978, 104.431, 92.386], ['B', ' CA ', 149.23, 103.966, 93.554], ['B', ' C ', 147.928, 104.635, 93.901], ['B', ' O ', 147.416, 105.45, 93.146], ['B', ' H ', 149.635, 104.308, 91.447], ['B', ' HA ', 149.018, 102.917, 93.411], ['B', ' HA ', 149.878, 104.038, 94.418]] AA_SCO= 2.0310526315789477 CA_SCO= 1.2144736842105264
[['B', ' N ', 147.379, 104.224, 95.052], ['B', ' CA ', 146.099, 104.688, 95.572], ['B', ' C ', 144.939, 104.52, 94.619], ['B', ' O ', 144.385, 105.503, 94.128], ['B', ' CB ', 146.209, 106.127, 96.019], ['B', ' OG ', 147.153, 106.246, 97.039], ['B', ' H ', 147.9, 103.558, 95.62], ['B', ' HA ', 145.873, 104.089, 96.457], ['B', ' HB ', 146.497, 106.754, 95.181], ['B', ' HB ', 145.242, 106.477, 96.373], ['B', ' HG ', 147.105, 107.154, 97.339]] AA_SCO= 2.068421052631579 CA_SCO= 1.488842105263158
[['B', ' N ', 144.578, 103.28, 94.318], ['B', ' CA ', 143.52, 103.069, 93.355], ['B', ' C ', 142.212, 103.281, 94.018], ['B', ' O ', 141.914, 102.636, 95.013], ['B', ' CB ', 143.517, 101.636, 92.854], ['B', ' CG1', 142.361, 101.39, 91.857], ['B', ' CG2', 144.779, 101.365, 92.305], ['B', ' H ', 145.002, 102.489, 94.808], ['B', ' HA ', 143.632, 103.77, 92.529], ['B', ' HB ', 143.36, 100.975, 93.679], ['B', ' HG1', 142.392, 100.354, 91.533], ['B', ' HG1', 141.396, 101.58, 92.327], ['B', ' HG1', 142.473, 102.04, 90.991], ['B', ' HG2', 144.793, 100.338, 91.965], ['B', ' HG2', 144.953, 102.045, 91.491], ['B', ' HG2', 145.543, 101.509, 93.061]] AA_SCO= 2.08 CA_SCO= 1.497157894736842
[['B', ' N ', 141.403, 104.154, 93.481], ['B', ' CA ', 140.146, 104.373, 94.13], ['B', ' C ', 139.125, 103.461, 93.512], ['B', ' O ', 139.065, 103.31, 92.296], ['B', ' CB ', 139.671, 105.783, 93.992], ['B', ' SG ', 138.285, 106.092, 95.03], ['B', ' H ', 141.68, 104.687, 92.669], ['B', ' HA ', 140.227, 104.145, 95.188], ['B', ' HB ', 140.446, 106.466, 94.204], ['B', ' HB ', 139.363, 105.953, 92.968], ['B', ' HG ', 137.543, 105.047, 94.626]] AA_SCO= 2.0426315789473684 CA_SCO= 1.4982105263157894
[['B', ' N ', 138.32, 102.858, 94.344], ['B', ' CA ', 137.25, 102.013, 93.881], ['B', ' C ', 136.154, 102.984, 93.549], ['B', ' O ', 136.325, 104.172, 93.794], ['B', ' CB ', 136.822, 101.022, 94.945], ['B', ' CG ', 137.921, 100.094, 95.466], ['B', ' CD1', 137.316, 99.185, 96.489], ['B', ' CD2', 138.576, 99.324, 94.335], ['B', ' H ', 138.438, 103.015, 95.35], ['B', ' HA ', 137.539, 101.5, 92.968], ['B', ' HB ', 136.445, 101.59, 95.799], ['B', ' HB ', 136.016, 100.407, 94.553], ['B', ' HG ', 138.685, 100.69, 95.974], ['B', ' HD1', 138.085, 98.538, 96.904], ['B', ' HD1', 136.881, 99.777, 97.282], ['B', ' HD1', 136.542, 98.575, 96.029], ['B', ' HD2', 139.343, 98.679, 94.748], ['B', ' HD2', 137.835, 98.718, 93.815], ['B', ' HD2', 139.04, 100.014, 93.642]] AA_SCO= 2.123684210526316 CA_SCO= 1.4982105263157894
[['B', ' N ', 135.096, 102.553, 92.879], ['B', ' CA ', 133.994, 103.44, 92.448], ['B', ' C ', 134.384, 104.201, 91.174], ['B', ' O ', 133.627, 104.24, 90.209], ['B', ' CB ', 133.59, 104.48, 93.518], ['B', ' CG ', 133.147, 103.906, 94.856], ['B', ' CD ', 131.964, 103.021, 94.725], ['B', ' OE1', 130.997, 103.346, 94.032], ['B', ' NE2', 132.013, 101.873, 95.387], ['B', ' H ', 135.016, 101.565, 92.682], ['B', ' HA ', 133.124, 102.826, 92.213], ['B', ' HB ', 134.333, 105.251, 93.665], ['B', ' HB ', 132.717, 105.006, 93.141], ['B', ' HG ', 133.962, 103.339, 95.301], ['B', ' HG ', 132.883, 104.737, 95.517], ['B', ' HE2', 131.242, 101.233, 95.339], ['B', ' HE2', 132.81, 101.651, 95.946]] AA_SCO= 2.2126315789473683 CA_SCO= 1.7989473684210526
[['B', ' N ', 135.577, 104.774, 91.181], ['B', ' CA ', 136.14, 105.555, 90.094], ['B', ' C ', 136.586, 104.673, 88.945], ['B', ' O ', 137.596, 103.956, 89.028], ['B', ' CB ', 137.347, 106.321, 90.618], ['B', ' CG ', 138.02, 107.232, 89.612], ['B', ' OD1', 137.835, 107.047, 88.418], ['B', ' OD2', 138.751, 108.088, 90.032], ['B', ' H ', 136.091, 104.695, 92.051], ['B', ' HA ', 135.381, 106.251, 89.729], ['B', ' HB ', 137.041, 106.905, 91.452], ['B', ' HB ', 138.083, 105.6, 90.981]] AA_SCO= 2.227368421052631 CA_SCO= 1.7896842105263158
[['B', ' N ', 135.823, 104.747, 87.866], ['B', ' CA ', 136.02, 103.91, 86.713], ['B', ' C ', 137.244, 104.276, 85.913], ['B', ' O ', 137.665, 103.494, 85.062], ['B', ' CB ', 134.79, 103.97, 85.8], ['B', ' CG ', 134.566, 105.313, 85.042], ['B', ' CD ', 133.841, 106.374, 85.843], ['B', ' OE1', 133.852, 106.303, 87.05], ['B', ' OE2', 133.274, 107.253, 85.243], ['B', ' H ', 135.023, 105.39, 87.872], ['B', ' HA ', 136.136, 102.887, 87.062], ['B', ' HB ', 134.863, 103.18, 85.052], ['B', ' HB ', 133.897, 103.773, 86.393], ['B', ' HG ', 135.51, 105.724, 84.698], ['B', ' HG ', 133.974, 105.095, 84.155]] AA_SCO= 2.2210526315789476 CA_SCO= 1.7902105263157893
[['B', ' N ', 137.825, 105.457, 86.126], ['B', ' CA ', 138.949, 105.792, 85.28], ['B', ' C ', 140.146, 105.002, 85.722], ['B', ' O ', 140.787, 104.334, 84.913], ['B', ' CB ', 139.306, 107.279, 85.345], ['B', ' CG ', 138.315, 108.208, 84.721], ['B', ' ND1', 137.971, 108.143, 83.39], ['B', ' CD2', 137.618, 109.253, 85.244], ['B', ' CE1', 137.098, 109.098, 83.114], ['B', ' NE2', 136.867, 109.798, 84.219], ['B', ' H ', 137.512, 106.084, 86.884], ['B', ' HA ', 138.731, 105.531, 84.246], ['B', ' HB ', 139.418, 107.572, 86.394], ['B', ' HB ', 140.272, 107.436, 84.862], ['B', ' HD1', 138.32, 107.486, 82.72], ['B', ' HD2', 137.579, 109.685, 86.248], ['B', ' HE1', 136.701, 109.207, 82.105]] AA_SCO= 2.2184210526315793 CA_SCO= 1.7902631578947368
[['B', ' N ', 140.398, 104.984, 87.025], ['B', ' CA ', 141.554, 104.271, 87.514], ['B', ' C ', 141.367, 102.781, 87.371], ['B', ' O ', 142.305, 102.07, 87.002], ['B', ' CB ', 141.823, 104.62, 88.962], ['B', ' OG ', 142.208, 105.964, 89.091], ['B', ' H ', 139.83, 105.539, 87.661], ['B', ' HA ', 142.419, 104.569, 86.919], ['B', ' HB ', 140.92, 104.437, 89.554], ['B', ' HB ', 142.608, 103.975, 89.35], ['B', ' HG ', 142.438, 106.085, 90.016]] AA_SCO= 2.2536842105263157 CA_SCO= 1.7867368421052627
[['B', ' N ', 140.153, 102.292, 87.606], ['B', ' CA ', 139.955, 100.864, 87.51], ['B', ' C ', 140.129, 100.403, 86.071], ['B', ' O ', 140.771, 99.379, 85.806], ['B', ' CB ', 138.538, 100.552, 87.979], ['B', ' CG ', 138.244, 100.814, 89.479], ['B', ' CD1', 136.753, 100.73, 89.713], ['B', ' CD2', 138.966, 99.816, 90.336], ['B', ' H ', 139.384, 102.9, 87.915], ['B', ' HA ', 140.698, 100.362, 88.122], ['B', ' HB ', 137.849, 101.158, 87.398], ['B', ' HB ', 138.331, 99.505, 87.772], ['B', ' HG ', 138.576, 101.817, 89.753], ['B', ' HD1', 136.544, 100.932, 90.757], ['B', ' HD1', 136.251, 101.478, 89.099], ['B', ' HD1', 136.391, 99.739, 89.452], ['B', ' HD2', 138.743, 100.025, 91.368], ['B', ' HD2', 138.646, 98.806, 90.09], ['B', ' HD2', 140.023, 99.909, 90.184]] AA_SCO= 2.2268421052631577 CA_SCO= 1.8208421052631578
[['B', ' N ', 139.6, 101.179, 85.126], ['B', ' CA ', 139.689, 100.814, 83.734], ['B', ' C ', 141.112, 100.861, 83.239], ['B', ' O ', 141.596, 99.914, 82.602], ['B', ' CB ', 138.858, 101.755, 82.873], ['B', ' CG ', 138.884, 101.357, 81.485], ['B', ' ND1', 138.113, 100.324, 80.996], ['B', ' CD2', 139.636, 101.783, 80.461], ['B', ' CE1', 138.391, 100.147, 79.724], ['B', ' NE2', 139.311, 101.012, 79.383], ['B', ' H ', 139.065, 102.021, 85.349], ['B', ' HA ', 139.318, 99.801, 83.598], ['B', ' HB ', 137.825, 101.754, 83.215], ['B', ' HB ', 139.24, 102.775, 82.962], ['B', ' HD2', 140.391, 102.57, 80.488], ['B', ' HE1', 137.955, 99.395, 79.071], ['B', ' HE2', 139.762, 101.081, 78.461]] AA_SCO= 2.2578947368421054 CA_SCO= 1.8463684210526314
[['B', ' N ', 141.792, 101.97, 83.525], ['B', ' CA ', 143.127, 102.162, 83.026], ['B', ' C ', 144.065, 101.099, 83.559], ['B', ' O ', 144.847, 100.546, 82.786], ['B', ' CB ', 143.6, 103.56, 83.396], ['B', ' CG ', 142.905, 104.694, 82.641], ['B', ' CD ', 143.332, 106.092, 83.119], ['B', ' OE1', 144.247, 106.189, 83.905], ['B', ' OE2', 142.743, 107.072, 82.688], ['B', ' H ', 141.355, 102.72, 84.071], ['B', ' HA ', 143.101, 102.079, 81.937], ['B', ' HB ', 143.426, 103.721, 84.462], ['B', ' HB ', 144.637, 103.646, 83.227], ['B', ' HG ', 143.162, 104.599, 81.585], ['B', ' HG ', 141.829, 104.588, 82.72]] AA_SCO= 2.27 CA_SCO= 1.8920526315789472
[['B', ' N ', 143.938, 100.714, 84.832], ['B', ' CA ', 144.809, 99.667, 85.324], ['B', ' C ', 144.575, 98.345, 84.656], ['B', ' O ', 145.533, 97.6, 84.431], ['B', ' CB ', 144.669, 99.477, 86.815], ['B', ' CG ', 145.266, 100.52, 87.677], ['B', ' CD1', 144.836, 100.301, 89.034], ['B', ' CD2', 146.833, 100.431, 87.624], ['B', ' H ', 143.278, 101.178, 85.466], ['B', ' HA ', 145.824, 99.963, 85.1], ['B', ' HB ', 143.599, 99.428, 87.044], ['B', ' HB ', 145.105, 98.556, 87.072], ['B', ' HG ', 144.925, 101.493, 87.37], ['B', ' HD1', 145.285, 101.062, 89.616], ['B', ' HD1', 143.749, 100.373, 89.094], ['B', ' HD1', 145.16, 99.327, 89.38], ['B', ' HD2', 147.258, 101.192, 88.28], ['B', ' HD2', 147.158, 99.449, 87.955], ['B', ' HD2', 147.204, 100.603, 86.625]] AA_SCO= 2.2531578947368422 CA_SCO= 1.888157894736842
[['B', ' N ', 143.333, 98.002, 84.346], ['B', ' CA ', 143.158, 96.729, 83.687], ['B', ' C ', 143.862, 96.749, 82.33], ['B', ' O ', 144.568, 95.793, 81.985], ['B', ' CB ', 141.68, 96.408, 83.565], ['B', ' CG ', 141.04, 96.073, 84.908], ['B', ' CD ', 139.557, 95.799, 84.776], ['B', ' CE ', 138.927, 95.512, 86.132], ['B', ' NZ ', 137.457, 95.256, 86.018], ['B', ' H ', 142.531, 98.593, 84.601], ['B', ' HA ', 143.627, 95.956, 84.293], ['B', ' HB ', 141.156, 97.275, 83.148], ['B', ' HB ', 141.538, 95.57, 82.885], ['B', ' HG ', 141.531, 95.193, 85.328], ['B', ' HG ', 141.192, 96.901, 85.597], ['B', ' HD ', 139.071, 96.675, 84.337], ['B', ' HD ', 139.397, 94.945, 84.119], ['B', ' HE ', 139.407, 94.64, 86.574], ['B', ' HE ', 139.087, 96.373, 86.787], ['B', ' HZ ', 137.073, 95.072, 86.935], ['B', ' HZ ', 137.003, 96.067, 85.62], ['B', ' HZ ', 137.297, 94.456, 85.422]] AA_SCO= 2.2742105263157897 CA_SCO= 1.890736842105263
[['B', ' N ', 143.753, 97.865, 81.597], ['B', ' CA ', 144.43, 97.947, 80.303], ['B', ' C ', 145.944, 97.912, 80.476], ['B', ' O ', 146.649, 97.262, 79.698], ['B', ' CB ', 144.022, 99.207, 79.545], ['B', ' CG ', 142.589, 99.191, 79.016], ['B', ' CD ', 142.217, 100.472, 78.336], ['B', ' OE1', 142.912, 101.422, 78.536], ['B', ' OE2', 141.231, 100.505, 77.614], ['B', ' H ', 143.144, 98.628, 81.925], ['B', ' HA ', 144.137, 97.079, 79.709], ['B', ' HB ', 144.124, 100.073, 80.205], ['B', ' HB ', 144.694, 99.36, 78.698], ['B', ' HG ', 142.479, 98.368, 78.311], ['B', ' HG ', 141.908, 99.016, 79.853]] AA_SCO= 2.3710526315789475 CA_SCO= 1.890578947368421
[['B', ' N ', 146.438, 98.563, 81.523], ['B', ' CA ', 147.855, 98.597, 81.799], ['B', ' C ', 148.381, 97.206, 82.004], ['B', ' O ', 149.407, 96.852, 81.431], ['B', ' CB ', 148.123, 99.429, 83.057], ['B', ' CG ', 149.581, 99.667, 83.46], ['B', ' CD1', 149.692, 101.036, 84.089], ['B', ' CD2', 150.004, 98.615, 84.497], ['B', ' H ', 145.799, 99.106, 82.11], ['B', ' HA ', 148.364, 99.046, 80.948], ['B', ' HB ', 147.612, 100.373, 82.983], ['B', ' HB ', 147.67, 98.901, 83.886], ['B', ' HG ', 150.228, 99.62, 82.591], ['B', ' HD1', 150.708, 101.223, 84.384], ['B', ' HD1', 149.398, 101.797, 83.385], ['B', ' HD1', 149.047, 101.088, 84.96], ['B', ' HD2', 151.012, 98.802, 84.805], ['B', ' HD2', 149.352, 98.68, 85.367], ['B', ' HD2', 149.95, 97.62, 84.095]] AA_SCO= 2.3547368421052632 CA_SCO= 1.880947368421053
[['B', ' N ', 147.7, 96.405, 82.82], ['B', ' CA ', 148.182, 95.061, 83.081], ['B', ' C ', 148.223, 94.209, 81.845], ['B', ' O ', 149.135, 93.392, 81.7], ['B', ' CB ', 147.346, 94.372, 84.116], ['B', ' CG ', 147.723, 92.876, 84.406], ['B', ' CD ', 149.064, 92.667, 85.087], ['B', ' NE ', 150.17, 92.561, 84.13], ['B', ' CZ ', 151.474, 92.36, 84.451], ['B', ' NH1', 151.862, 92.207, 85.729], ['B', ' NH2', 152.363, 92.318, 83.476], ['B', ' H ', 146.864, 96.763, 83.299], ['B', ' HA ', 149.195, 95.147, 83.47], ['B', ' HB ', 147.411, 94.95, 85.006], ['B', ' HB ', 146.301, 94.397, 83.797], ['B', ' HG ', 146.968, 92.467, 85.071], ['B', ' HG ', 147.718, 92.296, 83.485], ['B', ' HD ', 149.276, 93.502, 85.746], ['B', ' HD ', 149.027, 91.748, 85.672], ['B', ' HE ', 149.945, 92.67, 83.122], ['B', ' HH1', 151.175, 92.216, 86.501], ['B', ' HH1', 152.86, 92.079, 85.979], ['B', ' HH2', 152.086, 92.462, 82.488], ['B', ' HH2', 153.353, 92.143, 83.67]] AA_SCO= 2.434736842105263 CA_SCO= 1.8752105263157894
[['B', ' N ', 147.241, 94.374, 80.967], ['B', ' CA ', 147.208, 93.611, 79.736], ['B', ' C ', 148.379, 93.953, 78.825], ['B', ' O ', 148.886, 93.091, 78.104], ['B', ' CB ', 145.908, 93.863, 78.978], ['B', ' CG ', 144.669, 93.288, 79.626], ['B', ' CD ', 143.417, 93.646, 78.876], ['B', ' OE1', 143.513, 94.412, 77.946], ['B', ' OE2', 142.37, 93.16, 79.228], ['B', ' H ', 146.47, 95.017, 81.19], ['B', ' HA ', 147.268, 92.553, 79.989], ['B', ' HB ', 145.759, 94.938, 78.876], ['B', ' HB ', 145.989, 93.45, 77.974], ['B', ' HG ', 144.763, 92.204, 79.659], ['B', ' HG ', 144.599, 93.648, 80.647]] AA_SCO= 2.441052631578947 CA_SCO= 1.8502105263157893
[['B', ' N ', 148.795, 95.215, 78.835], ['B', ' CA ', 149.847, 95.665, 77.944], ['B', ' C ', 151.269, 95.59, 78.516], ['B', ' O ', 152.221, 95.357, 77.77], ['B', ' CB ', 149.48, 97.073, 77.544], ['B', ' CG ', 148.195, 97.053, 76.732], ['B', ' CD ', 147.65, 98.389, 76.452], ['B', ' CE ', 148.372, 99.049, 75.36], ['B', ' NZ ', 147.71, 100.245, 74.997], ['B', ' H ', 148.309, 95.893, 79.432], ['B', ' HA ', 149.822, 95.035, 77.057], ['B', ' HB ', 149.309, 97.668, 78.448], ['B', ' HB ', 150.289, 97.533, 76.993], ['B', ' HG ', 148.386, 96.54, 75.787], ['B', ' HG ', 147.432, 96.492, 77.267], ['B', ' HD ', 146.597, 98.302, 76.186], ['B', ' HD ', 147.724, 99.009, 77.35], ['B', ' HE ', 149.388, 99.289, 75.662], ['B', ' HE ', 148.407, 98.392, 74.489], ['B', ' HZ ', 148.226, 100.658, 74.233], ['B', ' HZ ', 146.775, 100.05, 74.702], ['B', ' HZ ', 147.673, 100.878, 75.783]] AA_SCO= 2.3926315789473684 CA_SCO= 1.8274736842105264
[['B', ' N ', 151.416, 95.762, 79.825], ['B', ' CA ', 152.707, 95.734, 80.501], ['B', ' C ', 153.213, 94.314, 80.61], ['B', ' O ', 152.437, 93.36, 80.713], ['B', ' CB ', 152.588, 96.336, 81.888], ['B', ' H ', 150.59, 95.964, 80.385], ['B', ' HA ', 153.428, 96.299, 79.912], ['B', ' HB ', 153.557, 96.316, 82.373], ['B', ' HB ', 152.235, 97.357, 81.821], ['B', ' HB ', 151.875, 95.749, 82.458]] AA_SCO= 2.417368421052632 CA_SCO= 1.8215263157894739
[['B', ' N ', 154.524, 94.154, 80.656], ['B', ' CA ', 155.068, 92.841, 80.903], ['B', ' C ', 155.361, 92.817, 82.376], ['B', ' O ', 155.053, 91.86, 83.087], ['B', ' CB ', 156.315, 92.63, 80.079], ['B', ' CG ', 156.025, 92.567, 78.613], ['B', ' CD ', 157.278, 92.443, 77.824], ['B', ' CE ', 156.996, 92.46, 76.338], ['B', ' NZ ', 158.243, 92.555, 75.57], ['B', ' H ', 155.161, 94.947, 80.574], ['B', ' HA ', 154.33, 92.073, 80.671], ['B', ' HB ', 157.013, 93.452, 80.255], ['B', ' HB ', 156.806, 91.705, 80.382], ['B', ' HG ', 155.381, 91.712, 78.409], ['B', ' HG ', 155.497, 93.475, 78.309], ['B', ' HD ', 157.943, 93.272, 78.064], ['B', ' HD ', 157.781, 91.512, 78.079], ['B', ' HE ', 156.471, 91.55, 76.056], ['B', ' HE ', 156.371, 93.323, 76.101], ['B', ' HZ ', 158.05, 92.586, 74.585], ['B', ' HZ ', 158.695, 93.438, 75.867], ['B', ' HZ ', 158.845, 91.777, 75.773]] AA_SCO= 2.4647368421052636 CA_SCO= 1.8206315789473684
[['B', ' N ', 155.858, 93.937, 82.846], ['B', ' CA ', 156.178, 94.107, 84.233], ['B', ' C ', 155.378, 95.247, 84.777], ['B', ' O ', 155.295, 96.306, 84.145], ['B', ' CB ', 157.64, 94.487, 84.381], ['B', ' CG ', 158.666, 93.543, 83.854], ['B', ' CD1', 159.976, 94.237, 83.928], ['B', ' CD2', 158.692, 92.28, 84.692], ['B', ' H ', 156.073, 94.694, 82.199], ['B', ' HA ', 155.933, 93.206, 84.797], ['B', ' HB ', 157.788, 95.42, 83.87], ['B', ' HB ', 157.839, 94.639, 85.442], ['B', ' HG ', 158.454, 93.294, 82.815], ['B', ' HD1', 160.762, 93.582, 83.554], ['B', ' HD1', 159.948, 95.147, 83.328], ['B', ' HD1', 160.166, 94.49, 84.966], ['B', ' HD2', 159.46, 91.607, 84.317], ['B', ' HD2', 158.906, 92.529, 85.735], ['B', ' HD2', 157.725, 91.777, 84.644]] AA_SCO= 2.4763157894736842 CA_SCO= 1.822473684210527
[['B', ' N ', 154.795, 95.046, 85.931], ['B', ' CA ', 154.116, 96.134, 86.588], ['B', ' C ', 154.793, 96.279, 87.916], ['B', ' O ', 154.901, 95.312, 88.677], ['B', ' CB ', 152.612, 95.881, 86.737], ['B', ' CG1', 151.955, 97.035, 87.479], ['B', ' CG2', 152.008, 95.75, 85.364], ['B', ' H ', 154.859, 94.114, 86.38], ['B', ' HA ', 154.261, 97.057, 86.027], ['B', ' HB ', 152.45, 94.967, 87.307], ['B', ' HG1', 150.887, 96.847, 87.572], ['B', ' HG1', 152.384, 97.141, 88.474], ['B', ' HG1', 152.114, 97.958, 86.924], ['B', ' HG2', 150.941, 95.566, 85.448], ['B', ' HG2', 152.18, 96.664, 84.815], ['B', ' HG2', 152.473, 94.934, 84.837]] AA_SCO= 2.4242105263157896 CA_SCO= 1.805578947368421
[['B', ' N ', 155.275, 97.473, 88.186], ['B', ' CA ', 155.945, 97.69, 89.428], ['B', ' C ', 155.269, 98.729, 90.251], ['B', ' O ', 155.164, 99.895, 89.851], ['B', ' CB ', 157.387, 98.121, 89.207], ['B', ' SG ', 158.332, 98.358, 90.732], ['B', ' H ', 155.182, 98.236, 87.508], ['B', ' HA ', 155.929, 96.773, 89.988], ['B', ' HB ', 157.899, 97.389, 88.603], ['B', ' HB ', 157.39, 99.056, 88.662], ['B', ' HG ', 157.447, 99.185, 91.348]] AA_SCO= 2.383684210526315 CA_SCO= 1.806263157894737
[['B', ' N ', 154.829, 98.32, 91.421], ['B', ' CA ', 154.218, 99.283, 92.288], ['B', ' C ', 155.306, 100.304, 92.434], ['B', ' O ', 156.454, 99.926, 92.67], ['B', ' CB ', 153.799, 98.632, 93.579], ['B', ' H ', 154.948, 97.33, 91.669], ['B', ' HA ', 153.368, 99.743, 91.807], ['B', ' HB ', 153.4, 99.326, 94.258], ['B', ' HB ', 153.053, 97.869, 93.366], ['B', ' HB ', 154.633, 98.194, 94.025]] AA_SCO= 2.453157894736842 CA_SCO= 1.8131052631578946
[['B', ' N ', 155.008, 101.579, 92.311], ['B', ' CA ', 156.084, 102.541, 92.345], ['B', ' C ', 155.963, 103.524, 93.458], ['B', ' O ', 155.992, 104.728, 93.253], ['B', ' CB ', 156.143, 103.241, 91.013], ['B', ' CG ', 157.347, 103.996, 90.817], ['B', ' CD1', 158.566, 103.35, 90.788], ['B', ' CD2', 157.303, 105.344, 90.631], ['B', ' CE1', 159.703, 104.046, 90.584], ['B', ' CE2', 158.442, 106.037, 90.429], ['B', ' CZ ', 159.635, 105.396, 90.405], ['B', ' H ', 154.057, 101.902, 92.125], ['B', ' HA ', 157.016, 102.007, 92.495], ['B', ' HB ', 156.066, 102.5, 90.218], ['B', ' HB ', 155.289, 103.917, 90.919], ['B', ' HD1', 158.611, 102.268, 90.926], ['B', ' HD2', 156.335, 105.871, 90.655], ['B', ' HE1', 160.664, 103.533, 90.558], ['B', ' HE2', 158.398, 107.115, 90.287], ['B', ' HZ ', 160.524, 105.969, 90.239]] AA_SCO= 2.434736842105263 CA_SCO= 1.8128421052631585
[['B', ' N ', 155.819, 102.984, 94.631], ['B', ' CA ', 155.725, 103.728, 95.86], ['B', ' C ', 154.921, 102.901, 96.802], ['B', ' O ', 154.222, 101.975, 96.389], ['B', ' H ', 155.761, 101.973, 94.652], ['B', ' HA ', 156.719, 103.91, 96.272], ['B', ' HA ', 155.244, 104.689, 95.689]] AA_SCO= 2.325263157894737 CA_SCO= 1.8127368421052636
[['B', ' N ', 154.936, 103.244, 98.07], ['B', ' CA ', 154.163, 102.442, 99.009], ['B', ' C ', 152.673, 102.466, 98.73], ['B', ' O ', 152.025, 101.44, 98.858], ['B', ' CB ', 154.428, 102.876, 100.433], ['B', ' OG ', 155.743, 102.573, 100.819], ['B', ' H ', 155.494, 104.035, 98.406], ['B', ' HA ', 154.484, 101.404, 98.914], ['B', ' HB ', 154.268, 103.947, 100.522], ['B', ' HB ', 153.72, 102.383, 101.101], ['B', ' HG ', 155.845, 102.947, 101.704]] AA_SCO= 2.3389473684210524 CA_SCO= 1.8179473684210528
[['B', ' N ', 152.125, 103.579, 98.217], ['B', ' CA ', 150.709, 103.762, 97.958], ['B', ' C ', 150.184, 102.803, 96.886], ['B', ' O ', 148.978, 102.596, 96.752], ['B', ' CB ', 150.401, 105.228, 97.615], ['B', ' SG ', 150.412, 106.392, 99.069], ['B', ' H ', 152.75, 104.369, 98.066], ['B', ' HA ', 150.189, 103.543, 98.882], ['B', ' HB ', 151.127, 105.604, 96.879], ['B', ' HB ', 149.419, 105.308, 97.147]] AA_SCO= 2.3757894736842107 CA_SCO= 1.8183157894736843
[['B', ' N ', 151.093, 102.217, 96.116], ['B', ' CA ', 150.762, 101.266, 95.078], ['B', ' C ', 150.777, 99.809, 95.567], ['B', ' O ', 150.195, 98.936, 94.917], ['B', ' CB ', 151.738, 101.484, 93.945], ['B', ' H ', 152.087, 102.395, 96.281], ['B', ' HA ', 149.753, 101.449, 94.745], ['B', ' HB ', 151.527, 100.81, 93.134], ['B', ' HB ', 151.678, 102.494, 93.592], ['B', ' HB ', 152.735, 101.326, 94.308]] AA_SCO= 2.38578947368421 CA_SCO= 1.8478947368421057
[['B', ' N ', 151.414, 99.544, 96.703], ['B', ' CA ', 151.58, 98.218, 97.296], ['B', ' C ', 151.699, 98.446, 98.783], ['B', ' O ', 152.798, 98.68, 99.282], ['B', ' CB ', 152.778, 97.466, 96.751], ['B', ' H ', 151.79, 100.316, 97.262], ['B', ' HA ', 150.693, 97.623, 97.107], ['B', ' HB ', 152.849, 96.492, 97.259], ['B', ' HB ', 152.654, 97.307, 95.696], ['B', ' HB ', 153.679, 98.038, 96.94]] AA_SCO= 2.3847368421052635 CA_SCO= 1.8577368421052634
[['B', ' N ', 150.552, 98.371, 99.451], ['B', ' CA ', 150.314, 98.782, 100.826], ['B', ' C ', 149.978, 100.236, 100.818], ['B', ' O ', 150.817, 101.09, 101.082], ['B', ' CB ', 151.484, 98.536, 101.779], ['B', ' OG1', 151.802, 97.137, 101.816], ['B', ' CG2', 151.078, 98.976, 103.13], ['B', ' H ', 149.753, 98.079, 98.922], ['B', ' HA ', 149.45, 98.261, 101.209], ['B', ' HB ', 152.353, 99.113, 101.502], ['B', ' HG1', 152.048, 96.811, 100.91], ['B', ' HG2', 151.86, 98.816, 103.798], ['B', ' HG2', 150.833, 100.02, 103.161], ['B', ' HG2', 150.224, 98.424, 103.423]] AA_SCO= 2.41421052631579 CA_SCO= 1.8573157894736843
[['B', ' N ', 148.714, 100.519, 100.545], ['B', ' CA ', 148.323, 101.885, 100.38], ['B', ' C ', 148.773, 102.654, 101.605], ['B', ' O ', 148.398, 102.282, 102.714], ['B', ' H ', 148.046, 99.784, 100.418], ['B', ' HA ', 148.711, 102.263, 99.45], ['B', ' HA ', 147.241, 101.934, 100.295]] AA_SCO= 2.4473684210526314 CA_SCO= 1.857263157894737
[['B', ' N ', 149.52, 103.744, 101.402], ['B', ' CA ', 150.062, 104.59, 102.428], ['B', ' C ', 149.132, 105.758, 102.472], ['B', ' O ', 148.628, 106.184, 101.437], ['B', ' CB ', 151.542, 104.952, 102.092], ['B', ' SG ', 152.036, 106.001, 100.493], ['B', ' H ', 149.743, 104.001, 100.457], ['B', ' HA ', 150.052, 104.068, 103.387], ['B', ' HB ', 151.965, 105.479, 102.958], ['B', ' HB ', 152.1, 104.015, 102.031]] AA_SCO= 2.46578947368421 CA_SCO= 1.856
[['B', ' N ', 148.867, 106.289, 103.656], ['B', ' CA ', 147.98, 107.442, 103.863], ['B', ' C ', 146.516, 107.1, 103.522], ['B', ' O ', 145.647, 107.09, 104.38], ['B', ' CB ', 148.438, 108.641, 103.025], ['B', ' CG ', 149.784, 109.181, 103.418], ['B', ' CD1', 150.946, 108.645, 102.893], ['B', ' CD2', 149.9, 110.248, 104.251], ['B', ' CE1', 152.191, 109.163, 103.209], ['B', ' CE2', 151.145, 110.773, 104.575], ['B', ' CZ ', 152.289, 110.235, 104.059], ['B', ' H ', 149.343, 105.876, 104.457], ['B', ' HA ', 148.027, 107.724, 104.917], ['B', ' HB ', 148.458, 108.427, 101.969], ['B', ' HB ', 147.715, 109.446, 103.161], ['B', ' HD1', 150.871, 107.821, 102.214], ['B', ' HD2', 149.0, 110.692, 104.651], ['B', ' HE1', 153.086, 108.719, 102.774], ['B', ' HE2', 151.214, 111.617, 105.231], ['B', ' HZ ', 153.26, 110.658, 104.314]] AA_SCO= 2.4784210526315786 CA_SCO= 1.8484210526315792
[['B', ' N ', 146.274, 106.681, 102.294], ['B', ' CA ', 144.99, 106.38, 101.703], ['B', ' C ', 144.213, 105.305, 102.432], ['B', ' O ', 142.985, 105.325, 102.439], ['B', ' CB ', 145.21, 105.992, 100.232], ['B', ' OG1', 143.986, 106.007, 99.561], ['B', ' CG2', 145.818, 104.601, 100.104], ['B', ' H ', 147.06, 106.662, 101.672], ['B', ' HA ', 144.39, 107.292, 101.723], ['B', ' HB ', 145.889, 106.714, 99.773], ['B', ' HG1', 143.663, 106.912, 99.498], ['B', ' HG2', 145.97, 104.377, 99.049], ['B', ' HG2', 146.77, 104.582, 100.615], ['B', ' HG2', 145.16, 103.851, 100.527]] AA_SCO= 2.5089473684210524 CA_SCO= 1.8428421052631585
[['B', ' N ', 144.879, 104.402, 103.133], ['B', ' CA ', 144.158, 103.373, 103.858], ['B', ' C ', 143.398, 103.937, 105.059], ['B', ' O ', 142.601, 103.223, 105.674], ['B', ' CB ', 145.08, 102.251, 104.279], ['B', ' CG ', 145.603, 101.353, 103.155], ['B', ' CD ', 144.567, 100.416, 102.623], ['B', ' NE ', 144.034, 99.556, 103.681], ['B', ' CZ ', 144.574, 98.386, 104.119], ['B', ' NH1', 145.663, 97.892, 103.575], ['B', ' NH2', 143.987, 97.738, 105.12], ['B', ' H ', 145.892, 104.386, 103.13], ['B', ' HA ', 143.418, 102.954, 103.18], ['B', ' HB ', 145.968, 102.7, 104.704], ['B', ' HB ', 144.617, 101.639, 105.048], ['B', ' HG ', 145.904, 101.987, 102.333], ['B', ' HG ', 146.46, 100.776, 103.508], ['B', ' HD ', 143.741, 100.969, 102.18], ['B', ' HD ', 145.013, 99.789, 101.857], ['B', ' HE ', 143.19, 99.876, 104.142], ['B', ' HH1', 146.115, 98.362, 102.812], ['B', ' HH1', 146.043, 97.012, 103.915], ['B', ' HH2', 143.15, 98.113, 105.543], ['B', ' HH2', 144.392, 96.857, 105.49]] AA_SCO= 2.457894736842105 CA_SCO= 1.8512105263157896
[['B', ' N ', 143.621, 105.218, 105.374], ['B', ' CA ', 142.924, 105.902, 106.447], ['B', ' C ', 141.741, 106.701, 105.893], ['B', ' O ', 141.063, 107.398, 106.65], ['B', ' CB ', 143.852, 106.86, 107.192], ['B', ' CG ', 144.923, 106.244, 108.008], ['B', ' CD1', 146.129, 105.953, 107.448], ['B', ' CD2', 144.72, 106.024, 109.344], ['B', ' CE1', 147.123, 105.437, 108.204], ['B', ' CE2', 145.727, 105.51, 110.111], ['B', ' CZ ', 146.927, 105.214, 109.541], ['B', ' OH ', 147.951, 104.707, 110.307], ['B', ' H ', 144.316, 105.747, 104.843], ['B', ' HA ', 142.541, 105.165, 107.147], ['B', ' HB ', 144.334, 107.504, 106.49], ['B', ' HB ', 143.26, 107.497, 107.843], ['B', ' HD1', 146.305, 106.131, 106.405], ['B', ' HD2', 143.761, 106.267, 109.798], ['B', ' HE1', 148.074, 105.211, 107.75], ['B', ' HE2', 145.574, 105.34, 111.176], ['B', ' HH ', 147.739, 104.8, 111.238]] AA_SCO= 2.519473684210526 CA_SCO= 1.8652631578947372
[['B', ' N ', 141.479, 106.608, 104.583], ['B', ' CA ', 140.344, 107.292, 103.97], ['B', ' C ', 139.046, 106.7, 104.45], ['B', ' O ', 138.876, 105.477, 104.451], ['B', ' CB ', 140.402, 107.197, 102.47], ['B', ' OG ', 139.229, 107.71, 101.902], ['B', ' H ', 142.072, 106.038, 103.978], ['B', ' HA ', 140.354, 108.335, 104.246], ['B', ' HB ', 141.263, 107.769, 102.113], ['B', ' HB ', 140.543, 106.162, 102.157], ['B', ' HG ', 138.707, 106.923, 101.613]] AA_SCO= 2.4368421052631577 CA_SCO= 1.8652631578947363
[['B', ' N ', 138.101, 107.557, 104.842], ['B', ' CA ', 136.812, 107.075, 105.303], ['B', ' C ', 135.642, 107.693, 104.552], ['B', ' O ', 134.501, 107.609, 104.999], ['B', ' CB ', 136.683, 107.298, 106.802], ['B', ' CG ', 137.7, 106.477, 107.654], ['B', ' CD ', 137.457, 104.992, 107.605], ['B', ' NE ', 138.425, 104.24, 108.405], ['B', ' CZ ', 139.615, 103.742, 107.955], ['B', ' NH1', 140.019, 103.908, 106.708], ['B', ' NH2', 140.384, 103.068, 108.796], ['B', ' H ', 138.272, 108.553, 104.836], ['B', ' HA ', 136.76, 106.008, 105.108], ['B', ' HB ', 136.83, 108.354, 107.029], ['B', ' HB ', 135.68, 107.027, 107.128], ['B', ' HG ', 138.707, 106.665, 107.306], ['B', ' HG ', 137.622, 106.789, 108.693], ['B', ' HD ', 136.463, 104.787, 108.002], ['B', ' HD ', 137.512, 104.62, 106.594], ['B', ' HE ', 138.187, 104.071, 109.372], ['B', ' HH1', 139.463, 104.432, 106.013], ['B', ' HH1', 140.926, 103.517, 106.398], ['B', ' HH2', 140.089, 102.93, 109.751], ['B', ' HH2', 141.268, 102.684, 108.485]] AA_SCO= 2.382631578947368 CA_SCO= 1.8676842105263156
[['B', ' N ', 135.922, 108.328, 103.427], ['B', ' CA ', 134.869, 108.928, 102.619], ['B', ' C ', 134.492, 110.294, 103.098], ['B', ' O ', 135.165, 110.887, 103.944], ['B', ' H ', 136.883, 108.367, 103.115], ['B', ' HA ', 135.195, 109.026, 101.591], ['B', ' HA ', 133.991, 108.282, 102.619]] AA_SCO= 2.282631578947368 CA_SCO= 1.7661578947368421
[['B', ' N ', 133.435, 110.833, 102.515], ['B', ' CA ', 133.074, 112.187, 102.837], ['B', ' C ', 134.013, 112.987, 101.987], ['B', ' O ', 134.646, 112.403, 101.113], ['B', ' H ', 132.922, 110.332, 101.784], ['B', ' HA ', 132.037, 112.388, 102.573], ['B', ' HA ', 133.226, 112.389, 103.895]] AA_SCO= 2.3421052631578947 CA_SCO= 1.782052631578947
[['B', ' N ', 134.158, 114.277, 102.28], ['B', ' CA ', 134.954, 115.215, 101.485], ['B', ' C ', 134.137, 115.694, 100.328], ['B', ' O ', 133.819, 114.941, 99.419], ['B', ' CB ', 136.261, 114.596, 100.967], ['B', ' CG ', 137.15, 115.494, 100.156], ['B', ' CD ', 137.702, 116.522, 100.876], ['B', ' OE1', 138.556, 116.282, 101.758], ['B', ' NE2', 137.205, 117.718, 100.571], ['B', ' H ', 133.616, 114.639, 103.048], ['B', ' HA ', 135.2, 116.078, 102.107], ['B', ' HB ', 136.805, 114.207, 101.812], ['B', ' HB ', 136.087, 113.821, 100.274], ['B', ' HG ', 137.976, 114.908, 99.797], ['B', ' HG ', 136.588, 115.912, 99.311], ['B', ' HE2', 137.498, 118.542, 101.103], ['B', ' HE2', 136.489, 117.795, 99.809]] AA_SCO= 2.4031578947368417 CA_SCO= 1.7929473684210524
[['B', ' N ', 133.814, 116.97, 100.348], ['B', ' CA ', 132.958, 117.481, 99.321], ['B', ' C ', 133.62, 117.482, 98.003], ['B', ' O ', 134.85, 117.561, 97.907], ['B', ' CB ', 132.422, 118.855, 99.644], ['B', ' CG ', 131.443, 118.841, 100.757], ['B', ' CD ', 130.242, 117.994, 100.367], ['B', ' OE1', 129.779, 118.056, 99.221], ['B', ' NE2', 129.739, 117.199, 101.305], ['B', ' H ', 134.142, 117.566, 101.095], ['B', ' HA ', 132.109, 116.806, 99.228], ['B', ' HB ', 133.243, 119.516, 99.917], ['B', ' HB ', 131.952, 119.269, 98.767], ['B', ' HG ', 131.9, 118.406, 101.641], ['B', ' HG ', 131.105, 119.859, 100.962], ['B', ' HE2', 128.946, 116.62, 101.103], ['B', ' HE2', 130.144, 117.179, 102.219]] AA_SCO= 2.304736842105263 CA_SCO= 1.7981578947368417
[['B', ' N ', 132.74, 117.41, 97.008], ['B', ' CA ', 133.003, 117.271, 95.596], ['B', ' C ', 133.354, 115.832, 95.333], ['B', ' O ', 134.511, 115.477, 95.218], ['B', ' CB ', 134.09, 118.178, 95.11], ['B', ' H ', 131.768, 117.407, 97.293], ['B', ' HA ', 132.086, 117.511, 95.054], ['B', ' HB ', 134.186, 118.013, 94.051], ['B', ' HB ', 133.806, 119.201, 95.289], ['B', ' HB ', 135.034, 117.97, 95.593]] AA_SCO= 2.364736842105263 CA_SCO= 1.7952105263157891
[['B', ' N ', 132.298, 115.022, 95.23], ['B', ' CA ', 132.3, 113.564, 95.079], ['B', ' C ', 132.738, 112.74, 96.323], ['B', ' O ', 133.576, 111.833, 96.196], ['B', ' CB ', 133.217, 113.178, 93.945], ['B', ' CG ', 132.924, 113.757, 92.631], ['B', ' CD ', 131.772, 113.236, 92.006], ['B', ' OE1', 131.489, 112.036, 92.059], ['B', ' NE2', 131.083, 114.099, 91.339], ['B', ' H ', 131.397, 115.475, 95.291], ['B', ' HA ', 131.295, 113.255, 94.795], ['B', ' HB ', 134.235, 113.362, 94.164], ['B', ' HB ', 133.099, 112.121, 93.818], ['B', ' HG ', 132.797, 114.83, 92.72], ['B', ' HG ', 133.736, 113.557, 91.977], ['B', ' HE2', 130.292, 113.799, 90.779], ['B', ' HE2', 131.38, 115.064, 91.308]] AA_SCO= 2.4778947368421056 CA_SCO= 1.7951578947368418
[['B', ' N ', 132.021, 112.879, 97.466], ['B', ' CA ', 132.22, 112.225, 98.763], ['B', ' C ', 132.013, 110.708, 98.738], ['B', ' O ', 132.298, 109.989, 99.709], ['B', ' CB ', 131.155, 112.892, 99.641], ['B', ' CG ', 130.111, 113.358, 98.697], ['B', ' CD ', 130.863, 113.792, 97.478], ['B', ' HA ', 133.231, 112.472, 99.12], ['B', ' HB ', 130.774, 112.171, 100.374], ['B', ' HB ', 131.611, 113.719, 100.203], ['B', ' HG ', 129.388, 112.551, 98.495], ['B', ' HG ', 129.544, 114.185, 99.153], ['B', ' HD ', 130.21, 113.676, 96.617], ['B', ' HD ', 131.2, 114.828, 97.63]] AA_SCO= 2.463157894736842 CA_SCO= 1.7947894736842105
[['B', ' N ', 131.435, 110.225, 97.646], ['B', ' CA ', 131.139, 108.824, 97.449], ['B', ' C ', 132.361, 107.964, 97.148], ['B', ' O ', 132.266, 106.742, 97.2], ['B', ' CB ', 130.15, 108.677, 96.321], ['B', ' OG ', 130.723, 109.062, 95.105], ['B', ' H ', 131.188, 110.839, 96.886], ['B', ' HA ', 130.681, 108.448, 98.363], ['B', ' HB ', 129.822, 107.637, 96.259], ['B', ' HB ', 129.272, 109.288, 96.524], ['B', ' HG ', 130.053, 108.9, 94.43]] AA_SCO= 2.39421052631579 CA_SCO= 1.7602105263157892
[['B', ' N ', 133.515, 108.566, 96.845], ['B', ' CA ', 134.68, 107.741, 96.499], ['B', ' C ', 135.113, 106.786, 97.615], ['B', ' O ', 135.129, 105.565, 97.432], ['B', ' CB ', 135.853, 108.639, 96.127], ['B', ' CG ', 135.792, 109.166, 94.741], ['B', ' ND1', 135.082, 110.268, 94.391], ['B', ' CD2', 136.365, 108.723, 93.613], ['B', ' CE1', 135.229, 110.478, 93.092], ['B', ' NE2', 136.0, 109.56, 92.611], ['B', ' H ', 133.552, 109.588, 96.811], ['B', ' HA ', 134.436, 107.135, 95.626], ['B', ' HB ', 135.853, 109.494, 96.797], ['B', ' HB ', 136.786, 108.126, 96.284], ['B', ' HD1', 134.522, 110.872, 95.008], ['B', ' HD2', 137.007, 107.904, 93.394], ['B', ' HE1', 134.76, 111.304, 92.582]] AA_SCO= 2.378421052631579 CA_SCO= 1.7459473684210522
[['B', ' N ', 135.452, 107.338, 98.773], ['B', ' CA ', 135.794, 106.593, 99.99], ['B', ' C ', 136.91, 105.55, 99.985], ['B', ' O ', 137.899, 105.69, 100.711], ['B', ' CB ', 134.53, 105.893, 100.52], ['B', ' CG ', 134.731, 105.101, 101.827], ['B', ' CD ', 133.474, 104.483, 102.383], ['B', ' OE1', 132.418, 104.695, 101.841], ['B', ' OE2', 133.582, 103.777, 103.355], ['B', ' H ', 135.431, 108.347, 98.818], ['B', ' HA ', 136.106, 107.32, 100.719], ['B', ' HB ', 133.751, 106.636, 100.689], ['B', ' HB ', 134.149, 105.198, 99.775], ['B', ' HG ', 135.439, 104.297, 101.669], ['B', ' HG ', 135.158, 105.754, 102.566]] AA_SCO= 2.3652631578947365 CA_SCO= 1.6722105263157894
[['B', ' N ', 136.719, 104.474, 99.246], ['B', ' CA ', 137.584, 103.315, 99.378], ['B', ' C ', 138.679, 103.204, 98.354], ['B', ' O ', 138.431, 103.226, 97.15], ['B', ' CB ', 136.762, 102.059, 99.379], ['B', ' OG ', 137.595, 100.941, 99.427], ['B', ' H ', 135.933, 104.481, 98.603], ['B', ' HA ', 138.065, 103.381, 100.355], ['B', ' HB ', 136.094, 102.062, 100.241], ['B', ' HB ', 136.145, 102.024, 98.482], ['B', ' HG ', 137.018, 100.184, 99.566]] AA_SCO= 2.3010526315789472 CA_SCO= 1.674157894736842
[['B', ' N ', 139.897, 103.094, 98.864], ['B', ' CA ', 141.103, 102.967, 98.072], ['B', ' C ', 141.819, 101.666, 98.35], ['B', ' O ', 141.76, 101.142, 99.465], ['B', ' CB ', 142.036, 104.114, 98.361], ['B', ' CG ', 141.589, 105.427, 97.85], ['B', ' CD1', 140.629, 106.195, 98.479], ['B', ' CD2', 142.201, 105.926, 96.751], ['B', ' CE1', 140.3, 107.419, 97.974], ['B', ' CE2', 141.891, 107.143, 96.258], ['B', ' CZ ', 140.936, 107.891, 96.86], ['B', ' H ', 139.985, 103.094, 99.872], ['B', ' HA ', 140.821, 102.987, 97.032], ['B', ' HB ', 142.174, 104.2, 99.439], ['B', ' HB ', 143.014, 103.899, 97.927], ['B', ' HD1', 140.128, 105.83, 99.378], ['B', ' HD2', 142.961, 105.332, 96.268], ['B', ' HE1', 139.535, 108.029, 98.463], ['B', ' HE2', 142.408, 107.511, 95.368], ['B', ' HZ ', 140.68, 108.864, 96.455]] AA_SCO= 2.255263157894737 CA_SCO= 1.6715263157894735
[['B', ' N ', 142.478, 101.133, 97.333], ['B', ' CA ', 143.23, 99.905, 97.479], ['B', ' C ', 144.629, 100.008, 96.85], ['B', ' O ', 144.906, 100.933, 96.079], ['B', ' CB ', 142.445, 98.741, 96.827], ['B', ' CG1', 141.094, 98.579, 97.504], ['B', ' CG2', 142.277, 98.994, 95.35], ['B', ' H ', 142.445, 101.621, 96.435], ['B', ' HA ', 143.298, 99.707, 98.54], ['B', ' HB ', 142.984, 97.817, 96.966], ['B', ' HG1', 140.564, 97.742, 97.054], ['B', ' HG1', 141.242, 98.385, 98.566], ['B', ' HG1', 140.499, 99.479, 97.382], ['B', ' HG2', 141.736, 98.166, 94.9], ['B', ' HG2', 141.717, 99.921, 95.194], ['B', ' HG2', 143.254, 99.07, 94.881]] AA_SCO= 2.212105263157895 CA_SCO= 1.6539473684210526
[['B', ' N ', 145.548, 99.109, 97.203], ['B', ' CA ', 146.806, 98.888, 96.54], ['B', ' C ', 146.502, 98.415, 95.139], ['B', ' O ', 145.496, 97.753, 94.913], ['B', ' CB ', 147.429, 97.753, 97.344], ['B', ' CG ', 146.774, 97.824, 98.681], ['B', ' CD ', 145.386, 98.324, 98.427], ['B', ' HA ', 147.414, 99.804, 96.539], ['B', ' HB ', 147.248, 96.788, 96.84], ['B', ' HB ', 148.494, 97.895, 97.375], ['B', ' HG ', 146.749, 96.816, 99.135], ['B', ' HG ', 147.33, 98.444, 99.354], ['B', ' HD ', 144.714, 97.483, 98.285], ['B', ' HD ', 145.109, 98.944, 99.285]] AA_SCO= 2.1426315789473684 CA_SCO= 1.6605263157894736
[['B', ' N ', 147.389, 98.665, 94.209], ['B', ' CA ', 147.176, 98.217, 92.856], ['B', ' C ', 147.143, 96.723, 92.842], ['B', ' O ', 146.309, 96.131, 92.162], ['B', ' CB ', 148.209, 98.806, 91.909], ['B', ' CG1', 147.899, 100.277, 91.831], ['B', ' CG2', 148.133, 98.123, 90.545], ['B', ' CD1', 148.859, 101.101, 91.209], ['B', ' H ', 148.259, 99.143, 94.44], ['B', ' HA ', 146.202, 98.565, 92.524], ['B', ' HB ', 149.213, 98.693, 92.329], ['B', ' HG1', 147.004, 100.382, 91.263], ['B', ' HG1', 147.737, 100.656, 92.837], ['B', ' HG2', 148.847, 98.547, 89.857], ['B', ' HG2', 148.351, 97.087, 90.661], ['B', ' HG2', 147.133, 98.236, 90.14], ['B', ' HD1', 148.499, 102.126, 91.192], ['B', ' HD1', 149.787, 101.055, 91.742], ['B', ' HD1', 148.978, 100.756, 90.219]] AA_SCO= 1.9636842105263164 CA_SCO= 1.6610526315789473
[['B', ' N ', 148.002, 96.133, 93.645], ['B', ' CA ', 148.163, 94.701, 93.783], ['B', ' C ', 146.863, 93.979, 94.191], ['B', ' O ', 146.776, 92.762, 94.037], ['B', ' CB ', 149.257, 94.425, 94.799], ['B', ' H ', 148.632, 96.742, 94.153], ['B', ' HA ', 148.476, 94.306, 92.825], ['B', ' HB ', 149.422, 93.348, 94.883], ['B', ' HB ', 150.181, 94.907, 94.479], ['B', ' HB ', 148.956, 94.821, 95.764]] AA_SCO= 1.935789473684211 CA_SCO= 1.6770000000000003
[['B', ' N ', 145.868, 94.669, 94.76], ['B', ' CA ', 144.639, 93.963, 95.124], ['B', ' C ', 143.67, 93.863, 93.947], ['B', ' O ', 142.637, 93.197, 94.036], ['B', ' CB ', 143.907, 94.624, 96.287], ['B', ' CG ', 144.575, 94.489, 97.654], ['B', ' OD1', 145.393, 93.617, 97.858], ['B', ' OD2', 144.181, 95.222, 98.524], ['B', ' H ', 145.92, 95.683, 94.882], ['B', ' HA ', 144.905, 92.95, 95.427], ['B', ' HB ', 143.814, 95.692, 96.065], ['B', ' HB ', 142.898, 94.224, 96.354]] AA_SCO= 1.8910526315789478 CA_SCO= 1.6820526315789472
[['B', ' N ', 143.967, 94.576, 92.869], ['B', ' CA ', 143.13, 94.606, 91.672], ['B', ' C ', 143.832, 93.914, 90.517], ['B', ' O ', 143.231, 93.195, 89.717], ['B', ' CB ', 142.868, 96.065, 91.261], ['B', ' CG ', 142.01, 96.31, 89.976], ['B', ' CD1', 140.587, 95.824, 90.182], ['B', ' CD2', 142.063, 97.778, 89.625], ['B', ' H ', 144.849, 95.087, 92.855], ['B', ' HA ', 142.199, 94.089, 91.886], ['B', ' HB ', 142.36, 96.557, 92.088], ['B', ' HB ', 143.83, 96.561, 91.127], ['B', ' HG ', 142.427, 95.742, 89.145], ['B', ' HD1', 140.014, 95.998, 89.274], ['B', ' HD1', 140.584, 94.759, 90.405], ['B', ' HD1', 140.132, 96.369, 91.009], ['B', ' HD2', 141.485, 97.967, 88.714], ['B', ' HD2', 141.655, 98.354, 90.442], ['B', ' HD2', 143.093, 98.057, 89.463]] AA_SCO= 1.971578947368421 CA_SCO= 1.6490000000000002
[['B', ' N ', 145.113, 94.203, 90.431], ['B', ' CA ', 146.015, 93.803, 89.386], ['B', ' C ', 147.06, 92.867, 89.908], ['B', ' O ', 147.612, 93.098, 90.971], ['B', ' CB ', 146.714, 95.046, 88.823], ['B', ' CG1', 145.679, 96.06, 88.299], ['B', ' CG2', 147.752, 94.711, 87.812], ['B', ' CD1', 144.751, 95.601, 87.166], ['B', ' H ', 145.511, 94.794, 91.158], ['B', ' HA ', 145.46, 93.286, 88.608], ['B', ' HB ', 147.199, 95.534, 89.637], ['B', ' HG1', 145.068, 96.369, 89.129], ['B', ' HG1', 146.233, 96.917, 87.951], ['B', ' HG2', 148.232, 95.624, 87.465], ['B', ' HG2', 148.512, 94.069, 88.232], ['B', ' HG2', 147.278, 94.212, 87.011], ['B', ' HD1', 144.081, 96.414, 86.899], ['B', ' HD1', 145.328, 95.321, 86.292], ['B', ' HD1', 144.153, 94.755, 87.489]] AA_SCO= 2.03421052631579 CA_SCO= 1.5967894736842105
[['B', ' N ', 147.371, 91.835, 89.155], ['B', ' CA ', 148.443, 90.965, 89.582], ['B', ' C ', 149.754, 91.685, 89.251], ['B', ' O ', 150.103, 91.854, 88.077], ['B', ' CB ', 148.348, 89.619, 88.853], ['B', ' CG ', 149.372, 88.591, 89.308], ['B', ' OD1', 150.261, 88.954, 90.029], ['B', ' OD2', 149.244, 87.446, 88.934], ['B', ' H ', 146.868, 91.659, 88.299], ['B', ' HA ', 148.384, 90.809, 90.659], ['B', ' HB ', 147.354, 89.199, 88.999], ['B', ' HB ', 148.48, 89.779, 87.782]] AA_SCO= 2.0884210526315794 CA_SCO= 1.690157894736842
[['B', ' N ', 150.408, 92.199, 90.293], ['B', ' CA ', 151.621, 93.004, 90.2], ['B', ' C ', 152.816, 92.171, 90.62], ['B', ' O ', 152.829, 91.629, 91.725], ['B', ' CB ', 151.494, 94.237, 91.125], ['B', ' CG1', 152.73, 95.061, 91.107], ['B', ' CG2', 150.355, 95.093, 90.677], ['B', ' H ', 150.023, 91.994, 91.207], ['B', ' HA ', 151.759, 93.33, 89.168], ['B', ' HB ', 151.33, 93.897, 92.146], ['B', ' HG1', 152.616, 95.914, 91.772], ['B', ' HG1', 153.57, 94.467, 91.439], ['B', ' HG1', 152.913, 95.414, 90.106], ['B', ' HG2', 150.274, 95.949, 91.343], ['B', ' HG2', 150.531, 95.434, 89.663], ['B', ' HG2', 149.449, 94.539, 90.701]] AA_SCO= 2.0778947368421057 CA_SCO= 1.6332105263157897
[['B', ' N ', 153.793, 92.015, 89.729], ['B', ' CA ', 154.948, 91.2, 90.036], ['B', ' C ', 156.055, 91.882, 90.854], ['B', ' O ', 156.754, 91.216, 91.635], ['B', ' CB ', 155.469, 90.639, 88.721], ['B', ' CG ', 155.707, 91.739, 87.681], ['B', ' OD1', 154.734, 92.41, 87.27], ['B', ' OD2', 156.809, 91.894, 87.273], ['B', ' H ', 153.745, 92.452, 88.803], ['B', ' HA ', 154.594, 90.352, 90.625], ['B', ' HB ', 156.409, 90.11, 88.898], ['B', ' HB ', 154.75, 89.918, 88.324]] AA_SCO= 2.0742105263157895 CA_SCO= 1.6239473684210526
[['B', ' N ', 156.176, 93.2, 90.733], ['B', ' CA ', 157.225, 93.946, 91.409], ['B', ' C ', 156.684, 95.04, 92.301], ['B', ' O ', 155.636, 95.617, 92.01], ['B', ' CB ', 158.092, 94.63, 90.359], ['B', ' CG ', 158.849, 93.792, 89.354], ['B', ' CD1', 159.414, 94.719, 88.292], ['B', ' CD2', 159.962, 93.046, 90.035], ['B', ' H ', 155.562, 93.721, 90.096], ['B', ' HA ', 157.807, 93.27, 92.025], ['B', ' HB ', 157.44, 95.222, 89.765], ['B', ' HB ', 158.767, 95.274, 90.856], ['B', ' HG ', 158.175, 93.086, 88.872], ['B', ' HD1', 159.959, 94.136, 87.553], ['B', ' HD1', 158.596, 95.245, 87.8], ['B', ' HD1', 160.081, 95.437, 88.756], ['B', ' HD2', 160.507, 92.456, 89.3], ['B', ' HD2', 160.644, 93.742, 90.515], ['B', ' HD2', 159.544, 92.399, 90.758]] AA_SCO= 2.128421052631579 CA_SCO= 1.6053157894736843
[['B', ' N ', 157.383, 95.346, 93.385], ['B', ' CA ', 156.971, 96.521, 94.126], ['B', ' C ', 158.121, 97.234, 94.739], ['B', ' O ', 158.928, 96.667, 95.464], ['B', ' CB ', 156.01, 96.175, 95.223], ['B', ' H ', 158.19, 94.785, 93.684], ['B', ' HA ', 156.511, 97.207, 93.424], ['B', ' HB ', 155.715, 97.082, 95.747], ['B', ' HB ', 155.148, 95.711, 94.786], ['B', ' HB ', 156.487, 95.513, 95.913]] AA_SCO= 2.0878947368421055 CA_SCO= 1.6082631578947368
[['B', ' N ', 158.093, 98.525, 94.565], ['B', ' CA ', 159.078, 99.417, 95.09], ['B', ' C ', 158.447, 100.322, 96.127], ['B', ' O ', 157.908, 101.359, 95.762], ['B', ' CB ', 159.666, 100.222, 93.921], ['B', ' CG ', 160.917, 101.109, 94.165], ['B', ' CD1', 161.682, 101.203, 92.892], ['B', ' CD2', 160.491, 102.522, 94.572], ['B', ' H ', 157.371, 98.922, 93.958], ['B', ' HA ', 159.878, 98.833, 95.505], ['B', ' HB ', 159.922, 99.516, 93.137], ['B', ' HB ', 158.881, 100.868, 93.533], ['B', ' HG ', 161.559, 100.673, 94.923], ['B', ' HD1', 162.568, 101.817, 93.035], ['B', ' HD1', 161.976, 100.203, 92.609], ['B', ' HD1', 161.057, 101.638, 92.119], ['B', ' HD2', 161.354, 103.14, 94.696], ['B', ' HD2', 159.853, 102.955, 93.798], ['B', ' HD2', 159.955, 102.502, 95.499]] AA_SCO= 2.0847368421052637 CA_SCO= 1.6077894736842104
[['B', ' N ', 158.415, 99.939, 97.403], ['B', ' CA ', 157.834, 100.703, 98.462], ['B', ' C ', 158.704, 101.904, 98.727], ['B', ' O ', 159.876, 101.947, 98.342], ['B', ' CB ', 157.796, 99.719, 99.626], ['B', ' CG ', 158.91, 98.764, 99.343], ['B', ' CD ', 158.914, 98.622, 97.844], ['B', ' HA ', 156.819, 101.011, 98.179], ['B', ' HB ', 157.906, 100.258, 100.576], ['B', ' HB ', 156.81, 99.231, 99.655], ['B', ' HG ', 159.865, 99.157, 99.721], ['B', ' HG ', 158.739, 97.804, 99.858], ['B', ' HD ', 159.916, 98.417, 97.543], ['B', ' HD ', 158.224, 97.825, 97.547]] AA_SCO= 2.0968421052631583 CA_SCO= 1.607315789473684
[['B', ' N ', 158.131, 102.853, 99.418], ['B', ' CA ', 158.788, 104.072, 99.835], ['B', ' C ', 157.696, 105.054, 100.133], ['B', ' O ', 156.656, 105.005, 99.458], ['B', ' H ', 157.165, 102.72, 99.701], ['B', ' HA ', 159.443, 103.917, 100.673], ['B', ' HA ', 159.387, 104.43, 99.023]] AA_SCO= 2.1294736842105264 CA_SCO= 1.641842105263158
[['B', ' N ', 157.895, 105.965, 101.123], ['B', ' CA ', 156.855, 106.929, 101.472], ['B', ' C ', 156.916, 107.963, 100.343], ['B', ' O ', 155.937, 108.164, 99.632], ['B', ' CB ', 157.04, 107.446, 102.914], ['B', ' SG ', 156.953, 106.125, 104.242], ['B', ' H ', 158.768, 105.993, 101.646], ['B', ' HA ', 155.875, 106.436, 101.437], ['B', ' HB ', 157.982, 107.909, 103.05], ['B', ' HB ', 156.28, 108.195, 103.143]] AA_SCO= 2.1194736842105266 CA_SCO= 1.6559473684210526
[['B', ' N ', 158.003, 108.748, 100.181], ['B', ' CA ', 158.48, 109.181, 98.904], ['B', ' C ', 159.605, 108.187, 98.588], ['B', ' O ', 160.596, 108.209, 99.319], ['B', ' CB ', 159.01, 110.563, 99.146], ['B', ' CG ', 159.488, 110.536, 100.57], ['B', ' CD ', 158.661, 109.469, 101.275], ['B', ' HA ', 157.655, 109.181, 98.181], ['B', ' HB ', 159.811, 110.741, 98.434], ['B', ' HB ', 158.238, 111.292, 98.933], ['B', ' HG ', 160.565, 110.32, 100.605], ['B', ' HG ', 159.356, 111.522, 101.038], ['B', ' HD ', 159.392, 108.845, 101.768], ['B', ' HD ', 157.947, 109.945, 101.964]] AA_SCO= 2.0457894736842106 CA_SCO= 1.7300526315789475
[['B', ' N ', 159.524, 107.269, 97.639], ['B', ' CA ', 160.602, 106.347, 97.37], ['B', ' C ', 161.804, 107.171, 97.0], ['B', ' O ', 161.671, 108.206, 96.349], ['B', ' CB ', 160.051, 105.497, 96.24], ['B', ' CG ', 158.932, 106.322, 95.654], ['B', ' CD ', 158.38, 107.133, 96.812], ['B', ' HA ', 160.831, 105.765, 98.264], ['B', ' HB ', 160.851, 105.299, 95.514], ['B', ' HB ', 159.706, 104.528, 96.625], ['B', ' HG ', 159.305, 106.974, 94.853], ['B', ' HG ', 158.163, 105.674, 95.188], ['B', ' HD ', 158.064, 108.093, 96.42], ['B', ' HD ', 157.564, 106.608, 97.341]] AA_SCO= 2.0878947368421055 CA_SCO= 1.7323157894736843
[['B', ' N ', 162.967, 106.74, 97.463], ['B', ' CA ', 164.19, 107.475, 97.242], ['B', ' C ', 164.595, 107.431, 95.793], ['B', ' O ', 164.402, 106.409, 95.136], ['B', ' CB ', 165.289, 106.827, 98.069], ['B', ' OG ', 165.575, 105.542, 97.583], ['B', ' H ', 163.008, 105.879, 97.974], ['B', ' HA ', 164.015, 108.5, 97.565], ['B', ' HB ', 166.193, 107.427, 98.064], ['B', ' HB ', 164.956, 106.749, 99.099], ['B', ' HG ', 166.039, 105.066, 98.314]] AA_SCO= 1.9963157894736845 CA_SCO= 1.735315789473684
[['B', ' N ', 165.264, 108.464, 95.275], ['B', ' CA ', 165.749, 108.479, 93.927], ['B', ' C ', 166.79, 107.417, 93.681], ['B', ' O ', 166.87, 106.868, 92.588], ['B', ' CB ', 166.361, 109.872, 93.829], ['B', ' CG ', 166.632, 110.294, 95.247], ['B', ' CD ', 165.548, 109.675, 96.051], ['B', ' HA ', 164.906, 108.38, 93.229], ['B', ' HB ', 167.285, 109.834, 93.255], ['B', ' HB ', 165.693, 110.533, 93.286], ['B', ' HG ', 167.63, 109.966, 95.55], ['B', ' HG ', 166.627, 111.394, 95.309], ['B', ' HD ', 165.948, 109.473, 97.048], ['B', ' HD ', 164.662, 110.335, 96.072]] AA_SCO= 2.026315789473684 CA_SCO= 1.7547894736842107
[['B', ' N ', 167.505, 107.014, 94.725], ['B', ' CA ', 168.525, 106.017, 94.531], ['B', ' C ', 167.933, 104.653, 94.312], ['B', ' O ', 168.421, 103.909, 93.464], ['B', ' CB ', 169.491, 106.025, 95.701], ['B', ' CG ', 170.333, 107.302, 95.748], ['B', ' CD ', 171.273, 107.376, 96.902], ['B', ' OE1', 171.244, 106.496, 97.722], ['B', ' OE2', 172.034, 108.318, 96.957], ['B', ' H ', 167.431, 107.456, 95.629], ['B', ' HA ', 169.089, 106.282, 93.637], ['B', ' HB ', 168.934, 105.944, 96.639], ['B', ' HB ', 170.16, 105.167, 95.636], ['B', ' HG ', 170.908, 107.372, 94.825], ['B', ' HG ', 169.663, 108.161, 95.785]] AA_SCO= 2.08578947368421 CA_SCO= 1.765473684210526
[['B', ' N ', 166.862, 104.309, 95.026], ['B', ' CA ', 166.315, 102.99, 94.788], ['B', ' C ', 165.659, 103.006, 93.438], ['B', ' O ', 165.656, 101.999, 92.742], ['B', ' CB ', 165.33, 102.495, 95.87], ['B', ' CG1', 165.066, 100.99, 95.732], ['B', ' CG2', 164.006, 103.185, 95.814], ['B', ' CD1', 166.21, 100.065, 96.014], ['B', ' H ', 166.466, 104.937, 95.729], ['B', ' HA ', 167.143, 102.297, 94.746], ['B', ' HB ', 165.77, 102.671, 96.844], ['B', ' HG1', 164.3, 100.759, 96.4], ['B', ' HG1', 164.712, 100.785, 94.725], ['B', ' HG2', 163.364, 102.802, 96.6], ['B', ' HG2', 164.133, 104.23, 95.948], ['B', ' HG2', 163.541, 102.995, 94.871], ['B', ' HD1', 165.874, 99.034, 95.908], ['B', ' HD1', 167.036, 100.228, 95.335], ['B', ' HD1', 166.523, 100.233, 97.024]] AA_SCO= 2.2352631578947366 CA_SCO= 1.731052631578947
[['B', ' N ', 165.08, 104.141, 93.061], ['B', ' CA ', 164.434, 104.188, 91.781], ['B', ' C ', 165.465, 104.023, 90.695], ['B', ' O ', 165.263, 103.236, 89.778], ['B', ' CB ', 163.717, 105.523, 91.598], ['B', ' CG1', 162.533, 105.589, 92.59], ['B', ' CG2', 163.275, 105.667, 90.136], ['B', ' CD1', 161.906, 106.981, 92.751], ['B', ' H ', 165.07, 104.949, 93.691], ['B', ' HA ', 163.72, 103.377, 91.707], ['B', ' HB ', 164.387, 106.34, 91.851], ['B', ' HG1', 161.779, 104.894, 92.275], ['B', ' HG1', 162.885, 105.273, 93.566], ['B', ' HG2', 162.771, 106.6, 90.019], ['B', ' HG2', 164.128, 105.649, 89.461], ['B', ' HG2', 162.606, 104.852, 89.872], ['B', ' HD1', 161.107, 106.925, 93.471], ['B', ' HD1', 162.655, 107.681, 93.115], ['B', ' HD1', 161.507, 107.341, 91.819]] AA_SCO= 2.28 CA_SCO= 1.6427894736842106
[['B', ' N ', 166.576, 104.748, 90.759], ['B', ' CA ', 167.555, 104.595, 89.71], ['B', ' C ', 168.097, 103.18, 89.684], ['B', ' O ', 168.246, 102.59, 88.616], ['B', ' CB ', 168.695, 105.561, 89.902], ['B', ' H ', 166.726, 105.415, 91.518], ['B', ' HA ', 167.072, 104.805, 88.76], ['B', ' HB ', 169.414, 105.445, 89.096], ['B', ' HB ', 168.315, 106.563, 89.907], ['B', ' HB ', 169.179, 105.356, 90.859]] AA_SCO= 2.2394736842105263 CA_SCO= 1.5988947368421051
[['B', ' N ', 168.329, 102.584, 90.85], ['B', ' CA ', 168.88, 101.252, 90.855], ['B', ' C ', 167.958, 100.227, 90.259], ['B', ' O ', 168.427, 99.369, 89.511], ['B', ' CB ', 169.249, 100.824, 92.264], ['B', ' CG ', 170.472, 101.498, 92.84], ['B', ' CD ', 170.685, 101.049, 94.278], ['B', ' CE ', 171.901, 101.676, 94.918], ['B', ' NZ ', 173.164, 101.109, 94.374], ['B', ' H ', 168.188, 103.076, 91.736], ['B', ' HA ', 169.787, 101.263, 90.253], ['B', ' HB ', 168.408, 101.032, 92.929], ['B', ' HB ', 169.417, 99.75, 92.285], ['B', ' HG ', 171.334, 101.224, 92.24], ['B', ' HG ', 170.358, 102.575, 92.801], ['B', ' HD ', 169.804, 101.308, 94.869], ['B', ' HD ', 170.807, 99.967, 94.304], ['B', ' HE ', 171.886, 102.753, 94.746], ['B', ' HE ', 171.863, 101.489, 95.994], ['B', ' HZ ', 173.957, 101.532, 94.83], ['B', ' HZ ', 173.159, 100.111, 94.554], ['B', ' HZ ', 173.224, 101.271, 93.384]] AA_SCO= 2.2010526315789476 CA_SCO= 1.6356842105263156
[['B', ' N ', 166.657, 100.312, 90.52], ['B', ' CA ', 165.79, 99.294, 89.984], ['B', ' C ', 165.385, 99.553, 88.551], ['B', ' O ', 165.181, 98.597, 87.801], ['B', ' CB ', 164.532, 99.18, 90.819], ['B', ' OG1', 163.851, 100.423, 90.771], ['B', ' CG2', 164.923, 98.849, 92.253], ['B', ' H ', 166.28, 101.022, 91.16], ['B', ' HA ', 166.319, 98.348, 90.029], ['B', ' HB ', 163.883, 98.41, 90.42], ['B', ' HG1', 162.961, 100.313, 91.097], ['B', ' HG2', 164.056, 98.798, 92.871], ['B', ' HG2', 165.43, 97.896, 92.264], ['B', ' HG2', 165.579, 99.602, 92.651]] AA_SCO= 1.9910526315789476 CA_SCO= 1.6351052631578944
[['B', ' N ', 165.323, 100.805, 88.096], ['B', ' CA ', 164.938, 100.944, 86.7], ['B', ' C ', 166.135, 100.562, 85.853], ['B', ' O ', 165.969, 99.956, 84.795], ['B', ' CB ', 164.371, 102.338, 86.327], ['B', ' CG1', 163.138, 102.635, 87.211], ['B', ' CG2', 165.42, 103.417, 86.444], ['B', ' H ', 165.454, 101.607, 88.725], ['B', ' HA ', 164.14, 100.232, 86.493], ['B', ' HB ', 164.018, 102.308, 85.297], ['B', ' HG1', 162.702, 103.595, 86.933], ['B', ' HG1', 162.398, 101.848, 87.069], ['B', ' HG1', 163.43, 102.663, 88.257], ['B', ' HG2', 164.981, 104.369, 86.168], ['B', ' HG2', 165.773, 103.465, 87.447], ['B', ' HG2', 166.244, 103.21, 85.784]] AA_SCO= 2.0210526315789474 CA_SCO= 1.625052631578947
[['B', ' N ', 167.34, 100.883, 86.325], ['B', ' CA ', 168.533, 100.513, 85.616], ['B', ' C ', 168.737, 99.01, 85.709], ['B', ' O ', 169.059, 98.375, 84.709], ['B', ' CB ', 169.743, 101.278, 86.127], ['B', ' CG1', 171.013, 100.752, 85.459], ['B', ' CG2', 169.526, 102.753, 85.808], ['B', ' H ', 167.433, 101.417, 87.194], ['B', ' HA ', 168.402, 100.783, 84.571], ['B', ' HB ', 169.844, 101.139, 87.207], ['B', ' HG1', 171.871, 101.315, 85.825], ['B', ' HG1', 171.155, 99.699, 85.694], ['B', ' HG1', 170.93, 100.873, 84.378], ['B', ' HG2', 170.374, 103.337, 86.16], ['B', ' HG2', 169.42, 102.857, 84.746], ['B', ' HG2', 168.625, 103.113, 86.288]] AA_SCO= 2.0221052631578944 CA_SCO= 1.6265263157894736
[['B', ' N ', 168.543, 98.404, 86.882], ['B', ' CA ', 168.69, 96.971, 86.948], ['B', ' C ', 167.712, 96.321, 85.977], ['B', ' O ', 168.062, 95.348, 85.315], ['B', ' CB ', 168.458, 96.48, 88.362], ['B', ' H ', 168.329, 98.917, 87.737], ['B', ' HA ', 169.702, 96.711, 86.641], ['B', ' HB ', 168.57, 95.403, 88.41], ['B', ' HB ', 169.174, 96.948, 89.035], ['B', ' HB ', 167.466, 96.747, 88.659]] AA_SCO= 2.0052631578947366 CA_SCO= 1.617736842105263
[['B', ' N ', 166.493, 96.846, 85.83], ['B', ' CA ', 165.609, 96.252, 84.84], ['B', ' C ', 166.127, 96.496, 83.431], ['B', ' O ', 166.142, 95.578, 82.617], ['B', ' CB ', 164.172, 96.766, 85.018], ['B', ' CG ', 163.416, 96.207, 86.256], ['B', ' CD1', 162.177, 96.966, 86.513], ['B', ' CD2', 163.003, 94.754, 85.961], ['B', ' H ', 166.164, 97.613, 86.423], ['B', ' HA ', 165.612, 95.18, 84.996], ['B', ' HB ', 164.217, 97.851, 85.126], ['B', ' HB ', 163.597, 96.531, 84.125], ['B', ' HG ', 164.047, 96.278, 87.133], ['B', ' HD1', 161.67, 96.549, 87.375], ['B', ' HD1', 162.421, 98.012, 86.71], ['B', ' HD1', 161.545, 96.883, 85.654], ['B', ' HD2', 162.451, 94.349, 86.808], ['B', ' HD2', 162.386, 94.75, 85.092], ['B', ' HD2', 163.86, 94.129, 85.769]] AA_SCO= 1.8915789473684206 CA_SCO= 1.6332631578947368
[['B', ' N ', 166.671, 97.681, 83.165], ['B', ' CA ', 167.195, 98.032, 81.848], ['B', ' C ', 168.295, 97.063, 81.433], ['B', ' O ', 168.376, 96.648, 80.275], ['B', ' CB ', 167.775, 99.459, 81.911], ['B', ' CG ', 168.329, 100.12, 80.639], ['B', ' CD1', 167.23, 100.275, 79.596], ['B', ' CD2', 168.913, 101.487, 81.034], ['B', ' H ', 166.623, 98.415, 83.874], ['B', ' HA ', 166.381, 97.976, 81.132], ['B', ' HB ', 167.015, 100.117, 82.329], ['B', ' HB ', 168.603, 99.438, 82.597], ['B', ' HG ', 169.119, 99.495, 80.209], ['B', ' HD1', 167.64, 100.757, 78.705], ['B', ' HD1', 166.835, 99.301, 79.321], ['B', ' HD1', 166.429, 100.893, 79.997], ['B', ' HD2', 169.322, 101.981, 80.148], ['B', ' HD2', 168.127, 102.102, 81.461], ['B', ' HD2', 169.704, 101.345, 81.772]] AA_SCO= 1.6631578947368422 CA_SCO= 1.6331052631578948
[['B', ' N ', 169.123, 96.684, 82.399], ['B', ' CA ', 170.239, 95.78, 82.184], ['B', ' C ', 169.959, 94.32, 82.564], ['B', ' O ', 170.888, 93.512, 82.616], ['B', ' CB ', 171.43, 96.284, 82.956], ['B', ' CG ', 171.937, 97.573, 82.414], ['B', ' OD1', 171.912, 97.828, 81.203], ['B', ' ND2', 172.417, 98.407, 83.291], ['B', ' H ', 168.994, 97.122, 83.316], ['B', ' HA ', 170.479, 95.791, 81.122], ['B', ' HB ', 171.141, 96.432, 84.001], ['B', ' HB ', 172.229, 95.547, 82.933], ['B', ' HD2', 172.78, 99.291, 82.995], ['B', ' HD2', 172.425, 98.161, 84.261]] AA_SCO= 1.698947368421053 CA_SCO= 1.6246842105263157
[['B', ' N ', 168.7, 93.99, 82.854], ['B', ' CA ', 168.247, 92.657, 83.254], ['B', ' C ', 168.953, 92.071, 84.488], ['B', ' O ', 169.136, 90.849, 84.601], ['B', ' CB ', 168.385, 91.705, 82.084], ['B', ' CG ', 167.53, 92.113, 80.93], ['B', ' OD1', 166.338, 92.408, 81.09], ['B', ' ND2', 168.114, 92.147, 79.759], ['B', ' H ', 167.97, 94.704, 82.772], ['B', ' HA ', 167.189, 92.74, 83.512], ['B', ' HB ', 169.421, 91.645, 81.758], ['B', ' HB ', 168.084, 90.707, 82.396], ['B', ' HD2', 167.594, 92.42, 78.95], ['B', ' HD2', 169.081, 91.908, 79.676]] AA_SCO= 1.565263157894737 CA_SCO= 1.6254736842105262
[['B', ' N ', 169.287, 92.899, 85.467], ['B', ' CA ', 169.946, 92.377, 86.65], ['B', ' C ', 168.936, 91.899, 87.659], ['B', ' O ', 168.53, 92.621, 88.58], ['B', ' CB ', 170.887, 93.406, 87.277], ['B', ' CG ', 171.663, 92.843, 88.488], ['B', ' OD1', 171.228, 91.838, 89.051], ['B', ' OD2', 172.684, 93.389, 88.825], ['B', ' H ', 169.08, 93.889, 85.38], ['B', ' HA ', 170.551, 91.523, 86.352], ['B', ' HB ', 171.603, 93.755, 86.521], ['B', ' HB ', 170.323, 94.26, 87.596]] AA_SCO= 1.4878947368421054 CA_SCO= 1.2409473684210524
[['B', ' N ', 168.522, 90.657, 87.494], ['B', ' CA ', 167.486, 90.183, 88.367], ['B', ' C ', 167.999, 89.586, 89.653], ['B', ' O ', 167.209, 89.194, 90.507], ['B', ' CB ', 166.494, 89.307, 87.646], ['B', ' CG ', 165.724, 90.117, 86.591], ['B', ' SD ', 164.454, 89.21, 85.738], ['B', ' CE ', 163.159, 89.251, 87.005], ['B', ' H ', 168.893, 90.108, 86.712], ['B', ' HA ', 166.92, 91.046, 88.655], ['B', ' HB ', 167.016, 88.486, 87.151], ['B', ' HB ', 165.799, 88.88, 88.362], ['B', ' HG ', 165.251, 90.958, 87.082], ['B', ' HG ', 166.424, 90.511, 85.851], ['B', ' HE ', 162.272, 88.733, 86.638], ['B', ' HE ', 163.507, 88.762, 87.913], ['B', ' HE ', 162.901, 90.289, 87.23]] AA_SCO= 1.4947368421052634 CA_SCO= 1.2113157894736843
[['B', ' N ', 169.312, 89.539, 89.839], ['B', ' CA ', 169.788, 89.046, 91.116], ['B', ' C ', 169.505, 90.169, 92.094], ['B', ' O ', 169.027, 89.947, 93.208], ['B', ' CB ', 171.289, 88.773, 91.099], ['B', ' CG ', 171.733, 87.576, 90.255], ['B', ' OD1', 170.929, 86.742, 89.907], ['B', ' OD2', 172.913, 87.519, 89.963], ['B', ' H ', 169.957, 89.867, 89.123], ['B', ' HA ', 169.236, 88.154, 91.407], ['B', ' HB ', 171.794, 89.662, 90.712], ['B', ' HB ', 171.636, 88.636, 92.125]] AA_SCO= 1.578421052631579 CA_SCO= 1.1981052631578948
[['B', ' N ', 169.73, 91.398, 91.62], ['B', ' CA ', 169.458, 92.592, 92.393], ['B', ' C ', 167.973, 92.769, 92.636], ['B', ' O ', 167.554, 93.085, 93.745], ['B', ' CB ', 169.983, 93.845, 91.713], ['B', ' CG ', 169.687, 95.066, 92.539], ['B', ' CD1', 170.448, 95.323, 93.657], ['B', ' CD2', 168.646, 95.914, 92.202], ['B', ' CE1', 170.176, 96.401, 94.438], ['B', ' CE2', 168.379, 96.998, 92.993], ['B', ' CZ ', 169.135, 97.239, 94.108], ['B', ' OH ', 168.847, 98.314, 94.91], ['B', ' H ', 170.175, 91.494, 90.693], ['B', ' HA ', 169.95, 92.49, 93.36], ['B', ' HB ', 171.063, 93.769, 91.565], ['B', ' HB ', 169.518, 93.959, 90.731], ['B', ' HD1', 171.268, 94.659, 93.928], ['B', ' HD2', 168.038, 95.718, 91.319], ['B', ' HE1', 170.777, 96.592, 95.324], ['B', ' HE2', 167.569, 97.668, 92.747], ['B', ' HH ', 169.51, 98.38, 95.627]] AA_SCO= 1.618421052631579 CA_SCO= 1.1846842105263158
[['B', ' N ', 167.176, 92.597, 91.586], ['B', ' CA ', 165.738, 92.809, 91.646], ['B', ' C ', 164.916, 91.698, 92.283], ['B', ' O ', 163.86, 91.99, 92.836], ['B', ' CB ', 165.236, 92.974, 90.238], ['B', ' CG ', 165.75, 94.168, 89.506], ['B', ' CD1', 165.485, 93.964, 88.1], ['B', ' CD2', 165.024, 95.426, 89.97], ['B', ' H ', 167.604, 92.368, 90.683], ['B', ' HA ', 165.567, 93.715, 92.219], ['B', ' HB ', 165.445, 92.096, 89.689], ['B', ' HB ', 164.151, 93.071, 90.285], ['B', ' HG ', 166.82, 94.275, 89.656], ['B', ' HD1', 165.834, 94.807, 87.546], ['B', ' HD1', 165.995, 93.079, 87.748], ['B', ' HD1', 164.436, 93.843, 87.988], ['B', ' HD2', 165.378, 96.274, 89.403], ['B', ' HD2', 163.957, 95.312, 89.797], ['B', ' HD2', 165.201, 95.605, 91.026]] AA_SCO= 1.6721052631578948 CA_SCO= 1.1794210526315794
[['B', ' N ', 165.349, 90.441, 92.244], ['B', ' CA ', 164.536, 89.383, 92.837], ['B', ' C ', 164.026, 89.676, 94.254], ['B', ' O ', 162.933, 89.24, 94.569], ['B', ' CB ', 165.225, 88.016, 92.755], ['B', ' CG ', 164.451, 86.876, 93.425], ['B', ' CD ', 163.1, 86.575, 92.796], ['B', ' OE1', 162.984, 86.355, 91.586], ['B', ' NE2', 162.069, 86.561, 93.628], ['B', ' H ', 166.202, 90.184, 91.74], ['B', ' HA ', 163.654, 89.286, 92.207], ['B', ' HB ', 165.303, 87.749, 91.701], ['B', ' HB ', 166.235, 88.038, 93.125], ['B', ' HG ', 165.057, 85.978, 93.334], ['B', ' HG ', 164.3, 87.098, 94.481], ['B', ' HE2', 161.149, 86.369, 93.291], ['B', ' HE2', 162.209, 86.768, 94.602]] AA_SCO= 1.5431578947368423 CA_SCO= 1.1217894736842107
[['B', ' N ', 164.79, 90.256, 95.184], ['B', ' CA ', 164.321, 90.658, 96.5], ['B', ' C ', 163.201, 91.725, 96.476], ['B', ' O ', 162.486, 91.88, 97.462], ['B', ' CB ', 165.608, 91.18, 97.136], ['B', ' CG ', 166.698, 90.476, 96.397], ['B', ' CD ', 166.221, 90.367, 95.017], ['B', ' HA ', 163.968, 89.76, 97.03], ['B', ' HB ', 165.684, 92.265, 97.009], ['B', ' HB ', 165.616, 90.967, 98.217], ['B', ' HG ', 167.607, 91.05, 96.42], ['B', ' HG ', 166.921, 89.504, 96.852], ['B', ' HD ', 166.462, 91.251, 94.511], ['B', ' HD ', 166.682, 89.509, 94.571]] AA_SCO= 1.436842105263158 CA_SCO= 1.1216315789473683
[['B', ' N ', 163.063, 92.478, 95.368], ['B', ' CA ', 162.028, 93.506, 95.218], ['B', ' C ', 160.802, 92.828, 94.632], ['B', ' O ', 159.638, 93.248, 94.781], ['B', ' CB ', 162.488, 94.637, 94.307], ['B', ' CG ', 161.462, 95.735, 94.203], ['B', ' SD ', 161.896, 97.09, 93.171], ['B', ' CE ', 161.596, 96.465, 91.541], ['B', ' H ', 163.664, 92.321, 94.572], ['B', ' HA ', 161.782, 93.904, 96.191], ['B', ' HB ', 163.418, 95.054, 94.68], ['B', ' HB ', 162.683, 94.239, 93.312], ['B', ' HG ', 160.529, 95.337, 93.835], ['B', ' HG ', 161.285, 96.119, 95.2], ['B', ' HE ', 161.825, 97.23, 90.803], ['B', ' HE ', 162.208, 95.59, 91.362], ['B', ' HE ', 160.57, 96.202, 91.464]] AA_SCO= 1.4694736842105265 CA_SCO= 1.142157894736842
[['B', ' N ', 161.081, 91.782, 93.895], ['B', ' CA ', 160.065, 90.998, 93.272], ['B', ' C ', 159.382, 90.33, 94.433], ['B', ' O ', 160.012, 89.975, 95.424], ['B', ' CB ', 160.695, 90.014, 92.278], ['B', ' CG ', 159.782, 89.359, 91.219], ['B', ' CD1', 160.636, 89.066, 89.99], ['B', ' CD2', 159.165, 88.07, 91.739], ['B', ' H ', 162.058, 91.535, 93.73], ['B', ' HA ', 159.348, 91.633, 92.774], ['B', ' HB ', 161.496, 90.533, 91.758], ['B', ' HB ', 161.136, 89.208, 92.849], ['B', ' HG ', 158.988, 90.052, 90.936], ['B', ' HD1', 160.017, 88.616, 89.212], ['B', ' HD1', 161.067, 89.993, 89.614], ['B', ' HD1', 161.441, 88.375, 90.26], ['B', ' HD2', 158.543, 87.63, 90.961], ['B', ' HD2', 159.952, 87.377, 91.999], ['B', ' HD2', 158.556, 88.255, 92.604]] AA_SCO= 1.473684210526316 CA_SCO= 1.1703157894736842
[['B', ' N ', 158.08, 90.238, 94.359], ['B', ' CA ', 157.274, 89.66, 95.428], ['B', ' C ', 157.142, 90.572, 96.672], ['B', ' O ', 156.408, 90.237, 97.598], ['B', ' CB ', 157.846, 88.293, 95.86], ['B', ' CG ', 156.775, 87.298, 96.368], ['B', ' OD1', 155.687, 87.302, 95.826], ['B', ' OD2', 157.063, 86.53, 97.267], ['B', ' H ', 157.622, 90.559, 93.495], ['B', ' HA ', 156.272, 89.492, 95.031], ['B', ' HB ', 158.379, 87.837, 95.028], ['B', ' HB ', 158.57, 88.441, 96.665]] AA_SCO= 1.5536842105263158 CA_SCO= 1.210421052631579
[['B', ' N ', 157.629, 91.833, 96.631], ['B', ' CA ', 157.304, 92.743, 97.742], ['B', ' C ', 155.919, 93.286, 97.457], ['B', ' O ', 155.285, 93.944, 98.273], ['B', ' CB ', 158.264, 93.931, 97.927], ['B', ' CG ', 159.699, 93.665, 98.38], ['B', ' CD1', 160.472, 95.01, 98.371], ['B', ' CD2', 159.72, 93.068, 99.776], ['B', ' H ', 158.256, 92.155, 95.88], ['B', ' HA ', 157.263, 92.173, 98.663], ['B', ' HB ', 158.348, 94.441, 96.965], ['B', ' HB ', 157.815, 94.625, 98.638], ['B', ' HG ', 160.177, 92.979, 97.685], ['B', ' HD1', 161.507, 94.838, 98.676], ['B', ' HD1', 160.453, 95.439, 97.368], ['B', ' HD1', 160.004, 95.705, 99.061], ['B', ' HD2', 160.75, 92.907, 100.073], ['B', ' HD2', 159.245, 93.752, 100.478], ['B', ' HD2', 159.199, 92.118, 99.787]] AA_SCO= 1.332105263157895 CA_SCO= 1.2127368421052631
[['B', ' N ', 155.408, 92.926, 96.289], ['B', ' CA ', 154.083, 93.26, 95.829], ['B', ' C ', 153.083, 92.471, 96.662], ['B', ' O ', 151.892, 92.772, 96.671], ['B', ' CB ', 153.947, 92.972, 94.346], ['B', ' H ', 156.006, 92.404, 95.669], ['B', ' HA ', 153.898, 94.315, 96.013], ['B', ' HB ', 152.944, 93.228, 94.012], ['B', ' HB ', 154.667, 93.554, 93.783], ['B', ' HB ', 154.124, 91.913, 94.159]] AA_SCO= 1.5263157894736843 CA_SCO= 1.2565263157894737
[['B', ' N ', 153.58, 91.456, 97.388], ['B', ' CA ', 152.77, 90.636, 98.254], ['B', ' C ', 152.407, 91.386, 99.538], ['B', ' O ', 151.586, 90.904, 100.32], ['B', ' H ', 154.573, 91.222, 97.353], ['B', ' HA ', 151.864, 90.333, 97.73], ['B', ' HA ', 153.322, 89.728, 98.501]] AA_SCO= 1.5310526315789474 CA_SCO= 1.275157894736842
[['B', ' N ', 153.009, 92.556, 99.77], ['B', ' CA ', 152.67, 93.341, 100.936], ['B', ' C ', 151.622, 94.345, 100.542], ['B', ' O ', 151.906, 95.369, 99.916], ['B', ' CB ', 153.875, 94.1, 101.485], ['B', ' CG ', 154.872, 93.27, 102.152], ['B', ' CD1', 155.797, 92.581, 101.417], ['B', ' CD2', 154.883, 93.216, 103.532], ['B', ' CE1', 156.734, 91.811, 102.043], ['B', ' CE2', 155.824, 92.451, 104.172], ['B', ' CZ ', 156.748, 91.743, 103.427], ['B', ' OH ', 157.684, 90.964, 104.058], ['B', ' H ', 153.7, 92.928, 99.114], ['B', ' HA ', 152.258, 92.691, 101.707], ['B', ' HB ', 154.368, 94.626, 100.665], ['B', ' HB ', 153.53, 94.856, 102.194], ['B', ' HD1', 155.779, 92.64, 100.342], ['B', ' HD2', 154.144, 93.78, 104.11], ['B', ' HE1', 157.464, 91.256, 101.455], ['B', ' HE2', 155.841, 92.399, 105.261], ['B', ' HH ', 158.248, 90.542, 103.403]] AA_SCO= 1.5373684210526315 CA_SCO= 1.3212105263157894
[['B', ' N ', 150.408, 94.081, 100.97], ['B', ' CA ', 149.279, 94.911, 100.639], ['B', ' C ', 148.812, 95.643, 101.883], ['B', ' O ', 147.945, 96.521, 101.839], ['B', ' CB ', 148.178, 94.042, 100.041], ['B', ' OG1', 147.789, 93.047, 100.997], ['B', ' CG2', 148.718, 93.36, 98.776], ['B', ' H ', 150.23, 93.227, 101.487], ['B', ' HA ', 149.583, 95.646, 99.897], ['B', ' HB ', 147.313, 94.652, 99.786], ['B', ' HG1', 146.979, 92.619, 100.684], ['B', ' HG2', 147.934, 92.738, 98.34], ['B', ' HG2', 149.014, 94.119, 98.06], ['B', ' HG2', 149.578, 92.737, 99.015]] AA_SCO= 1.3568421052631578 CA_SCO= 1.3374736842105261
[['B', ' N ', 149.413, 95.282, 102.998], ['B', ' CA ', 149.12, 95.874, 104.276], ['B', ' C ', 150.402, 95.873, 105.084], ['B', ' O ', 151.107, 94.861, 105.123], ['B', ' CB ', 148.018, 95.093, 104.976], ['B', ' CG ', 147.541, 95.693, 106.274], ['B', ' CD ', 146.374, 94.941, 106.849], ['B', ' OE1', 146.597, 93.946, 107.493], ['B', ' OE2', 145.246, 95.354, 106.629], ['B', ' H ', 150.124, 94.574, 102.936], ['B', ' HA ', 148.786, 96.898, 104.136], ['B', ' HB ', 147.157, 95.005, 104.313], ['B', ' HB ', 148.371, 94.084, 105.186], ['B', ' HG ', 148.358, 95.679, 106.997], ['B', ' HG ', 147.256, 96.731, 106.105]] AA_SCO= 1.4352631578947368 CA_SCO= 1.3341052631578945
[['B', ' N ', 150.733, 97.015, 105.674], ['B', ' CA ', 151.912, 97.153, 106.516], ['B', ' C ', 151.804, 98.468, 107.297], ['B', ' O ', 151.112, 99.382, 106.844], ['B', ' CB ', 153.207, 97.081, 105.703], ['B', ' H ', 150.09, 97.794, 105.619], ['B', ' HA ', 151.91, 96.318, 107.221], ['B', ' HB ', 154.049, 97.149, 106.388], ['B', ' HB ', 153.258, 96.133, 105.176], ['B', ' HB ', 153.267, 97.871, 105.007]] AA_SCO= 1.6468421052631579 CA_SCO= 1.3345263157894733
[['B', ' N ', 152.466, 98.543, 108.459], ['B', ' CA ', 152.613, 99.707, 109.345], ['B', ' C ', 153.682, 99.406, 110.382], ['B', ' O ', 154.264, 98.318, 110.415], ['B', ' CB ', 151.267, 100.068, 110.04], ['B', ' SG ', 151.256, 101.546, 111.234], ['B', ' H ', 152.958, 97.68, 108.712], ['B', ' HA ', 152.939, 100.56, 108.744], ['B', ' HB ', 150.521, 100.261, 109.283], ['B', ' HB ', 150.913, 99.196, 110.603]] AA_SCO= 1.6178947368421053 CA_SCO= 1.3418421052631577
[['B', ' N ', 153.92, 100.321, 111.291], ['B', ' CA ', 154.722, 99.907, 112.393], ['B', ' C ', 153.713, 98.951, 112.989], ['B', ' O ', 152.582, 98.918, 112.527], ['B', ' H ', 153.503, 101.241, 111.245], ['B', ' HA ', 155.633, 99.404, 112.067], ['B', ' HA ', 154.96, 100.733, 113.054]] AA_SCO= 1.7768421052631582 CA_SCO= 1.3267894736842105
[['B', ' N ', 154.062, 98.188, 113.99], ['B', ' CA ', 153.2, 97.114, 114.527], ['B', ' C ', 153.522, 95.821, 113.76], ['B', ' O ', 153.481, 94.746, 114.347], ['B', ' CB ', 151.682, 97.337, 114.365], ['B', ' SG ', 151.045, 98.858, 115.075], ['B', ' H ', 154.981, 98.312, 114.388], ['B', ' HA ', 153.423, 96.972, 115.582], ['B', ' HB ', 151.339, 97.219, 113.333], ['B', ' HB ', 151.194, 96.533, 114.911], ['B', ' HG ', 151.523, 99.601, 114.05]] AA_SCO= 1.8010526315789477 CA_SCO= 1.7108947368421052
[['B', ' N ', 154.041, 95.914, 112.526], ['B', ' CA ', 154.529, 94.718, 111.832], ['B', ' C ', 155.805, 94.33, 112.544], ['B', ' O ', 156.126, 93.161, 112.789], ['B', ' CB ', 154.841, 95.03, 110.387], ['B', ' CG ', 153.626, 95.331, 109.615], ['B', ' OD1', 152.552, 94.949, 109.998], ['B', ' OD2', 153.762, 96.019, 108.644], ['B', ' H ', 154.047, 96.809, 112.019], ['B', ' HA ', 153.794, 93.919, 111.902], ['B', ' HB ', 155.518, 95.888, 110.327], ['B', ' HB ', 155.34, 94.178, 109.926]] AA_SCO= 1.8289473684210527 CA_SCO= 1.7371578947368418
[['B', ' N ', 156.439, 95.344, 113.073], ['B', ' CA ', 157.642, 95.191, 113.824], ['B', ' C ', 157.369, 94.637, 115.205], ['B', ' O ', 158.3, 94.488, 115.962], ['B', ' CB ', 158.327, 96.535, 113.957], ['B', ' CG ', 158.842, 97.155, 112.68], ['B', ' CD1', 159.283, 98.559, 112.977], ['B', ' CD2', 160.022, 96.339, 112.155], ['B', ' H ', 156.117, 96.275, 112.851], ['B', ' HA ', 158.278, 94.483, 113.312], ['B', ' HB ', 157.635, 97.231, 114.423], ['B', ' HB ', 159.179, 96.407, 114.624], ['B', ' HG ', 158.056, 97.189, 111.926], ['B', ' HD1', 159.658, 99.017, 112.063], ['B', ' HD1', 158.438, 99.139, 113.349], ['B', ' HD1', 160.064, 98.541, 113.73], ['B', ' HD2', 160.396, 96.806, 111.26], ['B', ' HD2', 160.816, 96.315, 112.905], ['B', ' HD2', 159.731, 95.328, 111.918]] AA_SCO= 1.8342105263157895 CA_SCO= 1.7471578947368416
[['B', ' N ', 156.094, 94.478, 115.589], ['B', ' CA ', 155.704, 93.871, 116.847], ['B', ' C ', 154.968, 92.561, 116.569], ['B', ' O ', 154.395, 91.97, 117.493], ['B', ' CB ', 154.778, 94.782, 117.643], ['B', ' CG ', 155.362, 96.085, 118.055], ['B', ' CD ', 156.495, 95.924, 119.002], ['B', ' OE1', 156.504, 95.003, 119.822], ['B', ' NE2', 157.443, 96.828, 118.928], ['B', ' H ', 155.33, 94.672, 114.951], ['B', ' HA ', 156.591, 93.645, 117.431], ['B', ' HB ', 153.887, 94.984, 117.052], ['B', ' HB ', 154.455, 94.263, 118.544], ['B', ' HG ', 155.738, 96.593, 117.169], ['B', ' HG ', 154.593, 96.688, 118.535], ['B', ' HE2', 158.221, 96.803, 119.553], ['B', ' HE2', 157.378, 97.567, 118.255]] AA_SCO= 1.8605263157894738 CA_SCO= 1.7594210526315788
[['B', ' N ', 154.914, 92.16, 115.296], ['B', ' CA ', 154.17, 90.987, 114.866], ['B', ' C ', 155.052, 89.957, 114.192], ['B', ' O ', 154.948, 88.757, 114.473], ['B', ' CB ', 153.06, 91.387, 113.879], ['B', ' OG1', 152.177, 92.325, 114.499], ['B', ' CG2', 152.264, 90.164, 113.462], ['B', ' H ', 155.418, 92.679, 114.589], ['B', ' HA ', 153.716, 90.525, 115.74], ['B', ' HB ', 153.502, 91.846, 113.001], ['B', ' HG1', 152.624, 93.203, 114.543], ['B', ' HG2', 151.48, 90.467, 112.772], ['B', ' HG2', 152.905, 89.435, 112.971], ['B', ' HG2', 151.816, 89.711, 114.346]] AA_SCO= 1.7426315789473683 CA_SCO= 1.7486842105263154
[['B', ' N ', 155.881, 90.428, 113.265], ['B', ' CA ', 156.746, 89.593, 112.454], ['B', ' C ', 158.198, 89.694, 112.93], ['B', ' O ', 158.984, 88.763, 112.773], ['B', ' CB ', 156.602, 90.06, 111.024], ['B', ' CG ', 155.211, 89.866, 110.465], ['B', ' CD ', 155.089, 90.388, 109.041], ['B', ' CE ', 153.661, 90.241, 108.528], ['B', ' NZ ', 153.507, 90.763, 107.142], ['B', ' H ', 155.879, 91.422, 113.083], ['B', ' HA ', 156.427, 88.555, 112.542], ['B', ' HB ', 156.798, 91.116, 110.992], ['B', ' HB ', 157.327, 89.556, 110.389], ['B', ' HG ', 154.96, 88.807, 110.486], ['B', ' HG ', 154.5, 90.399, 111.088], ['B', ' HD ', 155.367, 91.446, 109.015], ['B', ' HD ', 155.766, 89.838, 108.387], ['B', ' HE ', 153.382, 89.188, 108.542], ['B', ' HE ', 152.99, 90.794, 109.188], ['B', ' HZ ', 152.548, 90.651, 106.839], ['B', ' HZ ', 153.75, 91.748, 107.114], ['B', ' HZ ', 154.118, 90.241, 106.527]] AA_SCO= 1.873157894736842 CA_SCO= 1.8007368421052632
[['B', ' N ', 158.544, 90.851, 113.47], ['B', ' CA ', 159.859, 91.177, 114.007], ['B', ' C ', 159.576, 91.607, 115.433], ['B', ' O ', 158.416, 91.845, 115.744], ['B', ' CB ', 160.595, 92.2, 113.12], ['B', ' CG1', 161.91, 92.636, 113.722], ['B', ' CG2', 160.887, 91.535, 111.778], ['B', ' H ', 157.827, 91.572, 113.499], ['B', ' HA ', 160.465, 90.272, 114.042], ['B', ' HB ', 159.98, 93.07, 112.976], ['B', ' HG1', 162.386, 93.324, 113.043], ['B', ' HG1', 161.739, 93.14, 114.652], ['B', ' HG1', 162.556, 91.773, 113.873], ['B', ' HG2', 161.4, 92.239, 111.124], ['B', ' HG2', 161.517, 90.658, 111.933], ['B', ' HG2', 159.966, 91.219, 111.311]] AA_SCO= 2.0557894736842104 CA_SCO= 1.556578947368421
[['B', ' N ', 160.567, 91.522, 116.336], ['B', ' CA ', 160.442, 91.766, 117.81], ['B', ' C ', 159.741, 90.576, 118.392], ['B', ' O ', 160.274, 89.834, 119.225], ['B', ' CB ', 159.667, 93.034, 118.213], ['B', ' CG1', 159.448, 93.064, 119.705], ['B', ' CG2', 160.436, 94.265, 117.827], ['B', ' H ', 161.457, 91.26, 115.945], ['B', ' HA ', 161.429, 91.822, 118.257], ['B', ' HB ', 158.716, 93.029, 117.757], ['B', ' HG1', 158.902, 93.968, 119.965], ['B', ' HG1', 158.87, 92.206, 120.031], ['B', ' HG1', 160.401, 93.058, 120.208], ['B', ' HG2', 159.85, 95.134, 118.113], ['B', ' HG2', 161.374, 94.283, 118.334], ['B', ' HG2', 160.594, 94.278, 116.752]] AA_SCO= 2.075263157894737 CA_SCO= 1.5737368421052629
[['B', ' N ', 158.562, 90.359, 117.896], ['B', ' CA ', 157.842, 89.229, 118.255], ['B', ' C ', 158.605, 88.195, 117.495], ['B', ' O ', 159.619, 88.501, 116.849], ['B', ' CB ', 156.442, 89.389, 117.763], ['B', ' CG ', 155.486, 88.594, 118.424], ['B', ' OD1', 155.776, 87.449, 118.819], ['B', ' ND2', 154.317, 89.153, 118.568], ['B', ' H ', 158.173, 91.021, 117.242], ['B', ' HA ', 157.895, 89.035, 119.326], ['B', ' HB ', 156.18, 90.416, 117.892], ['B', ' HB ', 156.41, 89.178, 116.698], ['B', ' HD2', 153.571, 88.669, 119.022], ['B', ' HD2', 154.178, 90.102, 118.2]] AA_SCO= 2.0563157894736843 CA_SCO= 1.6139473684210526
[['B', ' N ', 158.209, 86.975, 117.617], ['B', ' CA ', 158.906, 85.891, 116.963], ['B', ' C ', 160.369, 85.75, 117.449], ['B', ' O ', 161.069, 84.887, 116.926], ['B', ' CB ', 158.969, 86.103, 115.439], ['B', ' CG ', 157.68, 86.43, 114.749], ['B', ' CD ', 156.655, 85.405, 114.858], ['B', ' OE1', 156.933, 84.205, 114.98], ['B', ' NE2', 155.418, 85.856, 114.798], ['B', ' H ', 157.369, 86.801, 118.168], ['B', ' HA ', 158.381, 84.96, 117.181], ['B', ' HB ', 159.694, 86.864, 115.171], ['B', ' HB ', 159.314, 85.185, 114.98], ['B', ' HG ', 157.273, 87.353, 115.151], ['B', ' HG ', 157.899, 86.574, 113.7], ['B', ' HE2', 154.643, 85.228, 114.861], ['B', ' HE2', 155.253, 86.868, 114.681]] AA_SCO= 2.1173684210526313 CA_SCO= 1.6027894736842103
[['B', ' N ', 160.841, 86.563, 118.43], ['B', ' CA ', 162.195, 86.458, 118.957], ['B', ' C ', 163.261, 87.031, 118.024], ['B', ' O ', 164.425, 86.656, 118.127], ['B', ' H ', 160.264, 87.311, 118.827], ['B', ' HA ', 162.238, 86.981, 119.912], ['B', ' HA ', 162.42, 85.414, 119.163]] AA_SCO= 2.3699999999999997 CA_SCO= 1.6019999999999996
[['B', ' N ', 162.885, 87.907, 117.099], ['B', ' CA ', 163.888, 88.4, 116.159], ['B', ' C ', 164.561, 89.774, 116.331], ['B', ' O ', 165.706, 89.938, 115.918], ['B', ' CB ', 163.261, 88.348, 114.773], ['B', ' CG ', 162.86, 86.978, 114.238], ['B', ' CD1', 162.188, 87.164, 112.898], ['B', ' CD2', 164.079, 86.104, 114.074], ['B', ' H ', 161.898, 88.184, 117.032], ['B', ' HA ', 164.708, 87.695, 116.189], ['B', ' HB ', 162.366, 88.961, 114.787], ['B', ' HB ', 163.925, 88.749, 114.081], ['B', ' HG ', 162.153, 86.5, 114.914], ['B', ' HD1', 161.894, 86.189, 112.505], ['B', ' HD1', 161.301, 87.786, 113.015], ['B', ' HD1', 162.873, 87.642, 112.2], ['B', ' HD2', 163.786, 85.156, 113.658], ['B', ' HD2', 164.77, 86.588, 113.399], ['B', ' HD2', 164.57, 85.925, 115.023]] AA_SCO= 2.3568421052631576 CA_SCO= 1.610315789473684
[['B', ' N ', 163.919, 90.781, 116.894], ['B', ' CA ', 164.565, 92.106, 116.838], ['B', ' C ', 165.786, 92.158, 117.722], ['B', ' O ', 165.808, 91.561, 118.801], ['B', ' CB ', 163.661, 93.257, 117.209], ['B', ' SG ', 164.395, 94.897, 116.951], ['B', ' H ', 163.02, 90.633, 117.327], ['B', ' HA ', 164.885, 92.282, 115.811], ['B', ' HB ', 162.775, 93.206, 116.629], ['B', ' HB ', 163.397, 93.176, 118.261], ['B', ' HG ', 163.235, 95.54, 116.864]] AA_SCO= 2.353684210526316 CA_SCO= 1.5976315789473685
[['B', ' N ', 166.823, 92.821, 117.226], ['B', ' CA ', 168.071, 92.956, 117.939], ['B', ' C ', 168.447, 94.405, 118.307], ['B', ' O ', 169.606, 94.701, 118.563], ['B', ' CB ', 169.172, 92.194, 117.181], ['B', ' CG1', 170.454, 91.951, 118.085], ['B', ' CG2', 169.531, 92.938, 115.899], ['B', ' CD1', 170.206, 91.143, 119.388], ['B', ' H ', 166.712, 93.292, 116.341], ['B', ' HA ', 167.95, 92.419, 118.853], ['B', ' HB ', 168.789, 91.207, 116.909], ['B', ' HG1', 171.159, 91.378, 117.493], ['B', ' HG1', 170.926, 92.875, 118.338], ['B', ' HG2', 170.279, 92.368, 115.349], ['B', ' HG2', 168.648, 93.049, 115.281], ['B', ' HG2', 169.936, 93.927, 116.131], ['B', ' HD1', 171.143, 91.009, 119.911], ['B', ' HD1', 169.532, 91.654, 120.048], ['B', ' HD1', 169.804, 90.204, 119.149]] AA_SCO= 2.4321052631578945 CA_SCO= 1.5955263157894737
[['B', ' N ', 167.512, 95.348, 118.262], ['B', ' CA ', 167.894, 96.708, 118.655], ['B', ' C ', 168.79, 97.343, 117.598], ['B', ' O ', 169.718, 98.097, 117.921], ['B', ' H ', 166.556, 95.112, 118.034], ['B', ' HA ', 167.008, 97.31, 118.819], ['B', ' HA ', 168.414, 96.674, 119.609]] AA_SCO= 2.6231578947368424 CA_SCO= 1.5967894736842105
[['B', ' N ', 168.547, 96.974, 116.348], ['B', ' CA ', 169.365, 97.42, 115.248], ['B', ' C ', 169.324, 98.886, 114.869], ['B', ' O ', 170.3, 99.4, 114.349], ['B', ' CB ', 168.925, 96.66, 114.019], ['B', ' SG ', 167.246, 97.067, 113.578], ['B', ' H ', 167.784, 96.342, 116.163], ['B', ' HA ', 170.389, 97.14, 115.484], ['B', ' HB ', 169.58, 96.892, 113.175], ['B', ' HB ', 168.987, 95.589, 114.201], ['B', ' HG ', 167.539, 98.263, 112.986]] AA_SCO= 2.621578947368421 CA_SCO= 1.6025789473684209
[['B', ' N ', 168.213, 99.564, 115.061], ['B', ' CA ', 168.11, 100.981, 114.714], ['B', ' C ', 167.661, 101.267, 113.275], ['B', ' O ', 167.209, 102.374, 112.986], ['B', ' H ', 167.405, 99.115, 115.477], ['B', ' HA ', 167.434, 101.488, 115.385], ['B', ' HA ', 169.07, 101.451, 114.896]] AA_SCO= 2.6357894736842096 CA_SCO= 1.5966315789473684
[['B', ' N ', 167.734, 100.285, 112.368], ['B', ' CA ', 167.339, 100.565, 110.967], ['B', ' C ', 165.827, 100.804, 110.87], ['B', ' O ', 165.355, 101.671, 110.112], ['B', ' CB ', 167.679, 99.408, 110.094], ['B', ' OG1', 166.962, 98.335, 110.56], ['B', ' CG2', 169.095, 99.098, 110.15], ['B', ' H ', 168.061, 99.361, 112.622], ['B', ' HA ', 167.868, 101.454, 110.62], ['B', ' HB ', 167.399, 99.622, 109.063], ['B', ' HG1', 166.246, 98.19, 109.906], ['B', ' HG2', 169.257, 98.247, 109.514], ['B', ' HG2', 169.66, 99.932, 109.778], ['B', ' HG2', 169.404, 98.87, 111.163]] AA_SCO= 2.648421052631579 CA_SCO= 1.5983684210526317
[['B', ' N ', 165.056, 100.071, 111.694], ['B', ' CA ', 163.659, 100.259, 111.949], ['B', ' C ', 163.602, 101.405, 112.96], ['B', ' O ', 164.03, 101.271, 114.105], ['B', ' CB ', 162.962, 98.946, 112.37], ['B', ' SG ', 163.783, 97.877, 113.688], ['B', ' H ', 165.537, 99.336, 112.214], ['B', ' HA ', 163.169, 100.591, 111.023], ['B', ' HB ', 161.974, 99.182, 112.734], ['B', ' HB ', 162.825, 98.362, 111.502]] AA_SCO= 2.620526315789473 CA_SCO= 1.6132105263157892
[['B', ' N ', 163.071, 102.51, 112.472], ['B', ' CA ', 163.117, 103.862, 113.024], ['B', ' C ', 164.007, 104.73, 112.113], ['B', ' O ', 163.512, 105.747, 111.621], ['B', ' CB ', 163.628, 103.906, 114.459], ['B', ' H ', 162.685, 102.413, 111.551], ['B', ' HA ', 162.13, 104.272, 112.993], ['B', ' HB ', 163.617, 104.941, 114.8], ['B', ' HB ', 162.981, 103.315, 115.096], ['B', ' HB ', 164.651, 103.528, 114.518]] AA_SCO= 2.6263157894736837 CA_SCO= 1.6134210526315789
[['B', ' N ', 165.241, 104.326, 111.751], ['B', ' CA ', 166.04, 105.182, 110.854], ['B', ' C ', 165.317, 105.446, 109.547], ['B', ' O ', 165.39, 106.539, 108.987], ['B', ' CB ', 167.358, 104.535, 110.451], ['B', ' CG ', 168.32, 105.485, 109.709], ['B', ' SD ', 169.894, 104.725, 109.379], ['B', ' CE ', 170.629, 105.668, 108.072], ['B', ' H ', 165.691, 103.486, 112.131], ['B', ' HA ', 166.234, 106.128, 111.349], ['B', ' HB ', 167.837, 104.053, 111.26], ['B', ' HB ', 167.126, 103.734, 109.751], ['B', ' HG ', 167.888, 105.846, 108.78], ['B', ' HG ', 168.503, 106.334, 110.353], ['B', ' HE ', 171.614, 105.262, 107.835], ['B', ' HE ', 169.998, 105.602, 107.192], ['B', ' HE ', 170.732, 106.706, 108.378]] AA_SCO= 2.6521052631578943 CA_SCO= 1.6174736842105262
[['B', ' N ', 164.624, 104.428, 109.061], ['B', ' CA ', 163.901, 104.448, 107.8], ['B', ' C ', 162.417, 104.787, 107.897], ['B', ' O ', 161.679, 104.571, 106.936], ['B', ' CB ', 164.013, 103.098, 107.166], ['B', ' H ', 164.676, 103.543, 109.577], ['B', ' HA ', 164.378, 105.193, 107.163], ['B', ' HB ', 163.535, 103.129, 106.205], ['B', ' HB ', 165.036, 102.842, 107.047], ['B', ' HB ', 163.531, 102.359, 107.805]] AA_SCO= 2.6184210526315783 CA_SCO= 1.6063684210526314
[['B', ' N ', 161.928, 105.237, 109.041], ['B', ' CA ', 160.486, 105.457, 109.14], ['B', ' C ', 159.892, 106.484, 108.17], ['B', ' O ', 158.747, 106.326, 107.757], ['B', ' CB ', 160.07, 105.794, 110.544], ['B', ' SG ', 158.278, 105.878, 110.714], ['B', ' H ', 162.553, 105.421, 109.836], ['B', ' HA ', 160.01, 104.505, 108.912], ['B', ' HB ', 160.442, 105.026, 111.209], ['B', ' HB ', 160.508, 106.73, 110.851], ['B', ' HG ', 157.999, 105.072, 109.686]] AA_SCO= 2.563157894736842 CA_SCO= 1.6059473684210526
[['B', ' N ', 160.613, 107.581, 107.903], ['B', ' CA ', 160.221, 108.692, 106.996], ['B', ' C ', 159.052, 109.583, 107.424], ['B', ' O ', 158.67, 110.489, 106.692], ['B', ' CB ', 159.865, 108.121, 105.627], ['B', ' CG ', 160.976, 107.387, 104.941], ['B', ' CD ', 160.427, 106.522, 103.884], ['B', ' OE1', 160.158, 106.805, 102.699], ['B', ' NE2', 160.202, 105.351, 104.349], ['B', ' H ', 161.54, 107.632, 108.315], ['B', ' HA ', 161.095, 109.335, 106.873], ['B', ' HB ', 159.014, 107.481, 105.696], ['B', ' HB ', 159.588, 108.941, 104.969], ['B', ' HG ', 161.65, 108.113, 104.482], ['B', ' HG ', 161.523, 106.77, 105.644], ['B', ' HE2', 159.801, 104.666, 103.766], ['B', ' HE2', 160.473, 105.121, 105.319]] AA_SCO= 2.766315789473684 CA_SCO= 1.4734736842105263
[['B', ' N ', 158.52, 109.372, 108.613], ['B', ' CA ', 157.547, 110.266, 109.22], ['B', ' C ', 158.11, 110.498, 110.596], ['B', ' O ', 157.708, 111.384, 111.354], ['B', ' CB ', 156.15, 109.674, 109.358], ['B', ' OG1', 156.18, 108.594, 110.284], ['B', ' CG2', 155.666, 109.173, 108.049], ['B', ' H ', 158.828, 108.583, 109.158], ['B', ' HA ', 157.507, 111.214, 108.68], ['B', ' HB ', 155.465, 110.442, 109.727], ['B', ' HG1', 155.228, 108.393, 110.506], ['B', ' HG2', 154.671, 108.766, 108.188], ['B', ' HG2', 155.63, 109.992, 107.335], ['B', ' HG2', 156.33, 108.394, 107.675]] AA_SCO= 2.752105263157895 CA_SCO= 1.4758421052631576
[['B', ' N ', 159.074, 109.64, 110.899], ['B', ' CA ', 159.712, 109.495, 112.187], ['B', ' C ', 158.735, 109.116, 113.292], ['B', ' O ', 158.917, 109.496, 114.446], ['B', ' CB ', 160.495, 110.74, 112.539], ['B', ' CG ', 161.611, 111.019, 111.555], ['B', ' CD ', 162.421, 112.197, 111.929], ['B', ' NE ', 163.541, 112.399, 110.986], ['B', ' CZ ', 164.442, 113.412, 111.033], ['B', ' NH1', 164.37, 114.339, 111.959], ['B', ' NH2', 165.412, 113.471, 110.138], ['B', ' H ', 159.358, 109.025, 110.153], ['B', ' HA ', 160.438, 108.687, 112.111], ['B', ' HB ', 159.846, 111.609, 112.588], ['B', ' HB ', 160.948, 110.614, 113.523], ['B', ' HG ', 162.266, 110.157, 111.517], ['B', ' HG ', 161.197, 111.178, 110.571], ['B', ' HD ', 161.792, 113.086, 111.918], ['B', ' HD ', 162.826, 112.054, 112.927], ['B', ' HE ', 163.655, 111.714, 110.251], ['B', ' HH1', 163.641, 114.322, 112.654], ['B', ' HH1', 165.051, 115.091, 111.975], ['B', ' HH2', 165.485, 112.764, 109.423], ['B', ' HH2', 166.093, 114.224, 110.182]] AA_SCO= 2.6984210526315793 CA_SCO= 1.7098947368421051
[['B', ' N ', 157.731, 108.3, 112.941], ['B', ' CA ', 156.797, 107.753, 113.906], ['B', ' C ', 157.508, 106.81, 114.858], ['B', ' O ', 157.133, 106.683, 116.021], ['B', ' CB ', 155.682, 107.005, 113.212], ['B', ' H ', 157.581, 108.075, 111.958], ['B', ' HA ', 156.379, 108.579, 114.476], ['B', ' HB ', 154.978, 106.635, 113.948], ['B', ' HB ', 155.189, 107.67, 112.553], ['B', ' HB ', 156.083, 106.176, 112.652]] AA_SCO= 2.6652631578947372 CA_SCO= 1.717157894736842
[['B', ' N ', 158.506, 106.099, 114.362], ['B', ' CA ', 159.231, 105.156, 115.183], ['B', ' C ', 160.456, 105.742, 115.83], ['B', ' O ', 161.241, 106.459, 115.206], ['B', ' CB ', 159.672, 103.988, 114.341], ['B', ' CG ', 158.652, 103.092, 113.789], ['B', ' CD1', 159.304, 102.198, 112.835], ['B', ' CD2', 158.066, 102.256, 114.886], ['B', ' H ', 158.769, 106.209, 113.394], ['B', ' HA ', 158.573, 104.822, 115.975], ['B', ' HB ', 160.127, 104.417, 113.496], ['B', ' HB ', 160.407, 103.402, 114.895], ['B', ' HG ', 157.874, 103.664, 113.282], ['B', ' HD1', 158.546, 101.529, 112.441], ['B', ' HD1', 159.742, 102.78, 112.029], ['B', ' HD1', 160.083, 101.621, 113.335], ['B', ' HD2', 157.334, 101.565, 114.474], ['B', ' HD2', 158.853, 101.7, 115.361], ['B', ' HD2', 157.598, 102.868, 115.605]] AA_SCO= 2.621578947368421 CA_SCO= 1.7314210526315785
[['B', ' N ', 160.651, 105.345, 117.07], ['B', ' CA ', 161.784, 105.737, 117.889], ['B', ' C ', 162.114, 104.537, 118.759], ['B', ' O ', 161.216, 104.014, 119.412], ['B', ' CB ', 161.418, 106.965, 118.727], ['B', ' CG ', 162.594, 107.604, 119.439], ['B', ' OD1', 163.658, 107.06, 119.365], ['B', ' OD2', 162.417, 108.643, 120.045], ['B', ' H ', 159.908, 104.774, 117.491], ['B', ' HA ', 162.641, 105.963, 117.254], ['B', ' HB ', 160.953, 107.711, 118.078], ['B', ' HB ', 160.675, 106.676, 119.473]] AA_SCO= 2.5600000000000005 CA_SCO= 1.7496842105263157
[['B', ' N ', 163.303, 103.961, 118.663], ['B', ' CA ', 163.506, 102.77, 119.469], ['B', ' C ', 163.787, 103.14, 120.904], ['B', ' O ', 164.637, 103.982, 121.189], ['B', ' CB ', 164.634, 101.902, 118.932], ['B', ' CG ', 164.379, 101.365, 117.555], ['B', ' SD ', 165.617, 100.283, 116.961], ['B', ' CE ', 165.073, 98.687, 117.376], ['B', ' H ', 164.043, 104.387, 118.118], ['B', ' HA ', 162.594, 102.204, 119.474], ['B', ' HB ', 165.54, 102.492, 118.886], ['B', ' HB ', 164.808, 101.068, 119.613], ['B', ' HG ', 163.474, 100.833, 117.535], ['B', ' HG ', 164.294, 102.191, 116.857], ['B', ' HE ', 165.782, 97.958, 117.017], ['B', ' HE ', 164.951, 98.6, 118.448], ['B', ' HE ', 164.141, 98.524, 116.877]] AA_SCO= 2.5131578947368425 CA_SCO= 1.7505789473684212
[['B', ' N ', 163.096, 102.473, 121.815], ['B', ' CA ', 163.255, 102.703, 123.229], ['B', ' C ', 163.608, 101.384, 123.86], ['B', ' O ', 163.04, 100.349, 123.536], ['B', ' CB ', 161.957, 103.293, 123.819], ['B', ' OG1', 160.87, 102.369, 123.622], ['B', ' CG2', 161.629, 104.589, 123.075], ['B', ' H ', 162.42, 101.775, 121.506], ['B', ' HA ', 164.073, 103.402, 123.395], ['B', ' HB ', 162.084, 103.488, 124.883], ['B', ' HG1', 160.006, 102.796, 123.855], ['B', ' HG2', 160.709, 105.012, 123.48], ['B', ' HG2', 162.444, 105.3, 123.2], ['B', ' HG2', 161.487, 104.388, 122.017]] AA_SCO= 2.475263157894737 CA_SCO= 1.7511052631578947
[['B', ' N ', 164.607, 101.394, 124.72], ['B', ' CA ', 165.053, 100.183, 125.39], ['B', ' C ', 165.373, 99.074, 124.385], ['B', ' O ', 165.128, 97.899, 124.65], ['B', ' CB ', 164.006, 99.718, 126.369], ['B', ' CG ', 163.776, 100.71, 127.424], ['B', ' OD1', 164.72, 101.226, 128.037], ['B', ' ND2', 162.532, 101.018, 127.648], ['B', ' H ', 165.044, 102.276, 124.937], ['B', ' HA ', 165.973, 100.403, 125.933], ['B', ' HB ', 163.066, 99.51, 125.862], ['B', ' HB ', 164.332, 98.788, 126.833], ['B', ' HD2', 162.295, 101.691, 128.348], ['B', ' HD2', 161.817, 100.583, 127.1]] AA_SCO= 2.488947368421053 CA_SCO= 1.7616842105263155
[['B', ' N ', 165.925, 99.44, 123.23], ['B', ' CA ', 166.284, 98.457, 122.223], ['B', ' C ', 165.109, 97.941, 121.375], ['B', ' O ', 165.264, 96.93, 120.687], ['B', ' H ', 166.134, 100.414, 123.063], ['B', ' HA ', 167.034, 98.893, 121.562], ['B', ' HA ', 166.763, 97.611, 122.715]] AA_SCO= 2.4757894736842108 CA_SCO= 1.7737894736842104
[['B', ' N ', 163.939, 98.577, 121.424], ['B', ' CA ', 162.798, 98.099, 120.65], ['B', ' C ', 162.066, 99.246, 119.997], ['B', ' O ', 161.876, 100.282, 120.617], ['B', ' CB ', 161.766, 97.45, 121.545], ['B', ' CG ', 162.177, 96.274, 122.278], ['B', ' CD ', 162.428, 95.129, 121.431], ['B', ' NE ', 162.707, 94.023, 122.251], ['B', ' CZ ', 163.894, 93.769, 122.798], ['B', ' NH1', 164.933, 94.562, 122.592], ['B', ' NH2', 164.02, 92.717, 123.581], ['B', ' H ', 163.812, 99.365, 122.063], ['B', ' HA ', 163.162, 97.406, 119.9], ['B', ' HB ', 161.472, 98.183, 122.299], ['B', ' HB ', 160.87, 97.2, 120.988], ['B', ' HG ', 163.065, 96.51, 122.856], ['B', ' HG ', 161.379, 96.0, 122.965], ['B', ' HD ', 161.542, 94.921, 120.852], ['B', ' HD ', 163.267, 95.289, 120.764], ['B', ' HE ', 161.948, 93.384, 122.452], ['B', ' HH1', 164.881, 95.383, 121.974], ['B', ' HH1', 165.829, 94.332, 123.046], ['B', ' HH2', 163.227, 92.114, 123.753], ['B', ' HH2', 164.916, 92.526, 124.015]] AA_SCO= 2.288421052631579 CA_SCO= 1.763157894736842
[['B', ' N ', 161.545, 99.1, 118.793], ['B', ' CA ', 160.825, 100.159, 118.157], ['B', ' C ', 159.562, 100.444, 118.93], ['B', ' O ', 158.812, 99.517, 119.235], ['B', ' CB ', 160.547, 99.564, 116.78], ['B', ' CG ', 160.573, 98.066, 116.981], ['B', ' CD ', 161.522, 97.816, 118.108], ['B', ' HA ', 161.42, 101.066, 118.069], ['B', ' HB ', 159.571, 99.894, 116.429], ['B', ' HB ', 161.298, 99.924, 116.05], ['B', ' HG ', 159.559, 97.688, 117.186], ['B', ' HG ', 160.906, 97.576, 116.049], ['B', ' HD ', 161.085, 97.051, 118.742], ['B', ' HD ', 162.48, 97.518, 117.734]] AA_SCO= 2.2857894736842104 CA_SCO= 1.7515789473684216
[['B', ' N ', 159.284, 101.716, 119.155], ['B', ' CA ', 158.069, 102.169, 119.791], ['B', ' C ', 157.39, 103.034, 118.758], ['B', ' O ', 158.039, 103.887, 118.144], ['B', ' CB ', 158.374, 102.926, 121.082], ['B', ' CG ', 157.156, 103.418, 121.832], ['B', ' CD ', 157.485, 104.084, 123.149], ['B', ' OE1', 158.4, 103.655, 123.835], ['B', ' OE2', 156.813, 105.032, 123.472], ['B', ' H ', 159.983, 102.431, 118.947], ['B', ' HA ', 157.429, 101.315, 120.018], ['B', ' HB ', 158.942, 102.278, 121.749], ['B', ' HB ', 159.002, 103.789, 120.858], ['B', ' HG ', 156.624, 104.136, 121.206], ['B', ' HG ', 156.493, 102.576, 122.013]] AA_SCO= 2.354736842105263 CA_SCO= 1.7276315789473686
[['B', ' N ', 156.114, 102.784, 118.497], ['B', ' CA ', 155.451, 103.527, 117.444], ['B', ' C ', 154.524, 104.638, 117.872], ['B', ' O ', 153.486, 104.414, 118.507], ['B', ' CB ', 154.617, 102.551, 116.601], ['B', ' CG ', 153.824, 103.159, 115.43], ['B', ' CD1', 154.798, 103.673, 114.374], ['B', ' CD2', 152.86, 102.133, 114.879], ['B', ' H ', 155.613, 102.081, 119.023], ['B', ' HA ', 156.217, 103.99, 116.836], ['B', ' HB ', 155.28, 101.793, 116.196], ['B', ' HB ', 153.901, 102.058, 117.259], ['B', ' HG ', 153.261, 103.995, 115.775], ['B', ' HD1', 154.265, 104.114, 113.563], ['B', ' HD1', 155.456, 104.419, 114.794], ['B', ' HD1', 155.385, 102.858, 113.998], ['B', ' HD2', 152.289, 102.56, 114.058], ['B', ' HD2', 153.391, 101.283, 114.534], ['B', ' HD2', 152.175, 101.824, 115.667]] AA_SCO= 2.3668421052631574 CA_SCO= 1.7274210526315792
[['B', ' N ', 154.804, 105.833, 117.391], ['B', ' CA ', 153.924, 106.938, 117.631], ['B', ' C ', 152.894, 106.804, 116.548], ['B', ' O ', 153.055, 107.356, 115.462], ['B', ' CB ', 154.659, 108.256, 117.518], ['B', ' CG ', 153.821, 109.424, 117.865], ['B', ' OD1', 152.598, 109.306, 117.939], ['B', ' ND2', 154.44, 110.556, 118.082], ['B', ' H ', 155.68, 105.998, 116.891], ['B', ' HA ', 153.44, 106.838, 118.603], ['B', ' HB ', 155.537, 108.24, 118.165], ['B', ' HB ', 155.016, 108.38, 116.499], ['B', ' HD2', 153.919, 111.379, 118.327], ['B', ' HD2', 155.439, 110.6, 118.011]] AA_SCO= 2.2578947368421054 CA_SCO= 1.725578947368421
[['B', ' N ', 151.825, 106.089, 116.854], ['B', ' CA ', 150.843, 105.704, 115.855], ['B', ' C ', 150.166, 106.875, 115.186], ['B', ' O ', 149.799, 106.774, 114.018], ['B', ' CB ', 149.812, 104.806, 116.483], ['B', ' OG ', 149.049, 105.507, 117.415], ['B', ' H ', 151.787, 105.685, 117.792], ['B', ' HA ', 151.356, 105.135, 115.081], ['B', ' HB ', 149.166, 104.393, 115.711], ['B', ' HB ', 150.317, 103.971, 116.973], ['B', ' HG ', 148.438, 104.868, 117.795]] AA_SCO= 2.369473684210526 CA_SCO= 1.7011578947368422
[['B', ' N ', 150.152, 108.031, 115.836], ['B', ' CA ', 149.566, 109.245, 115.278], ['B', ' C ', 150.322, 109.686, 114.025], ['B', ' O ', 149.819, 110.473, 113.225], ['B', ' CB ', 149.606, 110.37, 116.309], ['B', ' CG ', 148.625, 110.182, 117.473], ['B', ' OD1', 147.708, 109.402, 117.366], ['B', ' OD2', 148.831, 110.809, 118.481], ['B', ' H ', 150.463, 108.044, 116.801], ['B', ' HA ', 148.53, 109.042, 115.005], ['B', ' HB ', 150.612, 110.45, 116.711], ['B', ' HB ', 149.385, 111.315, 115.817]] AA_SCO= 2.3468421052631583 CA_SCO= 1.6896315789473686
[['B', ' N ', 151.56, 109.231, 113.882], ['B', ' CA ', 152.381, 109.564, 112.733], ['B', ' C ', 152.657, 108.385, 111.767], ['B', ' O ', 153.539, 108.524, 110.905], ['B', ' CB ', 153.704, 110.135, 113.191], ['B', ' CG ', 153.602, 111.418, 113.938], ['B', ' CD ', 154.934, 111.961, 114.267], ['B', ' NE ', 155.636, 112.348, 113.065], ['B', ' CZ ', 155.461, 113.495, 112.398], ['B', ' NH1', 154.606, 114.413, 112.803], ['B', ' NH2', 156.172, 113.682, 111.317], ['B', ' H ', 151.935, 108.568, 114.564], ['B', ' HA ', 151.862, 110.337, 112.166], ['B', ' HB ', 154.167, 109.429, 113.869], ['B', ' HB ', 154.372, 110.272, 112.341], ['B', ' HG ', 153.055, 112.137, 113.335], ['B', ' HG ', 153.063, 111.251, 114.873], ['B', ' HD ', 154.841, 112.828, 114.918], ['B', ' HD ', 155.524, 111.191, 114.77], ['B', ' HE ', 156.342, 111.7, 112.675], ['B', ' HH1', 154.072, 114.299, 113.673], ['B', ' HH1', 154.504, 115.267, 112.28], ['B', ' HH2', 156.828, 112.94, 111.054], ['B', ' HH2', 156.093, 114.536, 110.776]] AA_SCO= 2.375263157894737 CA_SCO= 1.702421052631579
[['B', ' N ', 151.954, 107.216, 111.913], ['B', ' CA ', 152.128, 106.065, 111.03], ['B', ' C ', 151.169, 106.306, 109.893], ['B', ' O ', 150.036, 106.754, 110.063], ['B', ' CB ', 151.854, 104.676, 111.652], ['B', ' SG ', 152.309, 103.214, 110.482], ['B', ' H ', 151.231, 107.161, 112.643], ['B', ' HA ', 153.151, 106.05, 110.646], ['B', ' HB ', 152.412, 104.574, 112.562], ['B', ' HB ', 150.791, 104.577, 111.937]] AA_SCO= 2.3126315789473684 CA_SCO= 1.6891052631578949
[['B', ' N ', 151.653, 106.042, 108.728], ['B', ' CA ', 150.912, 106.226, 107.52], ['B', ' C ', 150.729, 104.942, 106.777], ['B', ' O ', 150.398, 104.948, 105.6], ['B', ' CB ', 151.639, 107.25, 106.689], ['B', ' CG1', 153.031, 106.739, 106.501], ['B', ' CG2', 151.605, 108.575, 107.381], ['B', ' CD1', 153.81, 107.413, 105.533], ['B', ' H ', 152.587, 105.664, 108.678], ['B', ' HA ', 149.931, 106.621, 107.773], ['B', ' HB ', 151.174, 107.336, 105.708], ['B', ' HG1', 153.554, 106.851, 107.442], ['B', ' HG1', 153.003, 105.703, 106.244], ['B', ' HG2', 152.125, 109.305, 106.801], ['B', ' HG2', 150.577, 108.888, 107.499], ['B', ' HG2', 152.071, 108.506, 108.359], ['B', ' HD1', 154.767, 106.979, 105.541], ['B', ' HD1', 153.355, 107.274, 104.579], ['B', ' HD1', 153.905, 108.461, 105.76]] AA_SCO= 2.364736842105263 CA_SCO= 1.7995263157894739
[['B', ' N ', 150.922, 103.83, 107.454], ['B', ' CA ', 150.805, 102.537, 106.794], ['B', ' C ', 151.703, 102.423, 105.549], ['B', ' O ', 151.256, 102.054, 104.474], ['B', ' CB ', 149.339, 102.223, 106.487], ['B', ' CG ', 148.466, 102.094, 107.751], ['B', ' CD ', 147.024, 101.75, 107.41], ['B', ' CE ', 146.124, 101.609, 108.64], ['B', ' NZ ', 146.541, 100.496, 109.52], ['B', ' H ', 151.157, 103.88, 108.438], ['B', ' HA ', 151.142, 101.78, 107.499], ['B', ' HB ', 148.906, 102.985, 105.839], ['B', ' HB ', 149.287, 101.277, 105.944], ['B', ' HG ', 148.862, 101.297, 108.34], ['B', ' HG ', 148.523, 102.993, 108.335], ['B', ' HD ', 146.626, 102.568, 106.825], ['B', ' HD ', 146.985, 100.84, 106.811], ['B', ' HE ', 146.149, 102.527, 109.206], ['B', ' HE ', 145.102, 101.43, 108.306], ['B', ' HZ ', 145.921, 100.439, 110.318], ['B', ' HZ ', 146.516, 99.622, 109.011], ['B', ' HZ ', 147.477, 100.689, 109.829]] AA_SCO= 2.292105263157895 CA_SCO= 1.8000526315789473
[['B', ' N ', 152.974, 102.82, 105.702], ['B', ' CA ', 154.047, 102.759, 104.737], ['B', ' C ', 154.888, 101.624, 105.296], ['B', ' O ', 155.335, 101.67, 106.447], ['B', ' CB ', 154.765, 104.124, 104.675], ['B', ' SG ', 156.138, 104.308, 103.587], ['B', ' H ', 153.234, 103.156, 106.622], ['B', ' HA ', 153.664, 102.496, 103.748], ['B', ' HB ', 154.037, 104.864, 104.346], ['B', ' HB ', 155.102, 104.427, 105.676]] AA_SCO= 2.291052631578948 CA_SCO= 1.808157894736842
[['B', ' N ', 155.134, 100.611, 104.486], ['B', ' CA ', 155.808, 99.409, 104.96], ['B', ' C ', 157.322, 99.49, 105.026], ['B', ' O ', 157.977, 98.501, 105.365], ['B', ' H ', 154.762, 100.632, 103.543], ['B', ' HA ', 155.424, 99.169, 105.953], ['B', ' HA ', 155.525, 98.577, 104.317]] AA_SCO= 2.2947368421052636 CA_SCO= 1.8053684210526313
[['B', ' N ', 157.895, 100.646, 104.75], ['B', ' CA ', 159.338, 100.748, 104.77], ['B', ' C ', 159.928, 100.422, 106.098], ['B', ' O ', 160.954, 99.745, 106.19], ['B', ' CB ', 159.844, 102.104, 104.35], ['B', ' CG1', 159.558, 102.346, 102.898], ['B', ' CG2', 161.356, 102.229, 104.666], ['B', ' CD1', 160.216, 101.393, 101.943], ['B', ' H ', 157.319, 101.44, 104.497], ['B', ' HA ', 159.701, 100.02, 104.089], ['B', ' HB ', 159.297, 102.868, 104.902], ['B', ' HG1', 158.483, 102.331, 102.726], ['B', ' HG1', 159.925, 103.305, 102.668], ['B', ' HG2', 161.728, 103.203, 104.374], ['B', ' HG2', 161.536, 102.116, 105.725], ['B', ' HG2', 161.918, 101.481, 104.14], ['B', ' HD1', 160.005, 101.677, 100.968], ['B', ' HD1', 161.27, 101.425, 102.075], ['B', ' HD1', 159.879, 100.386, 102.066]] AA_SCO= 2.4694736842105267 CA_SCO= 1.7196315789473686
[['B', ' N ', 159.281, 100.844, 107.146], ['B', ' CA ', 159.806, 100.571, 108.451], ['B', ' C ', 159.975, 99.071, 108.716], ['B', ' O ', 160.665, 98.694, 109.657], ['B', ' CB ', 158.913, 101.23, 109.479], ['B', ' SG ', 157.203, 100.699, 109.462], ['B', ' H ', 158.427, 101.379, 107.025], ['B', ' HA ', 160.789, 101.04, 108.519], ['B', ' HB ', 159.317, 100.988, 110.432], ['B', ' HB ', 158.939, 102.31, 109.363], ['B', ' HG ', 157.457, 99.391, 109.456]] AA_SCO= 2.561578947368421 CA_SCO= 1.4183157894736838
[['B', ' N ', 159.329, 98.219, 107.917], ['B', ' CA ', 159.456, 96.788, 108.041], ['B', ' C ', 160.51, 96.258, 107.07], ['B', ' O ', 161.361, 95.444, 107.452], ['B', ' CB ', 158.135, 96.1, 107.767], ['B', ' CG ', 158.244, 94.658, 107.923], ['B', ' CD1', 158.264, 94.132, 109.176], ['B', ' CD2', 158.354, 93.847, 106.82], ['B', ' CE1', 158.386, 92.805, 109.339], ['B', ' CE2', 158.481, 92.508, 106.989], ['B', ' CZ ', 158.494, 91.982, 108.238], ['B', ' OH ', 158.626, 90.629, 108.404], ['B', ' H ', 158.772, 98.577, 107.142], ['B', ' HA ', 159.779, 96.551, 109.05], ['B', ' HB ', 157.372, 96.47, 108.454], ['B', ' HB ', 157.802, 96.316, 106.753], ['B', ' HD1', 158.182, 94.783, 110.048], ['B', ' HD2', 158.346, 94.274, 105.817], ['B', ' HE1', 158.403, 92.404, 110.335], ['B', ' HE2', 158.574, 91.86, 106.129], ['B', ' HH ', 158.865, 90.221, 107.564]] AA_SCO= 2.6078947368421055 CA_SCO= 1.3661578947368418
[['B', ' N ', 160.487, 96.748, 105.811], ['B', ' CA ', 161.388, 96.226, 104.77], ['B', ' C ', 162.805, 96.607, 105.108], ['B', ' O ', 163.724, 96.082, 104.512], ['B', ' CB ', 161.094, 96.734, 103.334], ['B', ' CG1', 161.661, 98.118, 103.097], ['B', ' CG2', 161.651, 95.745, 102.284], ['B', ' H ', 159.763, 97.434, 105.572], ['B', ' HA ', 161.317, 95.138, 104.764], ['B', ' HB ', 160.009, 96.817, 103.232], ['B', ' HG1', 161.383, 98.455, 102.1], ['B', ' HG1', 161.296, 98.776, 103.813], ['B', ' HG1', 162.748, 98.105, 103.162], ['B', ' HG2', 161.401, 96.097, 101.286], ['B', ' HG2', 162.731, 95.656, 102.363], ['B', ' HG2', 161.206, 94.762, 102.439]] AA_SCO= 2.6257894736842107 CA_SCO= 1.2920526315789471
[['B', ' N ', 162.982, 97.594, 105.983], ['B', ' CA ', 164.299, 97.994, 106.449], ['B', ' C ', 164.781, 97.469, 107.831], ['B', ' O ', 165.821, 97.95, 108.27], ['B', ' CB ', 164.458, 99.517, 106.448], ['B', ' CG ', 164.423, 100.179, 105.093], ['B', ' CD ', 165.521, 99.753, 104.197], ['B', ' OE1', 166.472, 99.074, 104.583], ['B', ' NE2', 165.44, 100.181, 102.969], ['B', ' H ', 162.153, 98.083, 106.325], ['B', ' HA ', 164.994, 97.614, 105.724], ['B', ' HB ', 163.654, 99.952, 107.042], ['B', ' HB ', 165.4, 99.792, 106.923], ['B', ' HG ', 163.491, 99.911, 104.622], ['B', ' HG ', 164.485, 101.247, 105.19], ['B', ' HE2', 166.17, 99.934, 102.309], ['B', ' HE2', 164.668, 100.797, 102.688]] AA_SCO= 2.6068421052631585 CA_SCO= 1.2816842105263158
[['B', ' N ', 164.084, 96.515, 108.542], ['B', ' CA ', 164.568, 96.001, 109.859], ['B', ' C ', 165.272, 94.659, 109.475], ['B', ' O ', 164.567, 93.691, 109.161], ['B', ' CB ', 163.424, 95.787, 110.909], ['B', ' SG ', 164.0, 95.71, 112.779], ['B', ' H ', 163.2, 96.144, 108.155], ['B', ' HA ', 165.244, 96.707, 110.306], ['B', ' HB ', 162.643, 96.488, 110.779], ['B', ' HB ', 162.924, 94.828, 110.716]] AA_SCO= 2.5057894736842106 CA_SCO= 1.2821052631578946
[['B', ' N ', 166.627, 94.511, 109.567], ['B', ' CA ', 167.487, 93.428, 109.059], ['B', ' C ', 167.361, 92.086, 109.744], ['B', ' O ', 168.352, 91.479, 110.152], ['B', ' CB ', 168.868, 94.009, 109.312], ['B', ' CG ', 168.687, 94.81, 110.509], ['B', ' CD ', 167.362, 95.461, 110.293], ['B', ' HA ', 167.397, 93.315, 108.005], ['B', ' HB ', 169.62, 93.221, 109.431], ['B', ' HB ', 169.163, 94.62, 108.446], ['B', ' HG ', 168.713, 94.171, 111.406], ['B', ' HG ', 169.499, 95.536, 110.619], ['B', ' HD ', 166.888, 95.678, 111.233], ['B', ' HD ', 167.511, 96.319, 109.651]] AA_SCO= 2.670526315789474 CA_SCO= 1.293263157894737
[['B', ' N ', 166.12, 91.654, 109.865], ['B', ' CA ', 165.656, 90.403, 110.364], ['B', ' C ', 164.735, 89.847, 109.321], ['B', ' O ', 164.6, 88.65, 109.143], ['B', ' CB ', 164.88, 90.624, 111.639], ['B', ' CG ', 165.595, 90.446, 112.93], ['B', ' CD ', 166.749, 91.268, 113.126], ['B', ' NE ', 167.962, 90.574, 112.751], ['B', ' CZ ', 168.606, 89.62, 113.499], ['B', ' NH1', 168.14, 89.226, 114.687], ['B', ' NH2', 169.719, 89.087, 113.033], ['B', ' H ', 165.387, 92.243, 109.502], ['B', ' HA ', 166.491, 89.724, 110.52], ['B', ' HB ', 164.472, 91.637, 111.633], ['B', ' HB ', 164.029, 89.942, 111.654], ['B', ' HG ', 164.904, 90.738, 113.698], ['B', ' HG ', 165.879, 89.403, 113.048], ['B', ' HD ', 166.672, 92.18, 112.538], ['B', ' HD ', 166.82, 91.537, 114.176], ['B', ' HE ', 168.352, 90.821, 111.832], ['B', ' HH1', 167.265, 89.6, 115.075], ['B', ' HH1', 168.65, 88.535, 115.261], ['B', ' HH2', 170.084, 89.38, 112.137], ['B', ' HH2', 170.207, 88.386, 113.57]] AA_SCO= 2.6700000000000004 CA_SCO= 1.2990000000000002
[['B', ' N ', 164.07, 90.755, 108.639], ['B', ' CA ', 162.958, 90.387, 107.763], ['B', ' C ', 163.153, 89.99, 106.302], ['B', ' O ', 162.21, 89.47, 105.705], ['B', ' CB ', 162.007, 91.552, 107.728], ['B', ' OG ', 162.628, 92.648, 107.132], ['B', ' H ', 164.27, 91.753, 108.809], ['B', ' HA ', 162.455, 89.55, 108.249], ['B', ' HB ', 161.129, 91.28, 107.159], ['B', ' HB ', 161.687, 91.809, 108.734], ['B', ' HG ', 162.013, 93.404, 107.205]] AA_SCO= 2.6110526315789473 CA_SCO= 1.324684210526316
[['B', ' N ', 164.289, 90.265, 105.68], ['B', ' CA ', 164.29, 90.115, 104.224], ['B', ' C ', 165.56, 89.819, 103.386], ['B', ' O ', 165.456, 89.29, 102.282], ['B', ' CB ', 163.542, 91.353, 103.709], ['B', ' CG ', 163.545, 91.589, 102.284], ['B', ' CD1', 162.818, 90.982, 101.33], ['B', ' CD2', 164.269, 92.61, 101.633], ['B', ' NE1', 163.086, 91.551, 100.126], ['B', ' CE2', 163.967, 92.546, 100.309], ['B', ' CE3', 165.104, 93.549, 102.058], ['B', ' CZ2', 164.513, 93.409, 99.412], ['B', ' CZ3', 165.661, 94.408, 101.165], ['B', ' CH2', 165.376, 94.327, 99.88], ['B', ' H ', 165.073, 90.637, 106.182], ['B', ' HA ', 163.631, 89.274, 104.021], ['B', ' HB ', 162.496, 91.284, 104.001], ['B', ' HB ', 163.933, 92.234, 104.203], ['B', ' HD1', 162.127, 90.163, 101.499], ['B', ' HE1', 162.69, 91.319, 99.19], ['B', ' HE3', 165.314, 93.618, 103.084], ['B', ' HZ2', 164.275, 93.383, 98.365], ['B', ' HZ3', 166.337, 95.168, 101.53], ['B', ' HH2', 165.829, 95.016, 99.203]] AA_SCO= 2.5294736842105263 CA_SCO= 1.3140526315789476
[['B', ' N ', 166.715, 90.285, 103.817], ['B', ' CA ', 167.84, 90.517, 102.923], ['B', ' C ', 168.731, 89.446, 102.316], ['B', ' O ', 169.179, 88.506, 102.979], ['B', ' CB ', 168.832, 91.418, 103.605], ['B', ' CG ', 168.424, 92.761, 103.669], ['B', ' CD1', 168.863, 93.769, 102.881], ['B', ' CD2', 167.472, 93.322, 104.528], ['B', ' NE1', 168.287, 94.904, 103.241], ['B', ' CE2', 167.42, 94.648, 104.239], ['B', ' CE3', 166.661, 92.817, 105.517], ['B', ' CZ2', 166.626, 95.447, 104.892], ['B', ' CZ3', 165.845, 93.616, 106.116], ['B', ' CH2', 165.828, 94.864, 105.842], ['B', ' H ', 166.783, 90.582, 104.764], ['B', ' HA ', 167.359, 91.094, 102.155], ['B', ' HB ', 168.986, 91.064, 104.616], ['B', ' HB ', 169.797, 91.377, 103.095], ['B', ' HD1', 169.596, 93.678, 102.101], ['B', ' HE1', 168.48, 95.854, 102.855], ['B', ' HE3', 166.67, 91.806, 105.813], ['B', ' HZ2', 166.579, 96.51, 104.672], ['B', ' HZ3', 165.188, 93.212, 106.875], ['B', ' HH2', 165.152, 95.428, 106.375]] AA_SCO= 2.5968421052631583 CA_SCO= 1.2830526315789477
[['B', ' N ', 169.141, 89.698, 101.052], ['B', ' CA ', 170.077, 88.968, 100.248], ['B', ' C ', 171.473, 89.331, 100.668], ['B', ' O ', 172.117, 90.168, 100.025], ['B', ' CB ', 169.797, 89.462, 98.842], ['B', ' CG ', 169.374, 90.867, 99.042], ['B', ' CD ', 168.589, 90.874, 100.297], ['B', ' HA ', 169.902, 87.886, 100.345], ['B', ' HB ', 170.686, 89.344, 98.218], ['B', ' HB ', 169.014, 88.84, 98.383], ['B', ' HG ', 170.257, 91.498, 99.132], ['B', ' HG ', 168.827, 91.24, 98.196], ['B', ' HD ', 168.805, 91.83, 100.776], ['B', ' HD ', 167.515, 90.738, 100.047]] AA_SCO= 2.5277777777777777 CA_SCO= 1.2709444444444447
[['B', ' N ', 171.95, 88.734, 101.732], ['B', ' CA ', 173.272, 89.097, 102.218], ['B', ' C ', 174.319, 88.894, 101.134], ['B', ' O ', 175.315, 89.623, 101.092], ['B', ' CB ', 173.619, 88.31, 103.463], ['B', ' CG ', 172.823, 88.745, 104.652], ['B', ' CD ', 173.09, 87.948, 105.864], ['B', ' OE1', 173.797, 86.953, 105.775], ['B', ' OE2', 172.593, 88.335, 106.904], ['B', ' H ', 171.365, 88.053, 102.231], ['B', ' HA ', 173.263, 90.15, 102.481], ['B', ' HB ', 173.429, 87.251, 103.289], ['B', ' HB ', 174.679, 88.427, 103.69], ['B', ' HG ', 173.084, 89.778, 104.853], ['B', ' HG ', 171.759, 88.705, 104.41]] AA_SCO= 2.502352941176471 CA_SCO= 1.2427647058823528
[['B', ' N ', 174.112, 87.913, 100.262], ['B', ' CA ', 175.042, 87.681, 99.186], ['B', ' C ', 175.085, 88.837, 98.173], ['B', ' O ', 176.132, 89.048, 97.561], ['B', ' CB ', 174.675, 86.373, 98.468], ['B', ' CG ', 173.283, 86.345, 97.755], ['B', ' CD ', 172.123, 86.002, 98.669], ['B', ' OE1', 172.292, 86.074, 99.866], ['B', ' OE2', 171.07, 85.689, 98.173], ['B', ' H ', 173.302, 87.296, 100.362], ['B', ' HA ', 176.036, 87.571, 99.617], ['B', ' HB ', 175.429, 86.157, 97.713], ['B', ' HB ', 174.694, 85.555, 99.187], ['B', ' HG ', 173.074, 87.28, 97.261], ['B', ' HG ', 173.335, 85.585, 96.978]] AA_SCO= 2.5081249999999997 CA_SCO= 1.1991249999999998
[['B', ' N ', 173.987, 89.604, 98.002], ['B', ' CA ', 173.987, 90.723, 97.064], ['B', ' C ', 174.792, 91.832, 97.669], ['B', ' O ', 175.533, 92.541, 96.99], ['B', ' CB ', 172.577, 91.239, 96.789], ['B', ' CG ', 172.472, 92.33, 95.72], ['B', ' CD ', 172.875, 91.851, 94.35], ['B', ' OE1', 172.6, 90.7, 93.991], ['B', ' NE2', 173.497, 92.717, 93.559], ['B', ' H ', 173.143, 89.434, 98.547], ['B', ' HA ', 174.454, 90.41, 96.131], ['B', ' HB ', 171.945, 90.412, 96.478], ['B', ' HB ', 172.161, 91.64, 97.71], ['B', ' HG ', 171.45, 92.663, 95.668], ['B', ' HG ', 173.116, 93.174, 95.988], ['B', ' HE2', 173.765, 92.461, 92.632], ['B', ' HE2', 173.694, 93.678, 93.863]] AA_SCO= 2.5866666666666664 CA_SCO= 1.1667333333333334
[['B', ' N ', 174.647, 91.954, 98.975], ['B', ' CA ', 175.333, 92.995, 99.701], ['B', ' C ', 176.81, 92.755, 99.643], ['B', ' O ', 177.582, 93.689, 99.44], ['B', ' CB ', 174.852, 93.037, 101.142], ['B', ' CG1', 173.424, 93.522, 101.109], ['B', ' CG2', 175.759, 93.925, 101.989], ['B', ' CD1', 172.698, 93.373, 102.347], ['B', ' H ', 173.983, 91.325, 99.439], ['B', ' HA ', 175.118, 93.951, 99.236], ['B', ' HB ', 174.85, 92.037, 101.556], ['B', ' HG1', 173.424, 94.575, 100.845], ['B', ' HG1', 172.881, 92.97, 100.342], ['B', ' HG2', 175.404, 93.946, 103.007], ['B', ' HG2', 176.778, 93.544, 101.992], ['B', ' HG2', 175.755, 94.936, 101.573], ['B', ' HD1', 171.717, 93.753, 102.189], ['B', ' HD1', 172.643, 92.333, 102.632], ['B', ' HD1', 173.177, 93.939, 103.131]] AA_SCO= 2.476428571428571 CA_SCO= 1.1615
[['B', ' N ', 177.225, 91.519, 99.848], ['B', ' CA ', 178.632, 91.23, 99.757], ['B', ' C ', 179.119, 91.405, 98.318], ['B', ' O ', 180.159, 92.014, 98.092], ['B', ' CB ', 178.908, 89.838, 100.3], ['B', ' CG ', 178.731, 89.77, 101.813], ['B', ' CD ', 178.961, 88.382, 102.377], ['B', ' CE ', 178.745, 88.371, 103.902], ['B', ' NZ ', 178.924, 87.015, 104.493], ['B', ' H ', 176.548, 90.785, 100.082], ['B', ' HA ', 179.169, 91.945, 100.379], ['B', ' HB ', 178.218, 89.126, 99.84], ['B', ' HB ', 179.922, 89.534, 100.048], ['B', ' HG ', 179.427, 90.466, 102.281], ['B', ' HG ', 177.717, 90.086, 102.063], ['B', ' HD ', 178.262, 87.683, 101.913], ['B', ' HD ', 179.978, 88.059, 102.158], ['B', ' HE ', 179.459, 89.052, 104.369], ['B', ' HE ', 177.733, 88.716, 104.12], ['B', ' HZ ', 178.772, 87.066, 105.522], ['B', ' HZ ', 178.261, 86.375, 104.09], ['B', ' HZ ', 179.861, 86.685, 104.323]] AA_SCO= 2.5815384615384613 CA_SCO= 1.1032307692307692
[['B', ' N ', 178.327, 90.985, 97.323], ['B', ' CA ', 178.727, 91.118, 95.924], ['B', ' C ', 179.062, 92.564, 95.575], ['B', ' O ', 180.041, 92.833, 94.875], ['B', ' CB ', 177.608, 90.611, 95.008], ['B', ' CG ', 177.919, 90.603, 93.516], ['B', ' CD ', 176.74, 90.01, 92.723], ['B', ' CE ', 177.028, 89.949, 91.225], ['B', ' NZ ', 175.868, 89.387, 90.452], ['B', ' H ', 177.463, 90.478, 97.527], ['B', ' HA ', 179.619, 90.515, 95.762], ['B', ' HB ', 177.335, 89.599, 95.302], ['B', ' HB ', 176.727, 91.233, 95.145], ['B', ' HG ', 178.101, 91.626, 93.177], ['B', ' HG ', 178.816, 90.012, 93.335], ['B', ' HD ', 176.53, 89.002, 93.084], ['B', ' HD ', 175.852, 90.624, 92.891], ['B', ' HE ', 177.247, 90.95, 90.857], ['B', ' HE ', 177.899, 89.314, 91.062], ['B', ' HZ ', 176.092, 89.353, 89.467], ['B', ' HZ ', 175.65, 88.446, 90.778], ['B', ' HZ ', 175.067, 89.987, 90.587]] AA_SCO= 2.5558333333333336 CA_SCO= 1.0344166666666668
[['B', ' N ', 178.27, 93.497, 96.086], ['B', ' CA ', 178.472, 94.923, 95.825], ['B', ' C ', 179.411, 95.698, 96.791], ['B', ' O ', 179.543, 96.917, 96.621], ['B', ' CB ', 177.118, 95.647, 95.816], ['B', ' CG ', 176.172, 95.195, 94.721], ['B', ' CD ', 174.897, 96.013, 94.621], ['B', ' OE1', 174.813, 97.083, 95.185], ['B', ' OE2', 173.976, 95.532, 94.008], ['B', ' H ', 177.442, 93.196, 96.612], ['B', ' HA ', 178.902, 95.006, 94.829], ['B', ' HB ', 176.618, 95.477, 96.775], ['B', ' HB ', 177.273, 96.719, 95.712], ['B', ' HG ', 176.697, 95.243, 93.769], ['B', ' HG ', 175.912, 94.151, 94.903]] AA_SCO= 2.5736363636363637 CA_SCO= 0.9546363636363636
[['B', ' N ', 180.005, 95.034, 97.818], ['B', ' CA ', 180.842, 95.643, 98.876], ['B', ' C ', 182.32, 95.187, 98.771], ['B', ' O ', 182.718, 94.15, 99.315], ['B', ' OXT', 183.156, 95.998, 98.358], ['B', ' CB ', 180.194, 95.308, 100.274], ['B', ' CG ', 180.899, 95.829, 101.648], ['B', ' CD1', 180.867, 97.411, 101.727], ['B', ' CD2', 180.135, 95.185, 102.889], ['B', ' H ', 179.889, 94.016, 97.865], ['B', ' HA ', 180.831, 96.723, 98.756], ['B', ' HB ', 179.159, 95.68, 100.265], ['B', ' HB ', 180.134, 94.212, 100.341], ['B', ' HG ', 181.96, 95.508, 101.664], ['B', ' HD1', 181.352, 97.747, 102.65], ['B', ' HD1', 181.406, 97.838, 100.878], ['B', ' HD1', 179.835, 97.773, 101.715], ['B', ' HD2', 180.602, 95.509, 103.824], ['B', ' HD2', 179.087, 95.492, 102.891], ['B', ' HD2', 180.185, 94.096, 102.832]] AA_SCO= 2.3609999999999998 CA_SCO= 1.0283
[['A', ' N ', 127.544, 122.825, 67.273], ['A', ' CA ', 128.994, 123.016, 67.42], ['A', ' C ', 129.617, 121.873, 68.259], ['A', ' O ', 129.011, 121.45, 69.25], ['A', ' CB ', 129.267, 124.383, 68.057], ['A', ' OG ', 128.845, 125.399, 67.21], ['A', ' H ', 127.098, 123.727, 67.158], ['A', ' H ', 127.352, 122.249, 66.465], ['A', ' H ', 127.181, 122.372, 68.105], ['A', ' HA ', 129.436, 123.02, 66.413], ['A', ' HB ', 128.761, 124.484, 69.023], ['A', ' HB ', 130.323, 124.508, 68.246], ['A', ' HG ', 129.091, 126.253, 67.664]]
[['A', ' N ', 130.795, 121.37, 67.827], ['A', ' CA ', 131.571, 120.307, 68.471], ['A', ' C ', 132.375, 120.817, 69.654], ['A', ' O ', 132.625, 122.024, 69.788], ['A', ' CB ', 132.495, 119.604, 67.466], ['A', ' CG ', 133.727, 120.383, 66.989], ['A', ' CD ', 133.436, 121.33, 65.849], ['A', ' OE1', 132.292, 121.71, 65.676], ['A', ' OE2', 134.352, 121.649, 65.132], ['A', ' H ', 131.204, 121.768, 66.976], ['A', ' HA ', 130.883, 119.548, 68.851], ['A', ' HB ', 132.854, 118.674, 67.906], ['A', ' HB ', 131.918, 119.338, 66.581], ['A', ' HG ', 134.15, 120.949, 67.817], ['A', ' HG ', 134.48, 119.667, 66.669]]
[['A', ' N ', 132.733, 119.889, 70.531], ['A', ' CA ', 133.551, 120.243, 71.657], ['A', ' C ', 134.856, 119.518, 71.576], ['A', ' O ', 134.924, 118.36, 71.162], ['A', ' CB ', 132.883, 119.874, 72.966], ['A', ' CG ', 131.593, 120.562, 73.174], ['A', ' CD ', 131.104, 120.476, 74.566], ['A', ' NE ', 130.777, 119.116, 74.963], ['A', ' CZ ', 130.241, 118.767, 76.159], ['A', ' NH1', 129.967, 119.68, 77.076], ['A', ' NH2', 129.97, 117.5, 76.41], ['A', ' H ', 132.468, 118.925, 70.383], ['A', ' HA ', 133.743, 121.312, 71.635], ['A', ' HB ', 132.72, 118.8, 73.009], ['A', ' HB ', 133.542, 120.143, 73.796], ['A', ' HG ', 131.708, 121.592, 72.881], ['A', ' HG ', 130.844, 120.101, 72.533], ['A', ' HD ', 131.871, 120.858, 75.233], ['A', ' HD ', 130.206, 121.089, 74.66], ['A', ' HE ', 130.955, 118.376, 74.297], ['A', ' HH1', 130.155, 120.654, 76.907], ['A', ' HH1', 129.514, 119.399, 77.971], ['A', ' HH2', 130.164, 116.792, 75.719], ['A', ' HH2', 129.553, 117.24, 77.303]]
[['A', ' N ', 135.881, 120.19, 72.019], ['A', ' CA ', 137.185, 119.614, 72.084], ['A', ' C ', 137.364, 119.197, 73.511], ['A', ' O ', 137.375, 120.035, 74.413], ['A', ' CB ', 138.248, 120.66, 71.717], ['A', ' CG1', 137.916, 121.32, 70.348], ['A', ' CG2', 139.654, 120.052, 71.752], ['A', ' CD1', 137.797, 120.398, 69.16], ['A', ' H ', 135.723, 121.146, 72.33], ['A', ' HA ', 137.251, 118.736, 71.445], ['A', ' HB ', 138.204, 121.449, 72.441], ['A', ' HG1', 136.976, 121.855, 70.45], ['A', ' HG1', 138.69, 122.039, 70.13], ['A', ' HG2', 140.387, 120.824, 71.522], ['A', ' HG2', 139.857, 119.655, 72.745], ['A', ' HG2', 139.738, 119.251, 71.026], ['A', ' HD1', 137.565, 120.99, 68.275], ['A', ' HD1', 138.734, 119.872, 68.998], ['A', ' HD1', 136.997, 119.678, 69.322]]
[['A', ' N ', 137.46, 117.908, 73.743], ['A', ' CA ', 137.566, 117.456, 75.108], ['A', ' C ', 138.841, 116.702, 75.312], ['A', ' O ', 139.079, 115.675, 74.676], ['A', ' CB ', 136.363, 116.589, 75.468], ['A', ' CG1', 136.505, 116.092, 76.898], ['A', ' CG2', 135.096, 117.431, 75.291], ['A', ' H ', 137.453, 117.251, 72.972], ['A', ' HA ', 137.574, 118.315, 75.773], ['A', ' HB ', 136.32, 115.719, 74.816], ['A', ' HG1', 135.644, 115.482, 77.165], ['A', ' HG1', 137.405, 115.491, 77.011], ['A', ' HG1', 136.562, 116.937, 77.572], ['A', ' HG2', 134.222, 116.839, 75.548], ['A', ' HG2', 135.164, 118.282, 75.941], ['A', ' HG2', 135.009, 117.767, 74.261]]
[['A', ' N ', 139.65, 117.202, 76.219], ['A', ' CA ', 140.914, 116.571, 76.476], ['A', ' C ', 140.932, 116.02, 77.896], ['A', ' O ', 141.005, 116.783, 78.859], ['A', ' CB ', 142.036, 117.603, 76.288], ['A', ' CG1', 141.951, 118.21, 74.854], ['A', ' CG2', 143.374, 116.905, 76.485], ['A', ' CD1', 142.826, 119.429, 74.617], ['A', ' H ', 139.36, 118.057, 76.706], ['A', ' HA ', 141.059, 115.748, 75.781], ['A', ' HB ', 141.925, 118.407, 77.01], ['A', ' HG1', 142.222, 117.439, 74.134], ['A', ' HG1', 140.931, 118.516, 74.661], ['A', ' HG2', 144.195, 117.599, 76.371], ['A', ' HG2', 143.407, 116.494, 77.466], ['A', ' HG2', 143.482, 116.103, 75.756], ['A', ' HD1', 142.685, 119.783, 73.592], ['A', ' HD1', 142.539, 120.219, 75.311], ['A', ' HD1', 143.871, 119.184, 74.763]]
[['A', ' N ', 140.85, 114.693, 78.0], ['A', ' CA ', 140.862, 113.947, 79.265], ['A', ' C ', 142.196, 114.029, 80.048], ['A', ' O ', 142.173, 114.069, 81.275], ['A', ' CB ', 140.426, 112.512, 79.035], ['A', ' OG ', 140.479, 111.778, 80.218], ['A', ' H ', 140.768, 114.171, 77.138], ['A', ' HA ', 140.098, 114.392, 79.905], ['A', ' HB ', 139.396, 112.525, 78.679], ['A', ' HB ', 141.003, 112.027, 78.274], ['A', ' HG ', 140.159, 110.905, 80.001]]
[['A', ' N ', 143.373, 113.834, 79.412], ['A', ' CA ', 144.68, 113.981, 80.009], ['A', ' C ', 144.985, 115.456, 80.201], ['A', ' O ', 144.4, 116.3, 79.542], ['A', ' CB ', 145.575, 113.3, 78.998], ['A', ' CG ', 144.863, 113.435, 77.719], ['A', ' CD ', 143.447, 113.346, 78.018], ['A', ' HA ', 144.698, 113.457, 80.976], ['A', ' HB ', 146.543, 113.808, 78.971], ['A', ' HB ', 145.752, 112.253, 79.286], ['A', ' HG ', 145.132, 114.371, 77.219], ['A', ' HG ', 145.133, 112.623, 77.075], ['A', ' HD ', 143.022, 113.986, 77.283], ['A', ' HD ', 143.137, 112.308, 77.926]]
[['A', ' N ', 145.943, 115.772, 81.051], ['A', ' CA ', 146.312, 117.158, 81.303], ['A', ' C ', 147.663, 117.529, 80.738], ['A', ' O ', 148.175, 118.611, 81.025], ['A', ' CB ', 146.396, 117.406, 82.801], ['A', ' OG1', 147.417, 116.598, 83.36], ['A', ' CG2', 145.152, 116.996, 83.393], ['A', ' H ', 146.423, 115.06, 81.582], ['A', ' HA ', 145.557, 117.81, 80.862], ['A', ' HB ', 146.583, 118.454, 83.014], ['A', ' HG1', 147.573, 116.88, 84.281], ['A', ' HG2', 145.202, 117.138, 84.456], ['A', ' HG2', 144.364, 117.601, 82.962], ['A', ' HG2', 144.959, 115.952, 83.193]]
[['A', ' N ', 148.246, 116.635, 79.955], ['A', ' CA ', 149.615, 116.788, 79.482], ['A', ' C ', 150.556, 116.818, 80.658], ['A', ' O ', 150.334, 116.137, 81.66], ['A', ' CB ', 149.801, 118.052, 78.662], ['A', ' OG ', 151.104, 118.118, 78.149], ['A', ' H ', 147.721, 115.808, 79.72], ['A', ' HA ', 149.869, 115.932, 78.854], ['A', ' HB ', 149.089, 118.043, 77.838], ['A', ' HB ', 149.614, 118.941, 79.239], ['A', ' HG ', 151.024, 118.578, 77.29]]
[['A', ' N ', 151.6, 117.621, 80.572], ['A', ' CA ', 152.624, 117.619, 81.606], ['A', ' C ', 152.262, 118.553, 82.748], ['A', ' O ', 152.908, 119.578, 82.973], ['A', ' CB ', 153.928, 117.992, 80.956], ['A', ' CG ', 154.36, 116.971, 79.923], ['A', ' CD ', 155.688, 117.247, 79.413], ['A', ' NE ', 155.722, 118.528, 78.822], ['A', ' CZ ', 155.387, 118.859, 77.566], ['A', ' NH1', 155.016, 117.971, 76.697], ['A', ' NH2', 155.428, 120.107, 77.222], ['A', ' H ', 151.702, 118.18, 79.732], ['A', ' HA ', 152.717, 116.611, 82.004], ['A', ' HB ', 153.836, 118.963, 80.473], ['A', ' HB ', 154.712, 118.062, 81.677], ['A', ' HG ', 154.358, 115.99, 80.389], ['A', ' HG ', 153.658, 116.968, 79.09], ['A', ' HD ', 156.41, 117.228, 80.235], ['A', ' HD ', 155.961, 116.518, 78.668], ['A', ' HE ', 156.006, 119.281, 79.435], ['A', ' HH1', 154.982, 117.009, 76.958], ['A', ' HH1', 154.743, 118.278, 75.768], ['A', ' HH2', 155.698, 120.814, 77.9], ['A', ' HH2', 155.157, 120.418, 76.272]]
[['A', ' N ', 151.197, 118.158, 83.447], ['A', ' CA ', 150.547, 118.839, 84.57], ['A', ' C ', 150.035, 117.86, 85.59], ['A', ' O ', 148.861, 117.865, 85.952], ['A', ' CB ', 149.406, 119.708, 84.054], ['A', ' CG ', 149.87, 120.838, 83.225], ['A', ' CD ', 150.521, 121.806, 84.124], ['A', ' OE1', 149.79, 122.511, 84.748], ['A', ' NE2', 151.827, 121.811, 84.267], ['A', ' H ', 150.784, 117.282, 83.105], ['A', ' HA ', 151.282, 119.447, 85.084], ['A', ' HB ', 148.751, 119.106, 83.452], ['A', ' HB ', 148.832, 120.106, 84.89], ['A', ' HG ', 150.544, 120.537, 82.446], ['A', ' HG ', 148.997, 121.315, 82.782], ['A', ' HE2', 152.274, 122.442, 84.965], ['A', ' HE2', 152.378, 121.123, 83.75]]
[['A', ' N ', 150.915, 116.979, 86.015], ['A', ' CA ', 150.662, 115.918, 86.99], ['A', ' C ', 149.69, 114.881, 86.431], ['A', ' O ', 150.085, 113.757, 86.111], ['A', ' CB ', 150.112, 116.465, 88.311], ['A', ' CG ', 151.026, 117.444, 88.993], ['A', ' CD ', 152.363, 116.899, 89.224], ['A', ' OE1', 152.484, 115.725, 89.473], ['A', ' OE2', 153.295, 117.653, 89.103], ['A', ' H ', 151.854, 117.052, 85.648], ['A', ' HA ', 151.602, 115.41, 87.198], ['A', ' HB ', 149.145, 116.933, 88.181], ['A', ' HB ', 149.967, 115.636, 88.999], ['A', ' HG ', 151.103, 118.34, 88.38], ['A', ' HG ', 150.58, 117.73, 89.948]]
[['A', ' N ', 148.427, 115.285, 86.275], ['A', ' CA ', 147.379, 114.443, 85.72], ['A', ' C ', 145.977, 114.727, 86.251], ['A', ' O ', 145.758, 115.631, 87.048], ['A', ' H ', 148.224, 116.242, 86.548], ['A', ' HA ', 147.382, 114.537, 84.637], ['A', ' HA ', 147.63, 113.405, 85.921]]
[['A', ' N ', 145.039, 113.91, 85.794], ['A', ' CA ', 143.634, 113.913, 86.194], ['A', ' C ', 142.751, 115.152, 86.093], ['A', ' O ', 142.112, 115.524, 87.082], ['A', ' CB ', 143.538, 113.45, 87.62], ['A', ' CG ', 144.132, 112.125, 87.879], ['A', ' ND1', 144.247, 111.617, 89.143], ['A', ' CD2', 144.642, 111.181, 87.052], ['A', ' CE1', 144.793, 110.433, 89.088], ['A', ' NE2', 145.044, 110.149, 87.834], ['A', ' H ', 145.328, 113.212, 85.125], ['A', ' HA ', 143.131, 113.162, 85.585], ['A', ' HB ', 143.983, 114.178, 88.256], ['A', ' HB ', 142.5, 113.389, 87.878], ['A', ' HD2', 144.722, 111.214, 85.97], ['A', ' HE1', 145.003, 109.802, 89.937], ['A', ' HE2', 145.479, 109.276, 87.506]]
[['A', ' N ', 142.695, 115.797, 84.955], ['A', ' CA ', 141.767, 116.909, 84.801], ['A', ' C ', 141.348, 116.987, 83.38], ['A', ' O ', 142.086, 116.62, 82.48], ['A', ' CB ', 142.336, 118.217, 85.249], ['A', ' H ', 143.255, 115.486, 84.172], ['A', ' HA ', 140.883, 116.695, 85.386], ['A', ' HB ', 141.588, 118.999, 85.125], ['A', ' HB ', 142.609, 118.136, 86.286], ['A', ' HB ', 143.177, 118.46, 84.668]]
[['A', ' N ', 140.167, 117.495, 83.173], ['A', ' CA ', 139.634, 117.569, 81.845], ['A', ' C ', 139.301, 118.965, 81.388], ['A', ' O ', 138.692, 119.769, 82.102], ['A', ' CB ', 138.402, 116.68, 81.776], ['A', ' CG ', 137.705, 116.641, 80.445], ['A', ' CD ', 136.531, 115.722, 80.445], ['A', ' OE1', 136.629, 114.658, 80.996], ['A', ' OE2', 135.512, 116.096, 79.919], ['A', ' H ', 139.627, 117.83, 83.974], ['A', ' HA ', 140.379, 117.167, 81.161], ['A', ' HB ', 138.69, 115.659, 82.023], ['A', ' HB ', 137.704, 117.0, 82.525], ['A', ' HG ', 137.364, 117.633, 80.191], ['A', ' HG ', 138.413, 116.326, 79.68]]
[['A', ' N ', 139.777, 119.268, 80.192], ['A', ' CA ', 139.517, 120.553, 79.569], ['A', ' C ', 138.471, 120.419, 78.485], ['A', ' O ', 138.634, 119.655, 77.53], ['A', ' CB ', 140.831, 121.148, 79.015], ['A', ' CG ', 140.731, 122.484, 78.229], ['A', ' CD1', 140.214, 123.609, 79.126], ['A', ' CD2', 142.129, 122.871, 77.676], ['A', ' H ', 140.314, 118.536, 79.705], ['A', ' HA ', 139.102, 121.219, 80.316], ['A', ' HB ', 141.52, 121.293, 79.834], ['A', ' HB ', 141.27, 120.413, 78.342], ['A', ' HG ', 140.044, 122.354, 77.413], ['A', ' HD1', 140.145, 124.528, 78.548], ['A', ' HD1', 139.227, 123.369, 79.508], ['A', ' HD1', 140.891, 123.759, 79.957], ['A', ' HD2', 142.05, 123.795, 77.116], ['A', ' HD2', 142.826, 123.015, 78.487], ['A', ' HD2', 142.501, 122.086, 77.022]]
[['A', ' N ', 137.371, 121.143, 78.645], ['A', ' CA ', 136.274, 121.09, 77.698], ['A', ' C ', 136.099, 122.419, 76.999], ['A', ' O ', 135.774, 123.439, 77.62], ['A', ' CB ', 134.969, 120.743, 78.435], ['A', ' CG1', 133.779, 120.716, 77.467], ['A', ' CG2', 135.14, 119.415, 79.108], ['A', ' H ', 137.294, 121.764, 79.457], ['A', ' HA ', 136.487, 120.328, 76.947], ['A', ' HB ', 134.769, 121.508, 79.189], ['A', ' HG1', 132.872, 120.473, 78.019], ['A', ' HG1', 133.657, 121.693, 76.997], ['A', ' HG1', 133.938, 119.973, 76.702], ['A', ' HG2', 134.238, 119.152, 79.648], ['A', ' HG2', 135.34, 118.658, 78.369], ['A', ' HG2', 135.969, 119.46, 79.803]]
[['A', ' N ', 136.269, 122.419, 75.689], ['A', ' CA ', 136.142, 123.663, 74.964], ['A', ' C ', 135.119, 123.6, 73.854], ['A', ' O ', 135.12, 122.698, 73.018], ['A', ' CB ', 137.494, 124.016, 74.4], ['A', ' CG ', 138.545, 124.248, 75.448], ['A', ' SD ', 140.177, 124.512, 74.77], ['A', ' CE ', 140.687, 122.861, 74.289], ['A', ' H ', 136.556, 121.554, 75.218], ['A', ' HA ', 135.822, 124.447, 75.649], ['A', ' HB ', 137.82, 123.228, 73.757], ['A', ' HB ', 137.397, 124.889, 73.811], ['A', ' HG ', 138.266, 125.107, 76.053], ['A', ' HG ', 138.585, 123.39, 76.092], ['A', ' HE ', 141.689, 122.901, 73.852], ['A', ' HE ', 140.697, 122.206, 75.152], ['A', ' HE ', 140.005, 122.461, 73.559]]
[['A', ' N ', 134.278, 124.604, 73.798], ['A', ' CA ', 133.272, 124.684, 72.762], ['A', ' C ', 133.793, 125.602, 71.686], ['A', ' O ', 134.034, 126.793, 71.94], ['A', ' CB ', 131.959, 125.218, 73.321], ['A', ' CG ', 131.364, 124.362, 74.423], ['A', ' CD ', 130.011, 124.808, 74.884], ['A', ' OE1', 129.484, 125.744, 74.336], ['A', ' OE2', 129.503, 124.211, 75.803], ['A', ' H ', 134.322, 125.327, 74.517], ['A', ' HA ', 133.107, 123.698, 72.327], ['A', ' HB ', 132.123, 126.213, 73.701], ['A', ' HB ', 131.227, 125.292, 72.516], ['A', ' HG ', 131.291, 123.365, 74.079], ['A', ' HG ', 132.05, 124.373, 75.272]]
[['A', ' N ', 133.925, 125.065, 70.48], ['A', ' CA ', 134.47, 125.833, 69.371], ['A', ' C ', 133.393, 126.071, 68.33], ['A', ' O ', 132.605, 125.179, 68.039], ['A', ' CB ', 135.687, 125.109, 68.757], ['A', ' CG1', 136.814, 125.063, 69.766], ['A', ' CG2', 135.32, 123.674, 68.345], ['A', ' H ', 133.632, 124.088, 70.339], ['A', ' HA ', 134.798, 126.799, 69.743], ['A', ' HB ', 136.032, 125.67, 67.882], ['A', ' HG1', 137.67, 124.568, 69.317], ['A', ' HG1', 137.086, 126.067, 70.032], ['A', ' HG1', 136.499, 124.515, 70.657], ['A', ' HG2', 136.191, 123.189, 67.913], ['A', ' HG2', 134.989, 123.104, 69.211], ['A', ' HG2', 134.521, 123.681, 67.601]]
[['A', ' N ', 133.327, 127.292, 67.81], ['A', ' CA ', 132.289, 127.626, 66.824], ['A', ' C ', 132.829, 127.912, 65.431], ['A', ' O ', 133.462, 128.948, 65.21], ['A', ' CB ', 131.448, 128.84, 67.258], ['A', ' CG ', 130.488, 128.62, 68.481], ['A', ' OD1', 129.742, 127.656, 68.504], ['A', ' OD2', 130.476, 129.474, 69.352], ['A', ' H ', 134.064, 127.95, 68.088], ['A', ' HA ', 131.616, 126.773, 66.741], ['A', ' HB ', 132.12, 129.662, 67.495], ['A', ' HB ', 130.842, 129.163, 66.409]]
[['A', ' N ', 132.578, 126.991, 64.486], ['A', ' CA ', 133.016, 127.036, 63.069], ['A', ' C ', 134.529, 126.967, 62.877], ['A', ' O ', 135.053, 126.077, 62.207], ['A', ' CB ', 132.469, 128.276, 62.366], ['A', ' CG ', 130.966, 128.22, 62.196], ['A', ' OD1', 130.396, 127.16, 62.358], ['A', ' OD2', 130.393, 129.238, 61.901], ['A', ' H ', 132.029, 126.187, 64.762], ['A', ' HA ', 132.589, 126.167, 62.568], ['A', ' HB ', 132.733, 129.179, 62.906], ['A', ' HB ', 132.928, 128.354, 61.379]]
[['A', ' N ', 135.204, 127.924, 63.471], ['A', ' CA ', 136.633, 128.061, 63.509], ['A', ' C ', 137.096, 127.209, 64.658], ['A', ' O ', 136.29, 126.565, 65.322], ['A', ' CB ', 137.036, 129.519, 63.736], ['A', ' CG ', 136.683, 130.439, 62.603], ['A', ' CD ', 137.477, 130.138, 61.387], ['A', ' OE1', 138.62, 129.775, 61.53], ['A', ' OE2', 136.952, 130.26, 60.311], ['A', ' H ', 134.658, 128.608, 63.98], ['A', ' HA ', 137.069, 127.689, 62.58], ['A', ' HB ', 136.534, 129.892, 64.631], ['A', ' HB ', 138.107, 129.59, 63.909], ['A', ' HG ', 135.623, 130.327, 62.373], ['A', ' HG ', 136.859, 131.47, 62.908]]
[['A', ' N ', 138.392, 127.16, 64.895], ['A', ' CA ', 138.888, 126.355, 65.998], ['A', ' C ', 138.883, 127.165, 67.286], ['A', ' O ', 139.371, 126.711, 68.316], ['A', ' H ', 139.037, 127.68, 64.311], ['A', ' HA ', 138.258, 125.472, 66.117], ['A', ' HA ', 139.887, 126.002, 65.778]]
[['A', ' N ', 138.351, 128.376, 67.208], ['A', ' CA ', 138.3, 129.32, 68.299], ['A', ' C ', 137.274, 128.919, 69.312], ['A', ' O ', 136.106, 128.661, 68.992], ['A', ' CB ', 138.011, 130.716, 67.761], ['A', ' CG1', 139.186, 131.117, 66.845], ['A', ' CG2', 137.853, 131.702, 68.936], ['A', ' CD1', 138.941, 132.333, 66.001], ['A', ' H ', 137.96, 128.655, 66.322], ['A', ' HA ', 139.247, 129.346, 68.804], ['A', ' HB ', 137.102, 130.705, 67.16], ['A', ' HG1', 140.059, 131.304, 67.469], ['A', ' HG1', 139.413, 130.293, 66.176], ['A', ' HG2', 137.665, 132.702, 68.57], ['A', ' HG2', 137.022, 131.414, 69.577], ['A', ' HG2', 138.766, 131.7, 69.515], ['A', ' HD1', 139.824, 132.529, 65.393], ['A', ' HD1', 138.086, 132.158, 65.346], ['A', ' HD1', 138.744, 133.197, 66.624]]
[['A', ' N ', 137.732, 128.899, 70.551], ['A', ' CA ', 136.928, 128.545, 71.69], ['A', ' C ', 136.091, 129.726, 72.069], ['A', ' O ', 136.604, 130.821, 72.284], ['A', ' CB ', 137.842, 128.181, 72.862], ['A', ' CG1', 137.032, 127.86, 74.116], ['A', ' CG2', 138.708, 127.053, 72.451], ['A', ' H ', 138.719, 129.136, 70.697], ['A', ' HA ', 136.281, 127.71, 71.439], ['A', ' HB ', 138.479, 129.035, 73.096], ['A', ' HG1', 137.708, 127.616, 74.933], ['A', ' HG1', 136.427, 128.71, 74.408], ['A', ' HG1', 136.378, 127.011, 73.921], ['A', ' HG2', 139.377, 126.82, 73.262], ['A', ' HG2', 138.105, 126.199, 72.208], ['A', ' HG2', 139.288, 127.337, 71.58]]
[['A', ' N ', 134.802, 129.524, 72.176], ['A', ' CA ', 133.941, 130.626, 72.544], ['A', ' C ', 133.454, 130.439, 73.956], ['A', ' O ', 133.094, 131.401, 74.63], ['A', ' CB ', 132.784, 130.749, 71.559], ['A', ' OG1', 132.024, 129.537, 71.575], ['A', ' CG2', 133.356, 130.986, 70.16], ['A', ' H ', 134.421, 128.592, 71.992], ['A', ' HA ', 134.51, 131.552, 72.508], ['A', ' HB ', 132.142, 131.58, 71.842], ['A', ' HG1', 131.281, 129.603, 70.917], ['A', ' HG2', 132.536, 131.073, 69.452], ['A', ' HG2', 133.94, 131.903, 70.157], ['A', ' HG2', 133.992, 130.151, 69.871]]
[['A', ' N ', 133.496, 129.2, 74.414], ['A', ' CA ', 133.125, 128.873, 75.78], ['A', ' C ', 133.994, 127.742, 76.294], ['A', ' O ', 134.317, 126.829, 75.537], ['A', ' CB ', 131.649, 128.495, 75.87], ['A', ' CG ', 131.133, 128.183, 77.271], ['A', ' CD ', 129.645, 127.901, 77.225], ['A', ' CE ', 129.082, 127.536, 78.584], ['A', ' NZ ', 127.632, 127.205, 78.499], ['A', ' H ', 133.735, 128.458, 73.751], ['A', ' HA ', 133.286, 129.743, 76.405], ['A', ' HB ', 131.049, 129.308, 75.466], ['A', ' HB ', 131.456, 127.627, 75.264], ['A', ' HG ', 131.624, 127.291, 77.66], ['A', ' HG ', 131.337, 129.021, 77.939], ['A', ' HD ', 129.122, 128.78, 76.849], ['A', ' HD ', 129.457, 127.076, 76.544], ['A', ' HE ', 129.618, 126.673, 78.981], ['A', ' HE ', 129.213, 128.377, 79.264], ['A', ' HZ ', 127.268, 126.956, 79.429], ['A', ' HZ ', 127.117, 127.984, 78.148], ['A', ' HZ ', 127.484, 126.41, 77.896]]
[['A', ' N ', 134.3, 127.725, 77.581], ['A', ' CA ', 134.978, 126.537, 78.085], ['A', ' C ', 134.98, 126.39, 79.598], ['A', ' O ', 134.708, 127.32, 80.368], ['A', ' H ', 134.11, 128.551, 78.161], ['A', ' HA ', 134.507, 125.655, 77.652], ['A', ' HA ', 136.008, 126.538, 77.728]]
[['A', ' N ', 135.281, 125.166, 80.008], ['A', ' CA ', 135.342, 124.762, 81.398], ['A', ' C ', 136.482, 123.814, 81.665], ['A', ' O ', 136.899, 123.039, 80.805], ['A', ' CB ', 134.051, 124.099, 81.864], ['A', ' CG ', 132.775, 124.976, 81.922], ['A', ' CD ', 132.871, 126.0, 83.037], ['A', ' NE ', 131.651, 126.77, 83.236], ['A', ' CZ ', 131.307, 127.879, 82.55], ['A', ' NH1', 132.071, 128.352, 81.57], ['A', ' NH2', 130.185, 128.504, 82.873], ['A', ' H ', 135.483, 124.473, 79.277], ['A', ' HA ', 135.503, 125.651, 82.0], ['A', ' HB ', 133.827, 123.273, 81.191], ['A', ' HB ', 134.205, 123.668, 82.849], ['A', ' HG ', 132.642, 125.497, 80.98], ['A', ' HG ', 131.906, 124.347, 82.104], ['A', ' HD ', 133.101, 125.511, 83.963], ['A', ' HD ', 133.666, 126.701, 82.817], ['A', ' HE ', 131.02, 126.477, 84.02], ['A', ' HH1', 132.959, 127.89, 81.294], ['A', ' HH1', 131.799, 129.188, 81.076], ['A', ' HH2', 129.608, 128.141, 83.626], ['A', ' HH2', 129.906, 129.338, 82.384]]
[['A', ' N ', 136.98, 123.863, 82.874], ['A', ' CA ', 138.054, 122.993, 83.266], ['A', ' C ', 137.759, 122.492, 84.644], ['A', ' O ', 137.262, 123.24, 85.488], ['A', ' CB ', 139.358, 123.756, 83.2], ['A', ' CG ', 140.523, 123.009, 83.539], ['A', ' CD1', 140.977, 122.118, 82.66], ['A', ' CD2', 141.167, 123.225, 84.677], ['A', ' CE1', 142.068, 121.418, 82.892], ['A', ' CE2', 142.287, 122.528, 84.922], ['A', ' CZ ', 142.734, 121.627, 84.02], ['A', ' OH ', 143.854, 120.942, 84.232], ['A', ' H ', 136.606, 124.511, 83.554], ['A', ' HA ', 138.092, 122.133, 82.599], ['A', ' HB ', 139.498, 124.114, 82.19], ['A', ' HB ', 139.308, 124.621, 83.86], ['A', ' HD1', 140.446, 121.976, 81.761], ['A', ' HD2', 140.798, 123.962, 85.387], ['A', ' HE1', 142.421, 120.693, 82.161], ['A', ' HE2', 142.819, 122.701, 85.827], ['A', ' HH ', 144.236, 121.216, 85.063]]
[['A', ' N ', 137.974, 121.211, 84.854], ['A', ' CA ', 137.724, 120.629, 86.153], ['A', ' C ', 138.592, 119.429, 86.416], ['A', ' O ', 139.048, 118.774, 85.479], ['A', ' CB ', 136.257, 120.271, 86.213], ['A', ' CG ', 135.854, 119.308, 85.159], ['A', ' CD1', 135.748, 117.964, 85.408], ['A', ' CD2', 135.593, 119.759, 83.874], ['A', ' CE1', 135.36, 117.107, 84.413], ['A', ' CE2', 135.234, 118.898, 82.901], ['A', ' CZ ', 135.106, 117.573, 83.17], ['A', ' H ', 138.307, 120.622, 84.08], ['A', ' HA ', 137.935, 121.37, 86.912], ['A', ' HB ', 136.036, 119.83, 87.178], ['A', ' HB ', 135.649, 121.164, 86.114], ['A', ' HD1', 135.961, 117.582, 86.397], ['A', ' HD2', 135.668, 120.818, 83.639], ['A', ' HE1', 135.257, 116.048, 84.608], ['A', ' HE2', 135.034, 119.265, 81.907], ['A', ' HZ ', 134.802, 116.884, 82.377]]
[['A', ' N ', 138.793, 119.097, 87.689], ['A', ' CA ', 139.557, 117.906, 87.994], ['A', ' C ', 138.678, 116.687, 87.925], ['A', ' O ', 137.479, 116.758, 88.216], ['A', ' CB ', 140.187, 118.016, 89.356], ['A', ' OG ', 139.214, 118.036, 90.355], ['A', ' H ', 138.418, 119.659, 88.442], ['A', ' HA ', 140.352, 117.802, 87.268], ['A', ' HB ', 140.866, 117.176, 89.513], ['A', ' HB ', 140.785, 118.926, 89.408], ['A', ' HG ', 139.703, 118.114, 91.182]]
[['A', ' N ', 139.286, 115.544, 87.617], ['A', ' CA ', 138.582, 114.267, 87.609], ['A', ' C ', 139.297, 113.27, 88.499], ['A', ' O ', 139.099, 112.065, 88.376], ['A', ' CB ', 138.421, 113.711, 86.181], ['A', ' CG1', 139.785, 113.488, 85.528], ['A', ' CG2', 137.592, 114.699, 85.375], ['A', ' CD1', 139.776, 112.716, 84.222], ['A', ' H ', 140.285, 115.559, 87.393], ['A', ' HA ', 137.584, 114.419, 88.021], ['A', ' HB ', 137.903, 112.751, 86.222], ['A', ' HG1', 140.21, 114.443, 85.325], ['A', ' HG1', 140.425, 112.949, 86.221], ['A', ' HG2', 137.421, 114.336, 84.364], ['A', ' HG2', 136.637, 114.818, 85.879], ['A', ' HG2', 138.098, 115.664, 85.321], ['A', ' HD1', 140.8, 112.628, 83.848], ['A', ' HD1', 139.365, 111.719, 84.388], ['A', ' HD1', 139.18, 113.228, 83.474]]
[['A', ' N ', 140.17, 113.787, 89.34], ['A', ' CA ', 140.976, 113.008, 90.264], ['A', ' C ', 140.065, 112.33, 91.247], ['A', ' O ', 139.057, 112.922, 91.592], ['A', ' CB ', 141.944, 113.95, 91.015], ['A', ' OG1', 142.844, 113.179, 91.825], ['A', ' CG2', 141.167, 114.928, 91.925], ['A', ' H ', 140.258, 114.792, 89.341], ['A', ' HA ', 141.532, 112.265, 89.7], ['A', ' HB ', 142.497, 114.523, 90.289], ['A', ' HG1', 143.608, 113.719, 92.141], ['A', ' HG2', 141.883, 115.588, 92.419], ['A', ' HG2', 140.481, 115.522, 91.331], ['A', ' HG2', 140.609, 114.391, 92.686]]
[['A', ' N ', 140.335, 111.126, 91.733], ['A', ' CA ', 139.519, 110.508, 92.728], ['A', ' C ', 139.642, 111.335, 93.965], ['A', ' O ', 140.708, 111.881, 94.238], ['A', ' CB ', 140.145, 109.137, 92.895], ['A', ' CG ', 141.563, 109.313, 92.416], ['A', ' CD ', 141.467, 110.33, 91.294], ['A', ' HA ', 138.485, 110.457, 92.366], ['A', ' HB ', 140.077, 108.833, 93.947], ['A', ' HB ', 139.581, 108.403, 92.304], ['A', ' HG ', 142.205, 109.661, 93.24], ['A', ' HG ', 141.982, 108.349, 92.08], ['A', ' HD ', 142.395, 110.899, 91.262], ['A', ' HD ', 141.24, 109.836, 90.33]]
[['A', ' N ', 138.601, 111.392, 94.749], ['A', ' CA ', 138.692, 112.159, 95.958], ['A', ' C ', 139.429, 111.382, 97.002], ['A', ' O ', 139.009, 110.306, 97.402], ['A', ' CB ', 137.296, 112.514, 96.429], ['A', ' CG1', 137.311, 113.218, 97.709], ['A', ' CG2', 136.679, 113.372, 95.428], ['A', ' H ', 137.743, 110.915, 94.492], ['A', ' HA ', 139.236, 113.082, 95.744], ['A', ' HB ', 136.715, 111.614, 96.55], ['A', ' HG1', 136.277, 113.459, 97.983], ['A', ' HG1', 137.746, 112.594, 98.481], ['A', ' HG1', 137.882, 114.134, 97.598], ['A', ' HG2', 135.699, 113.585, 95.791], ['A', ' HG2', 137.24, 114.302, 95.308], ['A', ' HG2', 136.621, 112.869, 94.469]]
[['A', ' N ', 140.492, 111.993, 97.482], ['A', ' CA ', 141.419, 111.426, 98.444], ['A', ' C ', 140.84, 111.353, 99.838], ['A', ' O ', 141.168, 110.464, 100.612], ['A', ' CB ', 142.614, 112.326, 98.463], ['A', ' CG ', 143.381, 112.375, 97.154], ['A', ' CD ', 144.253, 111.226, 96.911], ['A', ' NE ', 145.191, 111.113, 97.962], ['A', ' CZ ', 146.263, 111.909, 98.122], ['A', ' NH1', 146.519, 112.912, 97.296], ['A', ' NH2', 147.047, 111.714, 99.127], ['A', ' H ', 140.709, 112.892, 97.076], ['A', ' HA ', 141.691, 110.423, 98.123], ['A', ' HB ', 142.299, 113.342, 98.687], ['A', ' HB ', 143.29, 112.018, 99.259], ['A', ' HG ', 142.668, 112.385, 96.327], ['A', ' HG ', 143.947, 113.295, 97.12], ['A', ' HD ', 143.667, 110.307, 96.869], ['A', ' HD ', 144.788, 111.352, 95.971], ['A', ' HE ', 145.05, 110.374, 98.638], ['A', ' HH1', 145.918, 113.097, 96.516], ['A', ' HH1', 147.323, 113.557, 97.485], ['A', ' HH2', 146.875, 110.971, 99.78], ['A', ' HH2', 147.845, 112.336, 99.225]]
[['A', ' N ', 139.997, 112.323, 100.168], ['A', ' CA ', 139.355, 112.361, 101.471], ['A', ' C ', 140.174, 112.973, 102.604], ['A', ' O ', 139.786, 112.853, 103.767], ['A', ' H ', 139.791, 113.039, 99.489], ['A', ' HA ', 138.424, 112.893, 101.375], ['A', ' HA ', 139.082, 111.343, 101.749]]
[['A', ' N ', 141.257, 113.676, 102.297], ['A', ' CA ', 142.114, 114.204, 103.351], ['A', ' C ', 141.5, 115.158, 104.329], ['A', ' O ', 141.934, 115.209, 105.479], ['A', ' CB ', 143.398, 114.775, 102.758], ['A', ' CG ', 144.409, 113.702, 102.299], ['A', ' CD1', 145.467, 114.293, 101.459], ['A', ' CD2', 145.123, 113.143, 103.554], ['A', ' H ', 141.516, 113.807, 101.333], ['A', ' HA ', 142.408, 113.351, 103.927], ['A', ' HB ', 143.142, 115.399, 101.904], ['A', ' HB ', 143.886, 115.402, 103.509], ['A', ' HG ', 143.893, 112.911, 101.751], ['A', ' HD1', 146.183, 113.525, 101.174], ['A', ' HD1', 145.028, 114.727, 100.565], ['A', ' HD1', 145.969, 115.044, 102.036], ['A', ' HD2', 145.858, 112.394, 103.259], ['A', ' HD2', 145.63, 113.96, 104.059], ['A', ' HD2', 144.442, 112.697, 104.243]]
[['A', ' N ', 140.508, 115.939, 103.962], ['A', ' CA ', 140.02, 116.815, 104.995], ['A', ' C ', 139.363, 115.965, 106.096], ['A', ' O ', 139.418, 116.317, 107.276], ['A', ' CB ', 139.07, 117.864, 104.417], ['A', ' CG ', 139.776, 118.879, 103.475], ['A', ' CD ', 138.835, 119.859, 102.783], ['A', ' OE1', 137.671, 119.581, 102.7], ['A', ' OE2', 139.278, 120.902, 102.368], ['A', ' H ', 140.07, 115.939, 103.032], ['A', ' HA ', 140.869, 117.334, 105.424], ['A', ' HB ', 138.252, 117.383, 103.902], ['A', ' HB ', 138.633, 118.437, 105.235], ['A', ' HG ', 140.517, 119.433, 104.045], ['A', ' HG ', 140.312, 118.316, 102.709]]
[['A', ' N ', 138.745, 114.827, 105.737], ['A', ' CA ', 138.047, 114.029, 106.734], ['A', ' C ', 138.995, 113.058, 107.419], ['A', ' O ', 138.825, 112.723, 108.603], ['A', ' CB ', 136.877, 113.303, 106.086], ['A', ' CG ', 135.806, 114.238, 105.496], ['A', ' CD ', 135.158, 115.135, 106.559], ['A', ' CE ', 134.007, 115.946, 105.986], ['A', ' NZ ', 133.403, 116.857, 107.011], ['A', ' H ', 138.776, 114.486, 104.774], ['A', ' HA ', 137.668, 114.69, 107.505], ['A', ' HB ', 137.245, 112.67, 105.27], ['A', ' HB ', 136.397, 112.649, 106.813], ['A', ' HG ', 136.261, 114.864, 104.725], ['A', ' HG ', 135.039, 113.626, 105.032], ['A', ' HD ', 134.795, 114.523, 107.384], ['A', ' HD ', 135.885, 115.849, 106.945], ['A', ' HE ', 134.372, 116.543, 105.15], ['A', ' HE ', 133.237, 115.263, 105.625], ['A', ' HZ ', 132.642, 117.38, 106.601], ['A', ' HZ ', 133.052, 116.311, 107.787], ['A', ' HZ ', 134.108, 117.501, 107.345]]
[['A', ' N ', 140.028, 112.634, 106.69], ['A', ' CA ', 141.024, 111.737, 107.253], ['A', ' C ', 141.673, 112.42, 108.416], ['A', ' O ', 141.927, 111.801, 109.448], ['A', ' CB ', 142.09, 111.411, 106.236], ['A', ' CG ', 141.631, 110.558, 105.161], ['A', ' SD ', 142.735, 110.462, 103.767], ['A', ' CE ', 144.137, 109.655, 104.403], ['A', ' H ', 140.088, 112.923, 105.711], ['A', ' HA ', 140.538, 110.827, 107.599], ['A', ' HB ', 142.494, 112.319, 105.837], ['A', ' HB ', 142.901, 110.894, 106.741], ['A', ' HG ', 141.557, 109.582, 105.59], ['A', ' HG ', 140.652, 110.852, 104.823], ['A', ' HE ', 144.875, 109.547, 103.615], ['A', ' HE ', 144.569, 110.218, 105.225], ['A', ' HE ', 143.835, 108.688, 104.741]]
[['A', ' N ', 141.936, 113.706, 108.228], ['A', ' CA ', 142.532, 114.546, 109.229], ['A', ' C ', 141.562, 114.919, 110.32], ['A', ' O ', 141.915, 114.869, 111.489], ['A', ' CB ', 143.087, 115.812, 108.578], ['A', ' CG1', 143.542, 116.775, 109.625], ['A', ' CG2', 144.253, 115.431, 107.695], ['A', ' H ', 141.718, 114.117, 107.315], ['A', ' HA ', 143.359, 113.997, 109.68], ['A', ' HB ', 142.31, 116.29, 107.974], ['A', ' HG1', 143.957, 117.661, 109.148], ['A', ' HG1', 142.715, 117.078, 110.264], ['A', ' HG1', 144.29, 116.283, 110.216], ['A', ' HG2', 144.653, 116.324, 107.223], ['A', ' HG2', 145.01, 114.966, 108.304], ['A', ' HG2', 143.929, 114.733, 106.925]]
[['A', ' N ', 140.34, 115.3, 109.962], ['A', ' CA ', 139.42, 115.763, 110.973], ['A', ' C ', 139.154, 114.764, 112.072], ['A', ' O ', 139.241, 115.114, 113.234], ['A', ' CB ', 138.061, 116.155, 110.363], ['A', ' OG1', 138.239, 117.217, 109.426], ['A', ' CG2', 137.157, 116.66, 111.464], ['A', ' H ', 140.063, 115.354, 108.982], ['A', ' HA ', 139.85, 116.647, 111.424], ['A', ' HB ', 137.609, 115.3, 109.864], ['A', ' HG1', 138.698, 116.889, 108.626], ['A', ' HG2', 136.203, 116.968, 111.044], ['A', ' HG2', 136.975, 115.897, 112.215], ['A', ' HG2', 137.636, 117.507, 111.928]]
[['A', ' N ', 138.89, 113.505, 111.774], ['A', ' CA ', 138.561, 112.603, 112.895], ['A', ' C ', 139.768, 112.004, 113.642], ['A', ' O ', 139.807, 110.791, 113.88], ['A', ' H ', 138.858, 113.203, 110.792], ['A', ' HA ', 137.938, 113.142, 113.608], ['A', ' HA ', 137.947, 111.79, 112.51]]
[['A', ' N ', 140.738, 112.85, 113.983], ['A', ' CA ', 142.023, 112.485, 114.59], ['A', ' C ', 142.59, 113.601, 115.463], ['A', ' O ', 142.047, 114.696, 115.514], ['A', ' CB ', 143.041, 112.048, 113.531], ['A', ' CG ', 142.604, 110.801, 112.767], ['A', ' CD ', 143.612, 110.262, 111.804], ['A', ' CE ', 143.097, 109.024, 111.117], ['A', ' NZ ', 141.743, 109.245, 110.587], ['A', ' H ', 140.525, 113.83, 113.791], ['A', ' HA ', 141.853, 111.63, 115.243], ['A', ' HB ', 143.177, 112.856, 112.804], ['A', ' HB ', 144.007, 111.853, 113.993], ['A', ' HG ', 142.287, 110.023, 113.461], ['A', ' HG ', 141.764, 111.101, 112.161], ['A', ' HD ', 143.849, 111.015, 111.05], ['A', ' HD ', 144.517, 109.992, 112.342], ['A', ' HE ', 143.762, 108.803, 110.283], ['A', ' HE ', 143.086, 108.176, 111.798], ['A', ' HZ ', 141.411, 108.436, 110.097], ['A', ' HZ ', 141.114, 109.447, 111.351], ['A', ' HZ ', 141.773, 110.07, 109.959]]
[['A', ' N ', 143.62, 113.272, 116.222], ['A', ' CA ', 144.322, 114.19, 117.117], ['A', ' C ', 145.153, 115.221, 116.345], ['A', ' O ', 145.392, 115.01, 115.164], ['A', ' CB ', 145.231, 113.396, 118.03], ['A', ' H ', 143.991, 112.335, 116.122], ['A', ' HA ', 143.586, 114.695, 117.712], ['A', ' HB ', 145.743, 114.057, 118.722], ['A', ' HB ', 144.646, 112.676, 118.593], ['A', ' HB ', 145.978, 112.869, 117.43]]
[['A', ' N ', 145.51, 116.384, 116.948], ['A', ' CA ', 146.492, 117.323, 116.46], ['A', ' C ', 147.692, 116.448, 116.39], ['A', ' O ', 147.716, 115.446, 117.095], ['A', ' CB ', 146.582, 118.379, 117.544], ['A', ' CG ', 145.266, 118.293, 118.22], ['A', ' CD ', 144.877, 116.838, 118.172], ['A', ' HA ', 146.21, 117.713, 115.474], ['A', ' HB ', 147.426, 118.16, 118.214], ['A', ' HB ', 146.772, 119.364, 117.095], ['A', ' HG ', 145.332, 118.679, 119.252], ['A', ' HG ', 144.552, 118.923, 117.687], ['A', ' HD ', 145.27, 116.304, 119.047], ['A', ' HD ', 143.798, 116.799, 118.096]]
[['A', ' N ', 148.656, 116.789, 115.564], ['A', ' CA ', 149.768, 115.894, 115.266], ['A', ' C ', 148.969, 115.154, 114.251], ['A', ' O ', 147.872, 115.622, 113.993], ['A', ' CB ', 150.236, 114.971, 116.409], ['A', ' CG ', 151.582, 114.274, 116.165], ['A', ' CD ', 152.714, 115.23, 116.206], ['A', ' OE1', 152.657, 116.134, 116.994], ['A', ' OE2', 153.616, 115.099, 115.42], ['A', ' H ', 148.561, 117.657, 115.058], ['A', ' HA ', 150.606, 116.408, 114.795], ['A', ' HB ', 150.284, 115.522, 117.352], ['A', ' HB ', 149.541, 114.14, 116.527], ['A', ' HG ', 151.729, 113.53, 116.951], ['A', ' HG ', 151.59, 113.751, 115.224]]
[['A', ' N ', 149.468, 114.145, 113.574], ['A', ' CA ', 148.7, 113.468, 112.52], ['A', ' C ', 148.459, 114.361, 111.306], ['A', ' O ', 148.991, 114.081, 110.236], ['A', ' CB ', 147.324, 112.954, 113.005], ['A', ' OG1', 147.499, 112.024, 114.071], ['A', ' CG2', 146.642, 112.257, 111.862], ['A', ' H ', 150.384, 113.79, 113.795], ['A', ' HA ', 149.277, 112.609, 112.183], ['A', ' HB ', 146.68, 113.753, 113.332], ['A', ' HG1', 147.88, 112.478, 114.831], ['A', ' HG2', 145.718, 111.904, 112.222], ['A', ' HG2', 146.461, 112.933, 111.03], ['A', ' HG2', 147.255, 111.422, 111.523]]
[['A', ' N ', 147.725, 115.462, 111.463], ['A', ' CA ', 147.435, 116.379, 110.379], ['A', ' C ', 148.687, 116.809, 109.642], ['A', ' O ', 148.735, 116.65, 108.431], ['A', ' CB ', 146.704, 117.628, 110.871], ['A', ' H ', 147.331, 115.623, 112.381], ['A', ' HA ', 146.786, 115.857, 109.68], ['A', ' HB ', 146.457, 118.257, 110.014], ['A', ' HB ', 145.801, 117.334, 111.374], ['A', ' HB ', 147.275, 118.21, 111.555]]
[['A', ' N ', 149.801, 117.199, 110.296], ['A', ' CA ', 151.004, 117.654, 109.649], ['A', ' C ', 151.609, 116.608, 108.75], ['A', ' O ', 152.473, 116.945, 107.951], ['A', ' CB ', 151.941, 117.932, 110.814], ['A', ' CG ', 151.051, 118.157, 111.953], ['A', ' CD ', 149.945, 117.201, 111.751], ['A', ' HA ', 150.801, 118.574, 109.088], ['A', ' HB ', 152.616, 117.076, 110.96], ['A', ' HB ', 152.582, 118.804, 110.582], ['A', ' HG ', 151.6, 117.999, 112.893], ['A', ' HG ', 150.703, 119.197, 111.945], ['A', ' HD ', 150.317, 116.239, 112.072], ['A', ' HD ', 149.095, 117.53, 112.31]]
[['A', ' N ', 151.225, 115.343, 108.935], ['A', ' CA ', 151.736, 114.252, 108.148], ['A', ' C ', 150.736, 113.919, 107.07], ['A', ' O ', 151.076, 113.806, 105.904], ['A', ' CB ', 151.961, 113.02, 109.038], ['A', ' CG1', 152.413, 111.833, 108.226], ['A', ' CG2', 152.961, 113.354, 110.062], ['A', ' H ', 150.49, 115.111, 109.597], ['A', ' HA ', 152.679, 114.549, 107.687], ['A', ' HB ', 151.023, 112.746, 109.521], ['A', ' HG1', 152.56, 110.979, 108.894], ['A', ' HG1', 151.661, 111.582, 107.491], ['A', ' HG1', 153.352, 112.066, 107.722], ['A', ' HG2', 153.119, 112.49, 110.709], ['A', ' HG2', 153.894, 113.624, 109.57], ['A', ' HG2', 152.604, 114.193, 110.655]]
[['A', ' N ', 149.473, 113.789, 107.426], ['A', ' CA ', 148.506, 113.36, 106.435], ['A', ' C ', 148.331, 114.369, 105.317], ['A', ' O ', 148.166, 113.994, 104.154], ['A', ' CB ', 147.173, 113.072, 107.105], ['A', ' CG ', 147.171, 111.852, 108.005], ['A', ' SD ', 147.495, 110.335, 107.1], ['A', ' CE ', 147.788, 109.167, 108.414], ['A', ' H ', 149.204, 113.952, 108.396], ['A', ' HA ', 148.873, 112.447, 105.989], ['A', ' HB ', 146.926, 113.921, 107.73], ['A', ' HB ', 146.387, 112.967, 106.359], ['A', ' HG ', 147.939, 111.971, 108.773], ['A', ' HG ', 146.2, 111.764, 108.499], ['A', ' HE ', 148.013, 108.195, 107.988], ['A', ' HE ', 148.636, 109.495, 109.021], ['A', ' HE ', 146.901, 109.088, 109.043]]
[['A', ' N ', 148.484, 115.644, 105.633], ['A', ' CA ', 148.327, 116.675, 104.625], ['A', ' C ', 149.524, 116.706, 103.693], ['A', ' O ', 149.471, 117.326, 102.638], ['A', ' CB ', 148.15, 118.061, 105.242], ['A', ' CG1', 146.92, 118.049, 106.152], ['A', ' CG2', 149.45, 118.489, 105.943], ['A', ' H ', 148.644, 115.894, 106.613], ['A', ' HA ', 147.432, 116.446, 104.048], ['A', ' HB ', 147.936, 118.781, 104.458], ['A', ' HG1', 146.771, 119.038, 106.567], ['A', ' HG1', 146.045, 117.769, 105.564], ['A', ' HG1', 147.039, 117.347, 106.952], ['A', ' HG2', 149.312, 119.466, 106.36], ['A', ' HG2', 149.711, 117.811, 106.714], ['A', ' HG2', 150.27, 118.529, 105.235]]
[['A', ' N ', 150.618, 116.052, 104.051], ['A', ' CA ', 151.795, 116.099, 103.225], ['A', ' C ', 151.607, 115.326, 101.966], ['A', ' O ', 152.391, 115.5, 101.04], ['A', ' CB ', 153.016, 115.599, 103.938], ['A', ' CG ', 153.42, 116.473, 104.978], ['A', ' CD ', 154.554, 115.948, 105.704], ['A', ' OE1', 154.772, 114.73, 105.748], ['A', ' NE2', 155.313, 116.837, 106.277], ['A', ' H ', 150.63, 115.472, 104.889], ['A', ' HA ', 151.974, 117.137, 102.951], ['A', ' HB ', 152.825, 114.61, 104.352], ['A', ' HB ', 153.842, 115.511, 103.242], ['A', ' HG ', 153.705, 117.418, 104.539], ['A', ' HG ', 152.586, 116.607, 105.64], ['A', ' HE2', 156.127, 116.541, 106.793], ['A', ' HE2', 155.098, 117.802, 106.23]]
[['A', ' N ', 150.613, 114.441, 101.916], ['A', ' CA ', 150.373, 113.761, 100.672], ['A', ' C ', 149.254, 114.364, 99.918], ['A', ' O ', 148.837, 113.765, 98.924], ['A', ' CB ', 150.178, 112.245, 100.735], ['A', ' CG ', 151.386, 111.476, 101.032], ['A', ' CD ', 152.36, 111.422, 99.906], ['A', ' NE ', 152.119, 110.469, 98.8], ['A', ' CZ ', 152.725, 109.261, 98.689], ['A', ' NH1', 153.566, 108.884, 99.594], ['A', ' NH2', 152.512, 108.509, 97.646], ['A', ' H ', 149.978, 114.288, 102.712], ['A', ' HA ', 151.237, 113.936, 100.052], ['A', ' HB ', 149.438, 112.003, 101.499], ['A', ' HB ', 149.808, 111.874, 99.788], ['A', ' HG ', 151.874, 111.868, 101.912], ['A', ' HG ', 151.07, 110.492, 101.148], ['A', ' HD ', 152.41, 112.356, 99.443], ['A', ' HD ', 153.306, 111.195, 100.348], ['A', ' HE ', 151.497, 110.748, 98.067], ['A', ' HH1', 153.758, 109.455, 100.384], ['A', ' HH1', 154.114, 108.021, 99.487], ['A', ' HH2', 151.894, 108.788, 96.921], ['A', ' HH2', 153.006, 107.625, 97.505]]
[['A', ' N ', 148.802, 115.563, 100.293], ['A', ' CA ', 147.809, 116.123, 99.409], ['A', ' C ', 148.484, 116.182, 98.042], ['A', ' O ', 147.921, 115.625, 97.106], ['A', ' CB ', 147.368, 117.56, 99.801], ['A', ' CG1', 146.59, 117.572, 101.104], ['A', ' CG2', 146.539, 118.192, 98.634], ['A', ' CD1', 146.418, 118.953, 101.74], ['A', ' H ', 149.147, 116.067, 101.114], ['A', ' HA ', 146.945, 115.469, 99.347], ['A', ' HB ', 148.229, 118.142, 99.971], ['A', ' HG1', 145.603, 117.162, 100.925], ['A', ' HG1', 147.103, 116.949, 101.805], ['A', ' HG2', 146.258, 119.201, 98.891], ['A', ' HG2', 147.126, 118.225, 97.712], ['A', ' HG2', 145.64, 117.603, 98.454], ['A', ' HD1', 145.859, 118.856, 102.673], ['A', ' HD1', 147.403, 119.37, 101.954], ['A', ' HD1', 145.885, 119.624, 101.079]]
[['A', ' N ', 149.742, 116.727, 97.954], ['A', ' CA ', 150.515, 116.816, 96.729], ['A', ' C ', 151.991, 116.717, 97.043], ['A', ' O ', 152.531, 117.48, 97.85], ['A', ' CB ', 150.196, 118.136, 95.997], ['A', ' SG ', 150.914, 118.297, 94.365], ['A', ' H ', 150.129, 117.128, 98.795], ['A', ' HA ', 150.276, 115.965, 96.096], ['A', ' HB ', 149.118, 118.261, 95.901], ['A', ' HB ', 150.539, 118.972, 96.595]]
[['A', ' N ', 152.678, 115.859, 96.313], ['A', ' CA ', 154.096, 115.609, 96.515], ['A', ' C ', 154.925, 116.617, 95.788], ['A', ' O ', 156.151, 116.609, 95.838], ['A', ' H ', 152.189, 115.318, 95.597], ['A', ' HA ', 154.332, 115.656, 97.576], ['A', ' HA ', 154.337, 114.619, 96.17]]
[['A', ' N ', 154.235, 117.513, 95.132], ['A', ' CA ', 154.849, 118.55, 94.388], ['A', ' C ', 154.584, 119.876, 95.123], ['A', ' O ', 155.046, 120.928, 94.686], ['A', ' CB ', 154.35, 118.451, 92.944], ['A', ' CG1', 154.857, 119.538, 92.113], ['A', ' CG2', 154.784, 117.088, 92.4], ['A', ' H ', 153.227, 117.45, 95.144], ['A', ' HA ', 155.925, 118.385, 94.372], ['A', ' HB ', 153.282, 118.519, 92.917], ['A', ' HG1', 154.477, 119.395, 91.1], ['A', ' HG1', 154.519, 120.485, 92.487], ['A', ' HG1', 155.949, 119.517, 92.101], ['A', ' HG2', 154.428, 116.975, 91.375], ['A', ' HG2', 155.87, 117.014, 92.417], ['A', ' HG2', 154.364, 116.287, 93.003]]
[['A', ' N ', 153.802, 119.82, 96.228], ['A', ' CA ', 153.578, 120.973, 97.088], ['A', ' C ', 153.557, 120.609, 98.593], ['A', ' O ', 152.805, 121.23, 99.358], ['A', ' CB ', 152.245, 121.626, 96.767], ['A', ' SG ', 152.135, 122.2, 95.138], ['A', ' H ', 153.424, 118.928, 96.551], ['A', ' HA ', 154.379, 121.695, 96.92], ['A', ' HB ', 151.462, 120.918, 96.923], ['A', ' HB ', 152.061, 122.462, 97.444], ['A', ' HG ', 153.198, 121.493, 94.702]]
[['A', ' N ', 154.433, 119.703, 99.063], ['A', ' CA ', 154.573, 119.299, 100.414], ['A', ' C ', 155.243, 120.489, 100.893], ['A', ' O ', 155.749, 121.199, 100.044], ['A', ' CB ', 155.503, 118.141, 100.351], ['A', ' CG ', 156.355, 118.473, 99.171], ['A', ' CD ', 155.446, 119.105, 98.23], ['A', ' HA ', 153.597, 119.109, 100.889], ['A', ' HB ', 156.078, 118.061, 101.279], ['A', ' HB ', 154.943, 117.198, 100.224], ['A', ' HG ', 157.209, 119.102, 99.464], ['A', ' HG ', 156.772, 117.565, 98.724], ['A', ' HD ', 155.978, 119.817, 97.627], ['A', ' HD ', 155.046, 118.296, 97.709]]
[['A', ' N ', 155.297, 120.7, 102.177], ['A', ' CA ', 155.962, 121.837, 102.784], ['A', ' C ', 154.871, 122.88, 102.997], ['A', ' O ', 154.391, 122.918, 104.116], ['A', ' CB ', 157.237, 122.285, 102.047], ['A', ' CG1', 158.22, 121.142, 102.089], ['A', ' CG2', 157.771, 123.477, 102.777], ['A', ' CD1', 159.263, 121.246, 101.107], ['A', ' H ', 154.854, 120.022, 102.777], ['A', ' HA ', 156.313, 121.541, 103.77], ['A', ' HB ', 157.121, 122.562, 101.058], ['A', ' HG1', 158.688, 121.114, 103.054], ['A', ' HG1', 157.713, 120.205, 101.917], ['A', ' HG2', 158.692, 123.811, 102.324], ['A', ' HG2', 157.059, 124.275, 102.74], ['A', ' HG2', 157.948, 123.203, 103.816], ['A', ' HD1', 159.893, 120.383, 101.183], ['A', ' HD1', 158.801, 121.246, 100.136], ['A', ' HD1', 159.84, 122.147, 101.243]]
[['A', ' N ', 154.334, 123.685, 102.044], ['A', ' CA ', 153.252, 124.562, 102.367], ['A', ' C ', 152.102, 123.821, 102.998], ['A', ' O ', 151.492, 124.324, 103.935], ['A', ' CB ', 152.812, 125.056, 101.019], ['A', ' CG ', 154.013, 124.995, 100.187], ['A', ' CD ', 154.742, 123.798, 100.647], ['A', ' HA ', 153.605, 125.356, 103.017], ['A', ' HB ', 151.971, 124.441, 100.638], ['A', ' HB ', 152.428, 126.066, 101.154], ['A', ' HG ', 153.705, 124.851, 99.151], ['A', ' HG ', 154.572, 125.904, 100.211], ['A', ' HD ', 154.382, 122.992, 100.05], ['A', ' HD ', 155.769, 124.008, 100.514]]
[['A', ' N ', 151.873, 122.569, 102.606], ['A', ' CA ', 150.75, 121.893, 103.21], ['A', ' C ', 150.97, 121.623, 104.685], ['A', ' O ', 150.019, 121.647, 105.469], ['A', ' CB ', 150.472, 120.56, 102.534], ['A', ' CG ', 150.05, 120.673, 101.134], ['A', ' ND1', 149.356, 121.74, 100.649], ['A', ' CD2', 150.226, 119.84, 100.094], ['A', ' CE1', 149.131, 121.569, 99.384], ['A', ' NE2', 149.632, 120.419, 99.008], ['A', ' H ', 152.351, 122.141, 101.799], ['A', ' HA ', 149.862, 122.518, 103.113], ['A', ' HB ', 151.363, 119.936, 102.573], ['A', ' HB ', 149.687, 120.038, 103.076], ['A', ' HD1', 149.09, 122.618, 101.11], ['A', ' HD2', 150.72, 118.871, 99.999], ['A', ' HE1', 148.615, 122.326, 98.849]]
[['A', ' N ', 152.208, 121.337, 105.079], ['A', ' CA ', 152.448, 120.987, 106.466], ['A', ' C ', 152.574, 122.262, 107.259], ['A', ' O ', 152.147, 122.342, 108.403], ['A', ' CB ', 153.692, 120.085, 106.638], ['A', ' OG1', 153.601, 119.403, 107.878], ['A', ' CG2', 154.997, 120.87, 106.659], ['A', ' H ', 152.985, 121.409, 104.435], ['A', ' HA ', 151.592, 120.436, 106.851], ['A', ' HB ', 153.72, 119.373, 105.832], ['A', ' HG1', 153.058, 118.58, 107.794], ['A', ' HG2', 155.823, 120.17, 106.792], ['A', ' HG2', 155.131, 121.393, 105.751], ['A', ' HG2', 155.003, 121.565, 107.482]]
[['A', ' N ', 153.137, 123.283, 106.64], ['A', ' CA ', 153.314, 124.544, 107.31], ['A', ' C ', 151.972, 125.207, 107.521], ['A', ' O ', 151.799, 125.941, 108.479], ['A', ' CB ', 154.234, 125.419, 106.477], ['A', ' CG ', 155.678, 124.975, 106.396], ['A', ' CD1', 156.328, 125.739, 105.373], ['A', ' CD2', 156.389, 125.245, 107.672], ['A', ' H ', 153.476, 123.165, 105.686], ['A', ' HA ', 153.751, 124.357, 108.285], ['A', ' HB ', 153.85, 125.424, 105.464], ['A', ' HB ', 154.205, 126.436, 106.867], ['A', ' HG ', 155.727, 123.916, 106.151], ['A', ' HD1', 157.37, 125.437, 105.3], ['A', ' HD1', 155.831, 125.561, 104.43], ['A', ' HD1', 156.28, 126.795, 105.626], ['A', ' HD2', 157.432, 124.935, 107.577], ['A', ' HD2', 156.345, 126.31, 107.876], ['A', ' HD2', 155.935, 124.709, 108.476]]
[['A', ' N ', 151.036, 124.993, 106.595], ['A', ' CA ', 149.688, 125.52, 106.701], ['A', ' C ', 148.797, 124.686, 107.649], ['A', ' O ', 147.917, 125.273, 108.288], ['A', ' CB ', 149.048, 125.61, 105.331], ['A', ' H ', 151.279, 124.462, 105.765], ['A', ' HA ', 149.759, 126.524, 107.118], ['A', ' HB ', 148.055, 126.044, 105.415], ['A', ' HB ', 149.642, 126.22, 104.668], ['A', ' HB ', 148.978, 124.614, 104.913]]
[['A', ' N ', 148.964, 123.333, 107.767], ['A', ' CA ', 148.102, 122.644, 108.751], ['A', ' C ', 148.644, 122.957, 110.15], ['A', ' O ', 147.882, 123.151, 111.104], ['A', ' CB ', 148.055, 121.153, 108.542], ['A', ' OG ', 149.243, 120.537, 108.91], ['A', ' H ', 149.6, 122.802, 107.168], ['A', ' HA ', 147.091, 123.038, 108.67], ['A', ' HB ', 147.229, 120.726, 109.106], ['A', ' HB ', 147.862, 120.965, 107.492], ['A', ' HG ', 149.188, 119.648, 108.541]]
[['A', ' N ', 149.958, 123.127, 110.241], ['A', ' CA ', 150.649, 123.593, 111.425], ['A', ' C ', 150.328, 125.037, 111.181], ['A', ' O ', 149.74, 125.293, 110.159], ['A', ' CB ', 152.146, 123.23, 111.416], ['A', ' CG1', 152.875, 123.823, 112.611], ['A', ' CG2', 152.26, 121.711, 111.454], ['A', ' H ', 150.533, 122.902, 109.426], ['A', ' HA ', 150.172, 123.244, 112.338], ['A', ' HB ', 152.607, 123.62, 110.512], ['A', ' HG1', 153.92, 123.535, 112.573], ['A', ' HG1', 152.817, 124.887, 112.605], ['A', ' HG1', 152.436, 123.467, 113.527], ['A', ' HG2', 153.295, 121.407, 111.431], ['A', ' HG2', 151.799, 121.349, 112.352], ['A', ' HG2', 151.748, 121.282, 110.593]]
[['A', ' N ', 150.441, 125.936, 112.11], ['A', ' CA ', 149.979, 127.322, 111.845], ['A', ' C ', 148.441, 127.366, 111.976], ['A', ' O ', 147.921, 128.022, 112.873], ['A', ' CB ', 150.392, 127.882, 110.46], ['A', ' CG ', 150.15, 129.377, 110.271], ['A', ' CD ', 151.075, 130.254, 111.017], ['A', ' OE1', 152.149, 129.825, 111.318], ['A', ' OE2', 150.711, 131.371, 111.282], ['A', ' H ', 150.932, 125.69, 112.982], ['A', ' HA ', 150.413, 127.992, 112.575], ['A', ' HB ', 151.442, 127.671, 110.269], ['A', ' HB ', 149.809, 127.465, 109.653], ['A', ' HG ', 150.199, 129.617, 109.209], ['A', ' HG ', 149.153, 129.601, 110.624]]
[['A', ' N ', 147.674, 126.608, 111.175], ['A', ' CA ', 146.228, 126.569, 111.429], ['A', ' C ', 145.999, 126.026, 112.832], ['A', ' O ', 145.138, 126.505, 113.575], ['A', ' CB ', 145.511, 125.729, 110.406], ['A', ' H ', 148.091, 126.078, 110.389], ['A', ' HA ', 145.843, 127.587, 111.386], ['A', ' HB ', 144.441, 125.734, 110.614], ['A', ' HB ', 145.697, 126.149, 109.426], ['A', ' HB ', 145.882, 124.711, 110.438]]
[['A', ' N ', 146.813, 125.048, 113.213], ['A', ' CA ', 146.793, 124.49, 114.545], ['A', ' C ', 147.524, 125.437, 115.509], ['A', ' O ', 147.092, 125.597, 116.639], ['A', ' CB ', 147.303, 123.049, 114.612], ['A', ' CG1', 146.304, 122.143, 113.848], ['A', ' CG2', 147.403, 122.634, 116.075], ['A', ' CD1', 146.775, 120.726, 113.583], ['A', ' H ', 147.43, 124.633, 112.507], ['A', ' HA ', 145.757, 124.443, 114.864], ['A', ' HB ', 148.277, 122.965, 114.125], ['A', ' HG1', 145.377, 122.093, 114.416], ['A', ' HG1', 146.09, 122.61, 112.886], ['A', ' HG2', 147.735, 121.621, 116.166], ['A', ' HG2', 148.11, 123.275, 116.596], ['A', ' HG2', 146.42, 122.728, 116.541], ['A', ' HD1', 146.002, 120.188, 113.033], ['A', ' HD1', 147.691, 120.758, 112.983], ['A', ' HD1', 146.97, 120.209, 114.513]]
[['A', ' N ', 148.631, 126.097, 115.083], ['A', ' CA ', 149.368, 126.993, 116.011], ['A', ' C ', 148.394, 128.102, 116.433], ['A', ' O ', 148.555, 128.762, 117.458], ['A', ' CB ', 150.539, 127.816, 115.404], ['A', ' CG ', 151.748, 127.066, 114.75], ['A', ' OD1', 151.694, 125.871, 114.622], ['A', ' OD2', 152.685, 127.731, 114.305], ['A', ' H ', 148.966, 125.946, 114.143], ['A', ' HA ', 149.688, 126.436, 116.878], ['A', ' HB ', 150.128, 128.535, 114.699], ['A', ' HB ', 150.959, 128.415, 116.218]]
[['A', ' N ', 147.426, 128.398, 115.568], ['A', ' CA ', 146.383, 129.352, 115.865], ['A', ' C ', 145.228, 128.709, 116.671], ['A', ' O ', 144.767, 129.291, 117.646], ['A', ' CB ', 145.877, 129.978, 114.56], ['A', ' CG ', 144.929, 131.166, 114.761], ['A', ' OD1', 145.126, 131.877, 115.713], ['A', ' OD2', 144.034, 131.388, 113.948], ['A', ' H ', 147.436, 127.963, 114.65], ['A', ' HA ', 146.814, 130.144, 116.478], ['A', ' HB ', 146.737, 130.312, 113.969], ['A', ' HB ', 145.381, 129.213, 113.965]]
[['A', ' N ', 144.751, 127.495, 116.302], ['A', ' CA ', 143.604, 126.93, 117.032], ['A', ' C ', 143.954, 126.637, 118.486], ['A', ' O ', 143.1, 126.72, 119.372], ['A', ' CB ', 143.137, 125.638, 116.408], ['A', ' OG ', 144.031, 124.605, 116.666], ['A', ' H ', 145.11, 127.006, 115.481], ['A', ' HA ', 142.799, 127.654, 116.999], ['A', ' HB ', 142.154, 125.379, 116.785], ['A', ' HB ', 143.051, 125.777, 115.331], ['A', ' HG ', 143.694, 123.838, 116.203]]
[['A', ' N ', 145.208, 126.324, 118.726], ['A', ' CA ', 145.76, 126.125, 120.04], ['A', ' C ', 146.592, 127.352, 120.191], ['A', ' O ', 147.294, 127.677, 119.263], ['A', ' CB ', 146.666, 124.901, 120.049], ['A', ' CG ', 146.045, 123.577, 119.698], ['A', ' CD1', 147.14, 122.538, 119.611], ['A', ' CD2', 145.051, 123.21, 120.75], ['A', ' H ', 145.834, 126.203, 117.925], ['A', ' HA ', 144.988, 126.105, 120.804], ['A', ' HB ', 147.434, 125.081, 119.305], ['A', ' HB ', 147.142, 124.815, 121.028], ['A', ' HG ', 145.544, 123.638, 118.731], ['A', ' HD1', 146.71, 121.565, 119.368], ['A', ' HD1', 147.841, 122.82, 118.847], ['A', ' HD1', 147.657, 122.489, 120.548], ['A', ' HD2', 144.611, 122.259, 120.509], ['A', ' HD2', 145.539, 123.145, 121.726], ['A', ' HD2', 144.281, 123.96, 120.784]]
[['A', ' N ', 146.662, 127.992, 121.325], ['A', ' CA ', 147.487, 129.195, 121.304], ['A', ' C ', 148.961, 128.887, 121.503], ['A', ' O ', 149.466, 128.863, 122.627], ['A', ' CB ', 146.973, 130.172, 122.355], ['A', ' CG ', 145.606, 130.725, 121.955], ['A', ' OD1', 145.471, 131.221, 120.857], ['A', ' OD2', 144.654, 130.617, 122.708], ['A', ' H ', 146.118, 127.72, 122.13], ['A', ' HA ', 147.378, 129.669, 120.325], ['A', ' HB ', 146.893, 129.671, 123.32], ['A', ' HB ', 147.677, 130.997, 122.465]]
[['A', ' N ', 149.651, 128.636, 120.392], ['A', ' CA ', 151.045, 128.229, 120.431], ['A', ' C ', 151.982, 129.308, 119.924], ['A', ' O ', 151.896, 129.726, 118.771], ['A', ' CB ', 151.235, 126.967, 119.584], ['A', ' CG1', 150.356, 125.862, 120.151], ['A', ' CG2', 152.668, 126.544, 119.556], ['A', ' CD1', 150.264, 124.598, 119.33], ['A', ' H ', 149.15, 128.672, 119.482], ['A', ' HA ', 151.312, 128.004, 121.463], ['A', ' HB ', 150.911, 127.176, 118.581], ['A', ' HG1', 150.724, 125.623, 121.11], ['A', ' HG1', 149.355, 126.245, 120.262], ['A', ' HG2', 152.782, 125.667, 118.942], ['A', ' HG2', 153.296, 127.33, 119.14], ['A', ' HG2', 152.971, 126.326, 120.572], ['A', ' HD1', 149.624, 123.908, 119.847], ['A', ' HD1', 149.852, 124.804, 118.355], ['A', ' HD1', 151.233, 124.14, 119.212]]
[['A', ' N ', 152.904, 129.74, 120.774], ['A', ' CA ', 153.852, 130.76, 120.366], ['A', ' C ', 155.182, 130.154, 119.978], ['A', ' O ', 155.906, 129.607, 120.81], ['A', ' CB ', 154.087, 131.785, 121.466], ['A', ' CG ', 155.067, 132.888, 121.056], ['A', ' CD ', 155.294, 133.915, 122.112], ['A', ' OE1', 154.677, 133.835, 123.144], ['A', ' OE2', 156.093, 134.792, 121.884], ['A', ' H ', 152.929, 129.365, 121.714], ['A', ' HA ', 153.45, 131.28, 119.496], ['A', ' HB ', 153.14, 132.25, 121.742], ['A', ' HB ', 154.485, 131.291, 122.351], ['A', ' HG ', 156.032, 132.442, 120.808], ['A', ' HG ', 154.687, 133.375, 120.162]]
[['A', ' N ', 155.511, 130.275, 118.712], ['A', ' CA ', 156.723, 129.701, 118.18], ['A', ' C ', 157.826, 130.772, 118.169], ['A', ' O ', 157.599, 131.833, 117.597], ['A', ' CB ', 156.447, 129.191, 116.769], ['A', ' CG1', 157.694, 128.617, 116.191], ['A', ' CG2', 155.318, 128.156, 116.827], ['A', ' H ', 154.865, 130.751, 118.097], ['A', ' HA ', 156.982, 128.853, 118.799], ['A', ' HB ', 156.147, 130.024, 116.136], ['A', ' HG1', 157.505, 128.273, 115.179], ['A', ' HG1', 158.464, 129.373, 116.171], ['A', ' HG1', 158.034, 127.772, 116.797], ['A', ' HG2', 155.096, 127.783, 115.828], ['A', ' HG2', 155.618, 127.332, 117.459], ['A', ' HG2', 154.414, 128.603, 117.236]]
[['A', ' N ', 158.987, 130.547, 118.808], ['A', ' CA ', 160.111, 131.469, 118.935], ['A', ' C ', 160.864, 131.634, 117.633], ['A', ' O ', 160.797, 130.754, 116.775], ['A', ' CB ', 160.984, 130.786, 119.988], ['A', ' CG ', 160.69, 129.326, 119.837], ['A', ' CD ', 159.225, 129.247, 119.472], ['A', ' HA ', 159.739, 132.441, 119.296], ['A', ' HB ', 162.05, 131.008, 119.795], ['A', ' HB ', 160.748, 131.172, 120.989], ['A', ' HG ', 161.339, 128.891, 119.058], ['A', ' HG ', 160.926, 128.784, 120.768], ['A', ' HD ', 159.113, 128.404, 118.777], ['A', ' HD ', 158.598, 129.139, 120.378]]
[['A', ' N ', 161.651, 132.696, 117.493], ['A', ' CA ', 162.424, 132.789, 116.268], ['A', ' C ', 163.611, 131.858, 116.279], ['A', ' O ', 164.567, 131.987, 117.038], ['A', ' CB ', 162.865, 134.21, 115.984], ['A', ' CG ', 161.733, 135.122, 115.598], ['A', ' CD ', 162.241, 136.51, 115.266], ['A', ' CE ', 161.109, 137.428, 114.83], ['A', ' NZ ', 161.599, 138.798, 114.503], ['A', ' H ', 161.708, 133.412, 118.206], ['A', ' HA ', 161.793, 132.481, 115.441], ['A', ' HB ', 163.352, 134.623, 116.866], ['A', ' HB ', 163.595, 134.21, 115.18], ['A', ' HG ', 161.23, 134.709, 114.72], ['A', ' HG ', 161.013, 135.18, 116.413], ['A', ' HD ', 162.726, 136.939, 116.144], ['A', ' HD ', 162.974, 136.45, 114.463], ['A', ' HE ', 160.628, 137.005, 113.948], ['A', ' HE ', 160.375, 137.497, 115.633], ['A', ' HZ ', 160.823, 139.379, 114.217], ['A', ' HZ ', 162.038, 139.204, 115.319], ['A', ' HZ ', 162.272, 138.746, 113.752]]
[['A', ' N ', 163.463, 130.914, 115.389], ['A', ' CA ', 164.251, 129.762, 115.035], ['A', ' C ', 163.184, 128.855, 114.489], ['A', ' O ', 163.036, 128.665, 113.286], ['A', ' CB ', 165.0, 129.154, 116.207], ['A', ' H ', 162.608, 131.005, 114.866], ['A', ' HA ', 164.952, 130.011, 114.241], ['A', ' HB ', 165.523, 128.256, 115.874], ['A', ' HB ', 165.73, 129.867, 116.579], ['A', ' HB ', 164.317, 128.892, 117.015]]
[['A', ' N ', 162.264, 128.497, 115.366], ['A', ' CA ', 161.081, 127.747, 114.979], ['A', ' C ', 160.247, 128.559, 114.009], ['A', ' O ', 159.674, 128.026, 113.079], ['A', ' H ', 162.413, 128.707, 116.345], ['A', ' HA ', 161.368, 126.809, 114.511], ['A', ' HA ', 160.497, 127.498, 115.864]]
[['A', ' N ', 160.246, 129.879, 114.175], ['A', ' CA ', 159.501, 130.791, 113.315], ['A', ' C ', 160.371, 131.328, 112.173], ['A', ' O ', 159.956, 132.227, 111.455], ['A', ' CB ', 158.964, 131.972, 114.139], ['A', ' CG ', 157.949, 132.926, 113.449], ['A', ' CD ', 157.61, 134.096, 114.293], ['A', ' NE ', 156.813, 133.757, 115.462], ['A', ' CZ ', 156.565, 134.598, 116.495], ['A', ' NH1', 157.064, 135.817, 116.501], ['A', ' NH2', 155.811, 134.207, 117.502], ['A', ' H ', 160.693, 130.233, 115.018], ['A', ' HA ', 158.656, 130.252, 112.891], ['A', ' HB ', 158.5, 131.594, 115.047], ['A', ' HB ', 159.79, 132.589, 114.445], ['A', ' HG ', 158.312, 133.353, 112.536], ['A', ' HG ', 157.032, 132.377, 113.247], ['A', ' HD ', 158.541, 134.549, 114.633], ['A', ' HD ', 157.052, 134.815, 113.696], ['A', ' HE ', 156.408, 132.83, 115.504], ['A', ' HH1', 157.637, 136.131, 115.739], ['A', ' HH1', 156.872, 136.436, 117.277], ['A', ' HH2', 155.418, 133.28, 117.5], ['A', ' HH2', 155.622, 134.842, 118.265]]
[['A', ' N ', 161.607, 130.857, 112.035], ['A', ' CA ', 162.445, 131.333, 110.938], ['A', ' C ', 162.54, 130.252, 109.919], ['A', ' O ', 162.319, 130.474, 108.747], ['A', ' CB ', 163.849, 131.689, 111.4], ['A', ' CG ', 163.974, 132.793, 112.421], ['A', ' CD1', 165.425, 132.915, 112.811], ['A', ' CD2', 163.464, 134.099, 111.864], ['A', ' H ', 161.933, 130.093, 112.619], ['A', ' HA ', 161.978, 132.188, 110.456], ['A', ' HB ', 164.304, 130.795, 111.819], ['A', ' HB ', 164.422, 131.98, 110.527], ['A', ' HG ', 163.403, 132.544, 113.288], ['A', ' HD1', 165.534, 133.696, 113.562], ['A', ' HD1', 165.776, 131.975, 113.222], ['A', ' HD1', 166.016, 133.171, 111.931], ['A', ' HD2', 163.575, 134.877, 112.615], ['A', ' HD2', 164.036, 134.373, 110.976], ['A', ' HD2', 162.411, 134.017, 111.602]]
[['A', ' N ', 162.612, 129.022, 110.381], ['A', ' CA ', 162.804, 127.839, 109.562], ['A', ' C ', 161.461, 127.293, 109.05], ['A', ' O ', 161.256, 126.089, 108.899], ['A', ' CB ', 163.451, 126.794, 110.469], ['A', ' CG ', 164.796, 127.165, 111.126], ['A', ' CD1', 165.221, 126.042, 112.073], ['A', ' CD2', 165.802, 127.407, 110.1], ['A', ' H ', 162.688, 128.894, 111.385], ['A', ' HA ', 163.426, 128.088, 108.704], ['A', ' HB ', 162.748, 126.557, 111.279], ['A', ' HB ', 163.608, 125.924, 109.9], ['A', ' HG ', 164.692, 128.065, 111.71], ['A', ' HD1', 166.16, 126.308, 112.551], ['A', ' HD1', 164.455, 125.903, 112.843], ['A', ' HD1', 165.345, 125.113, 111.521], ['A', ' HD2', 166.718, 127.643, 110.568], ['A', ' HD2', 165.932, 126.539, 109.518], ['A', ' HD2', 165.508, 128.232, 109.468]]
[['A', ' N ', 160.532, 128.208, 108.824], ['A', ' CA ', 159.193, 127.96, 108.331], ['A', ' C ', 159.24, 128.645, 107.007], ['A', ' O ', 158.484, 128.344, 106.092], ['A', ' CB ', 158.149, 128.569, 109.234], ['A', ' CG ', 158.219, 128.072, 110.629], ['A', ' CD ', 157.688, 126.686, 110.885], ['A', ' NE ', 156.231, 126.637, 110.746], ['A', ' CZ ', 155.341, 126.976, 111.721], ['A', ' NH1', 155.719, 127.376, 112.894], ['A', ' NH2', 154.056, 126.926, 111.531], ['A', ' H ', 160.867, 129.168, 108.855], ['A', ' HA ', 159.022, 126.895, 108.187], ['A', ' HB ', 158.271, 129.652, 109.251], ['A', ' HB ', 157.165, 128.348, 108.858], ['A', ' HG ', 159.264, 128.049, 110.85], ['A', ' HG ', 157.72, 128.769, 111.289], ['A', ' HD ', 158.124, 125.981, 110.175], ['A', ' HD ', 157.958, 126.371, 111.895], ['A', ' HE ', 155.855, 126.343, 109.859], ['A', ' HH1', 156.703, 127.456, 113.114], ['A', ' HH1', 154.966, 127.609, 113.579], ['A', ' HH2', 153.654, 126.634, 110.642], ['A', ' HH2', 153.452, 127.216, 112.33]]
[['A', ' N ', 160.144, 129.617, 106.958], ['A', ' CA ', 160.499, 130.322, 105.757], ['A', ' C ', 161.885, 129.716, 105.664], ['A', ' O ', 162.157, 128.862, 106.501], ['A', ' CB ', 160.353, 131.842, 105.808], ['A', ' CG ', 161.059, 132.582, 106.858], ['A', ' CD ', 160.862, 134.06, 106.678], ['A', ' OE1', 160.611, 134.463, 105.569], ['A', ' OE2', 160.959, 134.791, 107.625], ['A', ' H ', 160.713, 129.818, 107.783], ['A', ' HA ', 159.909, 129.97, 104.912], ['A', ' HB ', 160.672, 132.253, 104.85], ['A', ' HB ', 159.301, 132.084, 105.915], ['A', ' HG ', 160.656, 132.288, 107.832], ['A', ' HG ', 162.108, 132.335, 106.842]]
[['A', ' N ', 162.718, 130.007, 104.661], ['A', ' CA ', 163.974, 129.227, 104.42], ['A', ' C ', 163.511, 127.903, 103.808], ['A', ' O ', 163.81, 127.586, 102.664], ['A', ' CB ', 164.855, 128.949, 105.641], ['A', ' CG ', 166.12, 128.107, 105.354], ['A', ' CD1', 167.031, 128.813, 104.382], ['A', ' CD2', 166.825, 127.847, 106.642], ['A', ' H ', 162.464, 130.745, 104.028], ['A', ' HA ', 164.559, 129.764, 103.684], ['A', ' HB ', 165.149, 129.88, 106.048], ['A', ' HB ', 164.335, 128.394, 106.392], ['A', ' HG ', 165.832, 127.155, 104.916], ['A', ' HD1', 167.911, 128.2, 104.206], ['A', ' HD1', 166.537, 128.965, 103.444], ['A', ' HD1', 167.327, 129.768, 104.789], ['A', ' HD2', 167.701, 127.235, 106.45], ['A', ' HD2', 167.129, 128.787, 107.103], ['A', ' HD2', 166.15, 127.317, 107.294]]
[['A', ' N ', 162.735, 127.186, 104.601], ['A', ' CA ', 161.873, 126.104, 104.243], ['A', ' C ', 160.92, 126.926, 103.368], ['A', ' O ', 160.792, 128.119, 103.601], ['A', ' CB ', 161.136, 125.573, 105.494], ['A', ' OG1', 162.069, 125.162, 106.502], ['A', ' CG2', 160.327, 124.414, 105.139], ['A', ' H ', 162.676, 127.494, 105.562], ['A', ' HA ', 162.383, 125.333, 103.667], ['A', ' HB ', 160.507, 126.37, 105.896], ['A', ' HG1', 161.647, 125.249, 107.412], ['A', ' HG2', 159.811, 124.057, 106.027], ['A', ' HG2', 159.613, 124.708, 104.405], ['A', ' HG2', 160.97, 123.627, 104.742]]
[['A', ' N ', 160.378, 126.394, 102.3], ['A', ' CA ', 159.51, 127.157, 101.365], ['A', ' C ', 160.29, 128.045, 100.456], ['A', ' O ', 160.09, 128.036, 99.251], ['A', ' CB ', 158.497, 128.117, 101.978], ['A', ' CG ', 157.426, 127.576, 102.688], ['A', ' CD1', 156.742, 128.676, 103.333], ['A', ' CD2', 156.473, 126.891, 101.75], ['A', ' H ', 160.587, 125.416, 102.13], ['A', ' HA ', 158.966, 126.454, 100.768], ['A', ' HB ', 158.958, 128.877, 102.575], ['A', ' HB ', 158.049, 128.648, 101.137], ['A', ' HG ', 157.798, 126.895, 103.433], ['A', ' HD1', 155.918, 128.292, 103.905], ['A', ' HD1', 157.448, 129.17, 103.992], ['A', ' HD1', 156.381, 129.373, 102.586], ['A', ' HD2', 155.644, 126.511, 102.315], ['A', ' HD2', 156.111, 127.612, 101.016], ['A', ' HD2', 156.937, 126.07, 101.238]]
[['A', ' N ', 161.133, 128.894, 100.994], ['A', ' CA ', 161.9, 129.701, 100.075], ['A', ' C ', 162.709, 128.7, 99.223], ['A', ' O ', 162.709, 128.723, 97.979], ['A', ' CB ', 162.729, 130.682, 100.856], ['A', ' H ', 161.228, 128.91, 102.009], ['A', ' HA ', 161.222, 130.245, 99.416], ['A', ' HB ', 163.307, 131.266, 100.191], ['A', ' HB ', 162.071, 131.328, 101.433], ['A', ' HB ', 163.378, 130.137, 101.521]]
[['A', ' N ', 163.269, 127.712, 99.91], ['A', ' CA ', 163.868, 126.573, 99.289], ['A', ' C ', 162.696, 125.629, 99.241], ['A', ' O ', 162.163, 125.24, 100.271], ['A', ' CB ', 165.046, 126.047, 100.063], ['A', ' H ', 163.281, 127.743, 100.927], ['A', ' HA ', 164.167, 126.815, 98.275], ['A', ' HB ', 165.424, 125.148, 99.582], ['A', ' HB ', 165.821, 126.814, 100.086], ['A', ' HB ', 164.733, 125.812, 101.075]]
[['A', ' N ', 162.223, 125.388, 98.055], ['A', ' CA ', 161.008, 124.663, 97.735], ['A', ' C ', 160.324, 125.438, 96.65], ['A', ' O ', 160.038, 124.883, 95.593], ['A', ' CB ', 160.062, 124.451, 98.874], ['A', ' CG ', 158.869, 123.857, 98.419], ['A', ' ND1', 158.835, 122.607, 97.897], ['A', ' CD2', 157.617, 124.321, 98.379], ['A', ' CE1', 157.62, 122.32, 97.544], ['A', ' NE2', 156.845, 123.344, 97.826], ['A', ' H ', 162.757, 125.782, 97.303], ['A', ' HA ', 161.251, 123.685, 97.362], ['A', ' HB ', 160.481, 123.784, 99.619], ['A', ' HB ', 159.845, 125.36, 99.293], ['A', ' HD1', 159.603, 121.979, 97.786], ['A', ' HD2', 157.175, 125.267, 98.683], ['A', ' HE1', 157.407, 121.368, 97.087]]
[['A', ' N ', 160.138, 126.743, 96.839], ['A', ' CA ', 159.6, 127.519, 95.755], ['A', ' C ', 160.582, 127.411, 94.634], ['A', ' O ', 160.227, 127.003, 93.535], ['A', ' CB ', 159.461, 128.997, 96.101], ['A', ' CG ', 158.377, 129.348, 96.995], ['A', ' ND1', 158.098, 130.64, 97.297], ['A', ' CD2', 157.491, 128.608, 97.673], ['A', ' CE1', 157.069, 130.692, 98.091], ['A', ' NE2', 156.675, 129.481, 98.343], ['A', ' H ', 160.301, 127.19, 97.738], ['A', ' HA ', 158.648, 127.121, 95.431], ['A', ' HB ', 160.38, 129.324, 96.58], ['A', ' HB ', 159.348, 129.585, 95.187], ['A', ' HD2', 157.437, 127.527, 97.673], ['A', ' HE1', 156.612, 131.595, 98.479], ['A', ' HE2', 155.872, 129.279, 98.947]]
[['A', ' N ', 161.867, 127.524, 94.935], ['A', ' CA ', 162.836, 127.401, 93.857], ['A', ' C ', 162.709, 126.015, 93.215], ['A', ' O ', 162.772, 125.884, 91.993], ['A', ' CB ', 164.279, 127.62, 94.376], ['A', ' CG1', 165.322, 127.291, 93.275], ['A', ' CG2', 164.444, 129.074, 94.828], ['A', ' H ', 162.135, 127.838, 95.877], ['A', ' HA ', 162.618, 128.156, 93.105], ['A', ' HB ', 164.465, 126.948, 95.215], ['A', ' HG1', 166.331, 127.446, 93.667], ['A', ' HG1', 165.238, 126.249, 92.949], ['A', ' HG1', 165.168, 127.945, 92.421], ['A', ' HG2', 165.454, 129.218, 95.202], ['A', ' HG2', 164.269, 129.747, 93.984], ['A', ' HG2', 163.734, 129.305, 95.623]]
[['A', ' N ', 162.528, 124.998, 94.047], ['A', ' CA ', 162.435, 123.61, 93.616], ['A', ' C ', 161.131, 123.286, 92.896], ['A', ' O ', 161.064, 122.284, 92.187], ['A', ' CB ', 162.495, 122.673, 94.797], ['A', ' CG ', 163.773, 122.734, 95.53], ['A', ' OD1', 164.733, 123.313, 95.046], ['A', ' ND2', 163.8, 122.15, 96.701], ['A', ' H ', 162.484, 125.217, 95.025], ['A', ' HA ', 163.257, 123.411, 92.932], ['A', ' HB ', 161.675, 122.864, 95.443], ['A', ' HB ', 162.366, 121.653, 94.437], ['A', ' HD2', 164.641, 122.149, 97.266], ['A', ' HD2', 162.989, 121.687, 97.044]]
[['A', ' N ', 160.08, 124.071, 93.145], ['A', ' CA ', 158.775, 123.856, 92.553], ['A', ' C ', 158.655, 124.612, 91.258], ['A', ' O ', 157.889, 124.215, 90.374], ['A', ' CB ', 157.707, 124.316, 93.49], ['A', ' OG ', 157.712, 123.557, 94.647], ['A', ' H ', 160.179, 124.874, 93.761], ['A', ' HA ', 158.651, 122.792, 92.348], ['A', ' HB ', 157.886, 125.358, 93.738], ['A', ' HB ', 156.737, 124.248, 93.004], ['A', ' HG ', 158.495, 123.873, 95.145]]
[['A', ' N ', 159.395, 125.71, 91.136], ['A', ' CA ', 159.397, 126.432, 89.889], ['A', ' C ', 160.306, 125.601, 88.983], ['A', ' O ', 160.004, 125.371, 87.812], ['A', ' CB ', 159.836, 127.848, 90.093], ['A', ' CG ', 158.864, 128.62, 90.915], ['A', ' ND1', 157.528, 128.681, 90.607], ['A', ' CD2', 159.029, 129.377, 92.017], ['A', ' CE1', 156.915, 129.439, 91.492], ['A', ' NE2', 157.802, 129.867, 92.351], ['A', ' H ', 159.928, 126.046, 91.936], ['A', ' HA ', 158.401, 126.449, 89.453], ['A', ' HB ', 160.77, 127.813, 90.619], ['A', ' HB ', 159.975, 128.347, 89.138], ['A', ' HD2', 159.964, 129.57, 92.544], ['A', ' HE1', 155.849, 129.679, 91.514], ['A', ' HE2', 157.586, 130.492, 93.143]]
[['A', ' N ', 161.358, 125.03, 89.567], ['A', ' CA ', 162.128, 124.018, 88.883], ['A', ' C ', 161.061, 122.935, 88.824], ['A', ' O ', 160.06, 123.102, 89.477], ['A', ' CB ', 163.387, 123.619, 89.626], ['A', ' H ', 161.649, 125.321, 90.5], ['A', ' HA ', 162.377, 124.343, 87.873], ['A', ' HB ', 163.887, 122.812, 89.11], ['A', ' HB ', 164.057, 124.479, 89.692], ['A', ' HB ', 163.124, 123.297, 90.619]]
[['A', ' N ', 161.137, 121.939, 87.985], ['A', ' CA ', 160.001, 120.998, 87.828], ['A', ' C ', 158.958, 121.713, 86.953], ['A', ' O ', 158.727, 121.302, 85.826], ['A', ' CB ', 159.331, 120.465, 89.129], ['A', ' CG1', 160.365, 119.72, 90.032], ['A', ' CG2', 158.169, 119.532, 88.729], ['A', ' CD1', 161.05, 118.493, 89.422], ['A', ' H ', 161.984, 121.829, 87.45], ['A', ' HA ', 160.34, 120.122, 87.302], ['A', ' HB ', 158.877, 121.243, 89.719], ['A', ' HG1', 161.121, 120.436, 90.323], ['A', ' HG1', 159.843, 119.397, 90.933], ['A', ' HG2', 157.687, 119.149, 89.628], ['A', ' HG2', 157.432, 120.076, 88.144], ['A', ' HG2', 158.536, 118.708, 88.137], ['A', ' HD1', 161.721, 118.065, 90.155], ['A', ' HD1', 160.325, 117.767, 89.167], ['A', ' HD1', 161.613, 118.766, 88.541]]
[['A', ' N ', 158.399, 122.841, 87.356], ['A', ' CA ', 157.518, 123.528, 86.409], ['A', ' C ', 158.297, 123.837, 85.127], ['A', ' O ', 157.83, 123.582, 84.017], ['A', ' CB ', 156.943, 124.795, 86.982], ['A', ' CG ', 156.172, 125.576, 86.037], ['A', ' ND1', 154.978, 125.175, 85.538], ['A', ' CD2', 156.413, 126.778, 85.533], ['A', ' CE1', 154.484, 126.12, 84.774], ['A', ' NE2', 155.326, 127.135, 84.768], ['A', ' H ', 158.556, 123.2, 88.316], ['A', ' HA ', 156.683, 122.881, 86.149], ['A', ' HB ', 156.302, 124.548, 87.832], ['A', ' HB ', 157.715, 125.423, 87.348], ['A', ' HD1', 154.469, 124.309, 85.777], ['A', ' HD2', 157.245, 127.471, 85.666], ['A', ' HE1', 153.513, 125.985, 84.29]]
[['A', ' N ', 159.543, 124.281, 85.274], ['A', ' CA ', 160.409, 124.628, 84.153], ['A', ' C ', 161.169, 123.396, 83.634], ['A', ' O ', 162.201, 123.512, 82.982], ['A', ' CB ', 161.418, 125.721, 84.54], ['A', ' CG ', 160.809, 127.061, 84.866], ['A', ' ND1', 160.224, 127.863, 83.916], ['A', ' CD2', 160.733, 127.742, 86.026], ['A', ' CE1', 159.791, 128.972, 84.484], ['A', ' NE2', 160.079, 128.915, 85.769], ['A', ' H ', 159.853, 124.49, 86.225], ['A', ' HA ', 159.801, 125.011, 83.335], ['A', ' HB ', 161.984, 125.393, 85.414], ['A', ' HB ', 162.128, 125.866, 83.729], ['A', ' HD1', 160.161, 127.668, 82.938], ['A', ' HD2', 161.071, 127.522, 87.028], ['A', ' HE1', 159.28, 129.742, 83.89]]
[['A', ' N ', 160.656, 122.217, 83.961], ['A', ' CA ', 161.094, 120.91, 83.488], ['A', ' C ', 159.967, 120.36, 82.63], ['A', ' O ', 160.18, 119.907, 81.511], ['A', ' CB ', 161.355, 119.976, 84.651], ['A', ' CG ', 161.687, 118.614, 84.329], ['A', ' CD1', 162.857, 118.257, 83.721], ['A', ' CD2', 160.776, 117.629, 84.676], ['A', ' CE1', 163.098, 116.936, 83.447], ['A', ' CE2', 161.026, 116.326, 84.41], ['A', ' CZ ', 162.185, 115.978, 83.792], ['A', ' H ', 159.839, 122.219, 84.558], ['A', ' HA ', 161.992, 121.021, 82.879], ['A', ' HB ', 162.116, 120.381, 85.299], ['A', ' HB ', 160.472, 119.911, 85.193], ['A', ' HD1', 163.585, 119.023, 83.445], ['A', ' HD2', 159.843, 117.911, 85.168], ['A', ' HE1', 164.013, 116.641, 82.951], ['A', ' HE2', 160.301, 115.561, 84.684], ['A', ' HZ ', 162.385, 114.941, 83.572]]
[['A', ' N ', 158.759, 120.426, 83.19], ['A', ' CA ', 157.514, 119.989, 82.586], ['A', ' C ', 157.068, 120.877, 81.445], ['A', ' O ', 156.522, 120.401, 80.458], ['A', ' CB ', 156.42, 120.035, 83.645], ['A', ' CG ', 156.48, 119.028, 84.763], ['A', ' CD1', 155.473, 119.429, 85.804], ['A', ' CD2', 156.131, 117.667, 84.226], ['A', ' H ', 158.702, 120.781, 84.131], ['A', ' HA ', 157.648, 118.984, 82.207], ['A', ' HB ', 156.443, 121.026, 84.103], ['A', ' HB ', 155.458, 119.921, 83.147], ['A', ' HG ', 157.472, 119.015, 85.212], ['A', ' HD1', 155.482, 118.713, 86.626], ['A', ' HD1', 155.716, 120.423, 86.188], ['A', ' HD1', 154.48, 119.449, 85.353], ['A', ' HD2', 156.127, 116.945, 85.007], ['A', ' HD2', 155.138, 117.702, 83.803], ['A', ' HD2', 156.834, 117.348, 83.467]]
[['A', ' N ', 157.31, 122.17, 81.535], ['A', ' CA ', 156.856, 123.065, 80.488], ['A', ' C ', 157.981, 123.304, 79.502], ['A', ' O ', 157.755, 123.655, 78.337], ['A', ' CB ', 156.332, 124.396, 81.046], ['A', ' CG1', 154.941, 124.288, 81.614], ['A', ' CG2', 156.222, 125.385, 79.925], ['A', ' CD1', 154.653, 123.202, 82.633], ['A', ' H ', 157.735, 122.561, 82.38], ['A', ' HA ', 156.038, 122.588, 79.947], ['A', ' HB ', 156.988, 124.77, 81.828], ['A', ' HG1', 154.73, 125.24, 82.087], ['A', ' HG1', 154.285, 124.176, 80.793], ['A', ' HG2', 155.814, 126.299, 80.306], ['A', ' HG2', 157.182, 125.585, 79.507], ['A', ' HG2', 155.551, 124.996, 79.149], ['A', ' HD1', 153.627, 123.298, 82.95], ['A', ' HD1', 154.785, 122.223, 82.206], ['A', ' HD1', 155.305, 123.316, 83.493]]
[['A', ' N ', 159.201, 123.081, 79.941], ['A', ' CA ', 160.336, 123.316, 79.093], ['A', ' C ', 160.203, 122.703, 77.694], ['A', ' O ', 160.493, 123.415, 76.75], ['A', ' CB ', 161.591, 122.816, 79.763], ['A', ' H ', 159.354, 122.787, 80.899], ['A', ' HA ', 160.432, 124.393, 78.965], ['A', ' HB ', 162.446, 123.038, 79.15], ['A', ' HB ', 161.691, 123.315, 80.699], ['A', ' HB ', 161.558, 121.76, 79.935]]
[['A', ' N ', 159.685, 121.482, 77.439], ['A', ' CA ', 159.596, 120.929, 76.101], ['A', ' C ', 158.758, 121.8, 75.15], ['A', ' O ', 158.832, 121.624, 73.935], ['A', ' CB ', 158.947, 119.57, 76.331], ['A', ' CG ', 159.274, 119.24, 77.756], ['A', ' CD ', 159.232, 120.556, 78.467], ['A', ' HA ', 160.615, 120.811, 75.703], ['A', ' HB ', 157.879, 119.637, 76.125], ['A', ' HB ', 159.362, 118.837, 75.621], ['A', ' HG ', 158.548, 118.521, 78.16], ['A', ' HG ', 160.25, 118.759, 77.822], ['A', ' HD ', 158.206, 120.749, 78.736], ['A', ' HD ', 159.882, 120.531, 79.3]]
[['A', ' N ', 157.928, 122.706, 75.685], ['A', ' CA ', 157.125, 123.554, 74.825], ['A', ' C ', 157.873, 124.826, 74.445], ['A', ' O ', 157.614, 125.402, 73.386], ['A', ' CB ', 155.833, 123.963, 75.513], ['A', ' CG ', 154.955, 122.794, 75.822], ['A', ' OD1', 154.805, 121.908, 75.002], ['A', ' OD2', 154.435, 122.772, 76.912], ['A', ' H ', 157.868, 122.852, 76.69], ['A', ' HA ', 156.887, 123.005, 73.915], ['A', ' HB ', 156.076, 124.479, 76.447], ['A', ' HB ', 155.302, 124.668, 74.889]]
[['A', ' N ', 158.771, 125.297, 75.316], ['A', ' CA ', 159.469, 126.556, 75.006], ['A', ' C ', 160.961, 126.436, 74.723], ['A', ' O ', 161.559, 127.339, 74.137], ['A', ' CB ', 159.243, 127.593, 76.095], ['A', ' CG ', 157.824, 127.985, 76.203], ['A', ' CD1', 157.106, 127.651, 77.293], ['A', ' CD2', 157.194, 128.678, 75.175], ['A', ' CE1', 155.785, 127.99, 77.399], ['A', ' CE2', 155.871, 129.024, 75.271], ['A', ' CZ ', 155.166, 128.677, 76.392], ['A', ' H ', 158.95, 124.762, 76.179], ['A', ' HA ', 159.021, 126.957, 74.099], ['A', ' HB ', 159.566, 127.192, 77.055], ['A', ' HB ', 159.835, 128.48, 75.891], ['A', ' HD1', 157.596, 127.112, 78.09], ['A', ' HD2', 157.755, 128.953, 74.273], ['A', ' HE1', 155.225, 127.71, 78.29], ['A', ' HE2', 155.387, 129.567, 74.456], ['A', ' HZ ', 154.119, 128.942, 76.482]]
[['A', ' N ', 161.559, 125.349, 75.145], ['A', ' CA ', 162.97, 125.11, 74.984], ['A', ' C ', 163.175, 124.252, 73.736], ['A', ' O ', 162.604, 123.171, 73.654], ['A', ' CB ', 163.518, 124.378, 76.218], ['A', ' CG1', 164.967, 124.05, 76.046], ['A', ' CG2', 163.351, 125.233, 77.444], ['A', ' H ', 161.013, 124.642, 75.619], ['A', ' HA ', 163.475, 126.061, 74.922], ['A', ' HB ', 162.971, 123.465, 76.339], ['A', ' HG1', 165.325, 123.523, 76.915], ['A', ' HG1', 165.103, 123.417, 75.183], ['A', ' HG1', 165.529, 124.969, 75.921], ['A', ' HG2', 163.726, 124.704, 78.313], ['A', ' HG2', 163.905, 126.134, 77.329], ['A', ' HG2', 162.301, 125.465, 77.587]]
[['A', ' N ', 163.967, 124.682, 72.75], ['A', ' CA ', 164.247, 123.938, 71.543], ['A', ' C ', 164.812, 122.618, 71.979], ['A', ' O ', 165.543, 122.579, 72.963], ['A', ' CB ', 165.295, 124.795, 70.84], ['A', ' CG ', 165.05, 126.189, 71.363], ['A', ' CD ', 164.595, 126.005, 72.796], ['A', ' HA ', 163.327, 123.812, 70.948], ['A', ' HB ', 166.298, 124.414, 71.067], ['A', ' HB ', 165.167, 124.724, 69.75], ['A', ' HG ', 165.966, 126.794, 71.284], ['A', ' HG ', 164.287, 126.692, 70.747], ['A', ' HD ', 165.431, 126.011, 73.491], ['A', ' HD ', 163.859, 126.801, 72.996]]
[['A', ' N ', 164.592, 121.55, 71.229], ['A', ' CA ', 165.081, 120.253, 71.683], ['A', ' C ', 166.59, 120.221, 71.87], ['A', ' O ', 167.092, 119.518, 72.746], ['A', ' CB ', 164.635, 119.142, 70.72], ['A', ' CG ', 165.14, 119.239, 69.26], ['A', ' CD ', 164.273, 120.104, 68.371], ['A', ' OE1', 163.616, 120.988, 68.884], ['A', ' OE2', 164.266, 119.881, 67.187], ['A', ' H ', 164.021, 121.606, 70.379], ['A', ' HA ', 164.615, 120.043, 72.641], ['A', ' HB ', 164.967, 118.18, 71.111], ['A', ' HB ', 163.546, 119.116, 70.687], ['A', ' HG ', 166.157, 119.611, 69.229], ['A', ' HG ', 165.156, 118.232, 68.847]]
[['A', ' N ', 167.306, 121.077, 71.158], ['A', ' CA ', 168.751, 121.149, 71.23], ['A', ' C ', 169.237, 121.634, 72.584], ['A', ' O ', 170.398, 121.436, 72.941], ['A', ' CB ', 169.256, 122.081, 70.163], ['A', ' CG ', 169.119, 121.508, 68.813], ['A', ' OD1', 169.04, 120.289, 68.626], ['A', ' ND2', 169.074, 122.368, 67.837], ['A', ' H ', 166.831, 121.646, 70.471], ['A', ' HA ', 169.157, 120.149, 71.071], ['A', ' HB ', 168.698, 123.018, 70.209], ['A', ' HB ', 170.304, 122.314, 70.347], ['A', ' HD2', 168.977, 122.047, 66.894], ['A', ' HD2', 169.139, 123.348, 68.026]]
[['A', ' N ', 168.373, 122.332, 73.309], ['A', ' CA ', 168.7, 122.895, 74.598], ['A', ' C ', 168.137, 122.08, 75.743], ['A', ' O ', 168.331, 122.456, 76.901], ['A', ' CB ', 168.148, 124.317, 74.729], ['A', ' CG ', 168.981, 125.479, 74.18], ['A', ' CD1', 169.031, 125.42, 72.65], ['A', ' CD2', 168.351, 126.798, 74.673], ['A', ' H ', 167.414, 122.443, 72.976], ['A', ' HA ', 169.784, 122.923, 74.699], ['A', ' HB ', 167.195, 124.338, 74.203], ['A', ' HB ', 167.966, 124.518, 75.781], ['A', ' HG ', 170.004, 125.406, 74.553], ['A', ' HD1', 169.622, 126.256, 72.279], ['A', ' HD1', 169.491, 124.503, 72.324], ['A', ' HD1', 168.029, 125.486, 72.253], ['A', ' HD2', 168.936, 127.641, 74.307], ['A', ' HD2', 167.339, 126.886, 74.311], ['A', ' HD2', 168.345, 126.812, 75.762]]
[['A', ' N ', 167.408, 120.998, 75.466], ['A', ' CA ', 166.802, 120.279, 76.573], ['A', ' C ', 167.795, 119.628, 77.496], ['A', ' O ', 167.559, 119.555, 78.694], ['A', ' CB ', 165.792, 119.262, 76.084], ['A', ' CG ', 164.485, 119.865, 75.599], ['A', ' SD ', 163.602, 120.79, 76.881], ['A', ' CE ', 163.181, 119.551, 78.072], ['A', ' H ', 167.29, 120.665, 74.503], ['A', ' HA ', 166.256, 121.007, 77.165], ['A', ' HB ', 166.221, 118.73, 75.233], ['A', ' HB ', 165.598, 118.523, 76.856], ['A', ' HG ', 164.714, 120.571, 74.804], ['A', ' HG ', 163.825, 119.096, 75.202], ['A', ' HE ', 162.623, 119.997, 78.886], ['A', ' HE ', 162.577, 118.785, 77.598], ['A', ' HE ', 164.082, 119.107, 78.469]]
[['A', ' N ', 168.927, 119.145, 77.0], ['A', ' CA ', 169.843, 118.526, 77.946], ['A', ' C ', 170.324, 119.566, 78.939], ['A', ' O ', 170.435, 119.291, 80.133], ['A', ' CB ', 171.025, 117.912, 77.236], ['A', ' H ', 169.132, 119.192, 76.011], ['A', ' HA ', 169.304, 117.752, 78.493], ['A', ' HB ', 171.687, 117.452, 77.971], ['A', ' HB ', 170.678, 117.155, 76.534], ['A', ' HB ', 171.568, 118.69, 76.697]]
[['A', ' N ', 170.555, 120.782, 78.453], ['A', ' CA ', 171.043, 121.836, 79.31], ['A', ' C ', 169.945, 122.362, 80.201], ['A', ' O ', 170.197, 122.71, 81.357], ['A', ' CB ', 171.583, 122.983, 78.473], ['A', ' CG ', 172.87, 122.658, 77.738], ['A', ' OD1', 173.557, 121.731, 78.094], ['A', ' OD2', 173.157, 123.36, 76.807], ['A', ' H ', 170.452, 120.946, 77.46], ['A', ' HA ', 171.842, 121.438, 79.933], ['A', ' HB ', 170.827, 123.272, 77.735], ['A', ' HB ', 171.757, 123.847, 79.114]]
[['A', ' N ', 168.725, 122.46, 79.673], ['A', ' CA ', 167.629, 122.964, 80.47], ['A', ' C ', 167.338, 122.01, 81.603], ['A', ' O ', 167.1, 122.443, 82.733], ['A', ' CB ', 166.393, 123.158, 79.619], ['A', ' H ', 168.57, 122.21, 78.696], ['A', ' HA ', 167.926, 123.922, 80.893], ['A', ' HB ', 165.581, 123.552, 80.23], ['A', ' HB ', 166.625, 123.857, 78.82], ['A', ' HB ', 166.096, 122.202, 79.195]]
[['A', ' N ', 167.424, 120.709, 81.323], ['A', ' CA ', 167.175, 119.72, 82.339], ['A', ' C ', 168.284, 119.746, 83.346], ['A', ' O ', 168.032, 119.711, 84.55], ['A', ' CB ', 167.042, 118.31, 81.789], ['A', ' CG1', 165.787, 118.218, 80.935], ['A', ' CG2', 166.969, 117.351, 82.976], ['A', ' CD1', 165.704, 116.957, 80.102], ['A', ' H ', 167.617, 120.4, 80.365], ['A', ' HA ', 166.239, 119.959, 82.824], ['A', ' HB ', 167.898, 118.068, 81.149], ['A', ' HG1', 164.924, 118.274, 81.572], ['A', ' HG1', 165.761, 119.07, 80.266], ['A', ' HG2', 166.854, 116.348, 82.631], ['A', ' HG2', 167.868, 117.394, 83.586], ['A', ' HG2', 166.119, 117.631, 83.587], ['A', ' HD1', 164.788, 116.977, 79.514], ['A', ' HD1', 166.564, 116.915, 79.427], ['A', ' HD1', 165.696, 116.076, 80.73]]
[['A', ' N ', 169.523, 119.794, 82.883], ['A', ' CA ', 170.603, 119.793, 83.824], ['A', ' C ', 170.565, 121.055, 84.667], ['A', ' O ', 170.909, 121.009, 85.851], ['A', ' CB ', 171.913, 119.668, 83.095], ['A', ' CG ', 172.112, 118.304, 82.533], ['A', ' OD1', 171.509, 117.326, 82.978], ['A', ' ND2', 172.956, 118.206, 81.547], ['A', ' H ', 169.725, 119.781, 81.878], ['A', ' HA ', 170.484, 118.942, 84.493], ['A', ' HB ', 171.939, 120.393, 82.279], ['A', ' HB ', 172.734, 119.9, 83.77], ['A', ' HD2', 173.127, 117.318, 81.125], ['A', ' HD2', 173.417, 119.019, 81.197]]
[['A', ' N ', 170.106, 122.171, 84.092], ['A', ' CA ', 170.034, 123.405, 84.844], ['A', ' C ', 168.997, 123.305, 85.938], ['A', ' O ', 169.302, 123.664, 87.074], ['A', ' CB ', 169.695, 124.562, 83.932], ['A', ' OG ', 170.728, 124.8, 83.015], ['A', ' H ', 169.878, 122.178, 83.098], ['A', ' HA ', 171.005, 123.588, 85.302], ['A', ' HB ', 168.773, 124.348, 83.398], ['A', ' HB ', 169.525, 125.454, 84.534], ['A', ' HG ', 170.675, 124.069, 82.364]]
[['A', ' N ', 167.814, 122.736, 85.647], ['A', ' CA ', 166.809, 122.624, 86.7], ['A', ' C ', 167.243, 121.628, 87.749], ['A', ' O ', 166.867, 121.766, 88.908], ['A', ' CB ', 165.388, 122.283, 86.195], ['A', ' CG1', 164.87, 123.399, 85.348], ['A', ' CG2', 165.389, 121.027, 85.41], ['A', ' H ', 167.617, 122.463, 84.677], ['A', ' HA ', 166.716, 123.594, 87.17], ['A', ' HB ', 164.732, 122.179, 87.04], ['A', ' HG1', 163.861, 123.171, 85.009], ['A', ' HG1', 164.854, 124.311, 85.942], ['A', ' HG1', 165.517, 123.535, 84.483], ['A', ' HG2', 164.393, 120.815, 85.059], ['A', ' HG2', 166.025, 121.18, 84.586], ['A', ' HG2', 165.743, 120.186, 85.989]]
[['A', ' N ', 167.998, 120.6, 87.363], ['A', ' CA ', 168.486, 119.661, 88.346], ['A', ' C ', 169.497, 120.34, 89.249], ['A', ' O ', 169.394, 120.282, 90.471], ['A', ' CB ', 169.162, 118.502, 87.655], ['A', ' OG ', 168.251, 117.741, 86.928], ['A', ' H ', 168.208, 120.457, 86.368], ['A', ' HA ', 167.648, 119.309, 88.943], ['A', ' HB ', 169.915, 118.891, 86.981], ['A', ' HB ', 169.677, 117.883, 88.374], ['A', ' HG ', 168.788, 117.173, 86.355]]
[['A', ' N ', 170.4, 121.126, 88.693], ['A', ' CA ', 171.411, 121.74, 89.537], ['A', ' C ', 170.803, 122.71, 90.521], ['A', ' O ', 171.198, 122.747, 91.696], ['A', ' CB ', 172.446, 122.469, 88.683], ['A', ' CG ', 173.584, 123.15, 89.468], ['A', ' CD ', 174.454, 122.184, 90.235], ['A', ' OE1', 174.433, 121.012, 89.936], ['A', ' OE2', 175.152, 122.628, 91.117], ['A', ' H ', 170.464, 121.206, 87.673], ['A', ' HA ', 171.911, 120.95, 90.099], ['A', ' HB ', 172.89, 121.766, 87.977], ['A', ' HB ', 171.94, 123.238, 88.094], ['A', ' HG ', 174.207, 123.694, 88.761], ['A', ' HG ', 173.159, 123.879, 90.159]]
[['A', ' N ', 169.789, 123.451, 90.083], ['A', ' CA ', 169.241, 124.463, 90.957], ['A', ' C ', 168.09, 123.943, 91.777], ['A', ' O ', 167.374, 124.725, 92.393], ['A', ' CB ', 168.784, 125.716, 90.182], ['A', ' CG1', 167.612, 125.399, 89.296], ['A', ' CG2', 169.975, 126.248, 89.311], ['A', ' CD1', 166.969, 126.572, 88.663], ['A', ' H ', 169.481, 123.368, 89.107], ['A', ' HA ', 170.018, 124.746, 91.652], ['A', ' HB ', 168.47, 126.46, 90.894], ['A', ' HG1', 167.93, 124.757, 88.55], ['A', ' HG1', 166.843, 124.894, 89.877], ['A', ' HG2', 169.703, 127.145, 88.774], ['A', ' HG2', 170.817, 126.475, 89.929], ['A', ' HG2', 170.271, 125.485, 88.595], ['A', ' HD1', 166.135, 126.222, 88.055], ['A', ' HD1', 166.615, 127.232, 89.439], ['A', ' HD1', 167.661, 127.099, 88.033]]
[['A', ' N ', 167.882, 122.636, 91.746], ['A', ' CA ', 166.885, 122.005, 92.568], ['A', ' C ', 167.636, 121.175, 93.59], ['A', ' O ', 167.228, 121.107, 94.742], ['A', ' CB ', 165.934, 121.187, 91.731], ['A', ' CG ', 164.783, 120.574, 92.477], ['A', ' CD ', 163.786, 119.944, 91.583], ['A', ' NE ', 164.304, 118.763, 90.88], ['A', ' CZ ', 164.644, 118.707, 89.572], ['A', ' NH1', 164.558, 119.759, 88.804], ['A', ' NH2', 165.074, 117.581, 89.056], ['A', ' H ', 168.47, 122.044, 91.165], ['A', ' HA ', 166.316, 122.769, 93.091], ['A', ' HB ', 165.496, 121.84, 90.988], ['A', ' HB ', 166.486, 120.432, 91.2], ['A', ' HG ', 165.138, 119.843, 93.175], ['A', ' HG ', 164.292, 121.346, 93.014], ['A', ' HD ', 162.937, 119.627, 92.191], ['A', ' HD ', 163.44, 120.672, 90.863], ['A', ' HE ', 164.357, 117.891, 91.41], ['A', ' HH1', 164.253, 120.642, 89.182], ['A', ' HH1', 164.836, 119.688, 87.829], ['A', ' HH2', 165.175, 116.739, 89.639], ['A', ' HH2', 165.32, 117.546, 88.078]]
[['A', ' N ', 168.771, 120.577, 93.184], ['A', ' CA ', 169.619, 119.816, 94.09], ['A', ' C ', 170.11, 120.797, 95.142], ['A', ' O ', 169.955, 120.599, 96.352], ['A', ' CB ', 170.767, 119.19, 93.307], ['A', ' CG ', 171.711, 118.337, 94.103], ['A', ' CD ', 172.712, 117.578, 93.201], ['A', ' CE ', 173.757, 118.504, 92.556], ['A', ' NZ ', 174.834, 117.73, 91.836], ['A', ' H ', 169.037, 120.615, 92.207], ['A', ' HA ', 169.038, 119.042, 94.577], ['A', ' HB ', 170.375, 118.606, 92.494], ['A', ' HB ', 171.345, 119.996, 92.855], ['A', ' HG ', 172.271, 118.98, 94.756], ['A', ' HG ', 171.148, 117.628, 94.711], ['A', ' HD ', 173.232, 116.828, 93.798], ['A', ' HD ', 172.174, 117.065, 92.406], ['A', ' HE ', 173.271, 119.162, 91.835], ['A', ' HE ', 174.22, 119.112, 93.334], ['A', ' HZ ', 175.501, 118.369, 91.431], ['A', ' HZ ', 175.309, 117.12, 92.478], ['A', ' HZ ', 174.443, 117.145, 91.071]]
[['A', ' N ', 170.607, 121.934, 94.693], ['A', ' CA ', 170.941, 122.958, 95.642], ['A', ' C ', 169.626, 123.618, 95.924], ['A', ' O ', 168.972, 124.116, 95.024], ['A', ' CB ', 172.026, 123.867, 95.151], ['A', ' CG ', 173.315, 123.167, 95.171], ['A', ' OD1', 173.629, 122.583, 96.227], ['A', ' ND2', 174.049, 123.19, 94.094], ['A', ' H ', 170.748, 122.087, 93.69], ['A', ' HA ', 171.283, 122.506, 96.566], ['A', ' HB ', 171.803, 124.167, 94.135], ['A', ' HB ', 172.09, 124.758, 95.773], ['A', ' HD2', 174.931, 122.72, 94.065], ['A', ' HD2', 173.739, 123.691, 93.278]]
[['A', ' N ', 169.235, 123.542, 97.189], ['A', ' CA ', 167.93, 123.922, 97.747], ['A', ' C ', 167.128, 122.654, 98.067], ['A', ' O ', 166.155, 122.7, 98.831], ['A', ' CB ', 167.11, 124.809, 96.807], ['A', ' H ', 169.928, 123.155, 97.809], ['A', ' HA ', 168.107, 124.471, 98.666], ['A', ' HB ', 166.172, 125.068, 97.282], ['A', ' HB ', 167.66, 125.721, 96.578], ['A', ' HB ', 166.878, 124.283, 95.885]]
[['A', ' N ', 167.574, 121.494, 97.563], ['A', ' CA ', 167.005, 120.233, 98.018], ['A', ' C ', 167.55, 120.048, 99.38], ['A', ' O ', 166.833, 119.692, 100.306], ['A', ' CB ', 167.458, 119.019, 97.203], ['A', ' CG ', 166.808, 117.708, 97.6], ['A', ' CD ', 165.366, 117.707, 97.326], ['A', ' OE1', 165.017, 117.957, 96.172], ['A', ' NE2', 164.519, 117.414, 98.316], ['A', ' H ', 168.373, 121.467, 96.929], ['A', ' HA ', 165.919, 120.299, 98.057], ['A', ' HB ', 167.252, 119.18, 96.163], ['A', ' HB ', 168.528, 118.88, 97.31], ['A', ' HG ', 167.263, 116.9, 97.036], ['A', ' HG ', 166.951, 117.536, 98.667], ['A', ' HE2', 163.534, 117.391, 98.131], ['A', ' HE2', 164.865, 117.185, 99.27]]
[['A', ' N ', 168.828, 120.411, 99.507], ['A', ' CA ', 169.556, 120.253, 100.747], ['A', ' C ', 169.009, 121.185, 101.776], ['A', ' O ', 168.941, 120.849, 102.944], ['A', ' CB ', 171.026, 120.588, 100.571], ['A', ' CG ', 171.753, 119.658, 99.714], ['A', ' CD1', 172.121, 120.062, 98.469], ['A', ' CD2', 172.06, 118.4, 100.153], ['A', ' CE1', 172.795, 119.226, 97.645], ['A', ' CE2', 172.744, 117.545, 99.323], ['A', ' CZ ', 173.113, 117.961, 98.066], ['A', ' OH ', 173.793, 117.105, 97.226], ['A', ' H ', 169.305, 120.687, 98.645], ['A', ' HA ', 169.442, 119.23, 101.101], ['A', ' HB ', 171.127, 121.59, 100.155], ['A', ' HB ', 171.51, 120.591, 101.548], ['A', ' HD1', 171.878, 121.057, 98.131], ['A', ' HD2', 171.765, 118.077, 101.153], ['A', ' HE1', 173.083, 119.571, 96.662], ['A', ' HE2', 172.991, 116.538, 99.662], ['A', ' HH ', 173.818, 116.231, 97.616]]
[['A', ' N ', 168.572, 122.354, 101.371], ['A', ' CA ', 168.064, 123.239, 102.386], ['A', ' C ', 166.856, 122.652, 102.985], ['A', ' O ', 166.749, 122.639, 104.207], ['A', ' CB ', 167.709, 124.609, 101.849], ['A', ' CG1', 166.973, 125.437, 102.914], ['A', ' CG2', 168.925, 125.316, 101.474], ['A', ' H ', 168.629, 122.603, 100.4], ['A', ' HA ', 168.793, 123.344, 103.175], ['A', ' HB ', 167.076, 124.489, 100.997], ['A', ' HG1', 166.731, 126.417, 102.504], ['A', ' HG1', 166.04, 124.956, 103.218], ['A', ' HG1', 167.61, 125.561, 103.788], ['A', ' HG2', 168.635, 126.265, 101.102], ['A', ' HG2', 169.547, 125.448, 102.342], ['A', ' HG2', 169.471, 124.769, 100.716]]
[['A', ' N ', 165.941, 122.146, 102.174], ['A', ' CA ', 164.789, 121.622, 102.841], ['A', ' C ', 165.168, 120.347, 103.566], ['A', ' O ', 164.87, 120.188, 104.743], ['A', ' CB ', 163.635, 121.322, 101.932], ['A', ' CG1', 162.545, 120.695, 102.781], ['A', ' CG2', 163.177, 122.567, 101.286], ['A', ' H ', 166.041, 122.179, 101.151], ['A', ' HA ', 164.432, 122.365, 103.532], ['A', ' HB ', 163.938, 120.595, 101.174], ['A', ' HG1', 161.734, 120.463, 102.166], ['A', ' HG1', 162.88, 119.788, 103.267], ['A', ' HG1', 162.233, 121.404, 103.546], ['A', ' HG2', 162.33, 122.356, 100.641], ['A', ' HG2', 162.878, 123.28, 102.053], ['A', ' HG2', 163.984, 122.994, 100.693]]
[['A', ' N ', 165.899, 119.446, 102.913], ['A', ' CA ', 166.191, 118.184, 103.561], ['A', ' C ', 166.902, 118.371, 104.879], ['A', ' O ', 166.66, 117.583, 105.785], ['A', ' CB ', 167.079, 117.254, 102.706], ['A', ' CG ', 166.415, 116.589, 101.441], ['A', ' OD1', 165.23, 116.7, 101.252], ['A', ' OD2', 167.091, 115.889, 100.728], ['A', ' H ', 166.178, 119.6, 101.949], ['A', ' HA ', 165.242, 117.688, 103.762], ['A', ' HB ', 167.931, 117.838, 102.359], ['A', ' HB ', 167.477, 116.474, 103.34]]
[['A', ' N ', 167.79, 119.364, 104.988], ['A', ' CA ', 168.506, 119.644, 106.22], ['A', ' C ', 167.672, 120.377, 107.268], ['A', ' O ', 167.907, 120.191, 108.454], ['A', ' CB ', 169.733, 120.503, 105.932], ['A', ' CG ', 170.852, 119.856, 105.134], ['A', ' SD ', 171.593, 118.549, 105.952], ['A', ' CE ', 172.501, 117.732, 104.631], ['A', ' H ', 167.991, 119.943, 104.176], ['A', ' HA ', 168.814, 118.694, 106.647], ['A', ' HB ', 169.4, 121.355, 105.355], ['A', ' HB ', 170.147, 120.887, 106.868], ['A', ' HG ', 170.471, 119.486, 104.191], ['A', ' HG ', 171.618, 120.59, 104.934], ['A', ' HE ', 173.037, 116.867, 105.039], ['A', ' HE ', 171.805, 117.398, 103.862], ['A', ' HE ', 173.219, 118.428, 104.193]]
[['A', ' N ', 166.731, 121.231, 106.864], ['A', ' CA ', 165.947, 121.98, 107.848], ['A', ' C ', 164.713, 121.243, 108.311], ['A', ' O ', 164.301, 121.36, 109.456], ['A', ' CB ', 165.56, 123.375, 107.319], ['A', ' CG1', 164.523, 123.345, 106.266], ['A', ' CG2', 165.024, 124.183, 108.417], ['A', ' H ', 166.582, 121.388, 105.861], ['A', ' HA ', 166.583, 122.138, 108.719], ['A', ' HB ', 166.452, 123.816, 106.881], ['A', ' HG1', 164.346, 124.356, 105.912], ['A', ' HG1', 164.865, 122.767, 105.505], ['A', ' HG1', 163.591, 122.942, 106.629], ['A', ' HG2', 164.782, 125.172, 108.035], ['A', ' HG2', 164.129, 123.724, 108.804], ['A', ' HG2', 165.75, 124.253, 109.21]]
[['A', ' N ', 164.079, 120.551, 107.401], ['A', ' CA ', 162.852, 119.856, 107.645], ['A', ' C ', 163.028, 118.507, 107.011], ['A', ' O ', 162.704, 118.303, 105.842], ['A', ' CB ', 161.677, 120.633, 107.096], ['A', ' H ', 164.478, 120.495, 106.468], ['A', ' HA ', 162.738, 119.727, 108.711], ['A', ' HB ', 160.764, 120.108, 107.301], ['A', ' HB ', 161.64, 121.602, 107.578], ['A', ' HB ', 161.801, 120.765, 106.024]]
[['A', ' N ', 163.604, 117.619, 107.802], ['A', ' CA ', 164.126, 116.346, 107.355], ['A', ' C ', 163.303, 115.643, 106.317], ['A', ' O ', 162.151, 115.287, 106.548], ['A', ' H ', 163.781, 117.909, 108.753], ['A', ' HA ', 165.133, 116.469, 106.996], ['A', ' HA ', 164.213, 115.695, 108.223]]
[['A', ' N ', 163.975, 115.362, 105.196], ['A', ' CA ', 163.401, 114.663, 104.034], ['A', ' C ', 162.382, 115.54, 103.334], ['A', ' O ', 161.183, 115.377, 103.54], ['A', ' CB ', 162.727, 113.34, 104.431], ['A', ' CG ', 163.637, 112.444, 105.179], ['A', ' CD ', 163.194, 111.046, 105.336], ['A', ' OE1', 162.126, 110.708, 104.911], ['A', ' OE2', 163.973, 110.293, 105.886], ['A', ' H ', 164.919, 115.76, 105.163], ['A', ' HA ', 164.206, 114.454, 103.326], ['A', ' HB ', 161.823, 113.506, 105.009], ['A', ' HB ', 162.429, 112.812, 103.527], ['A', ' HG ', 164.548, 112.465, 104.688], ['A', ' HG ', 163.794, 112.858, 106.169]]
[['A', ' N ', 162.845, 116.423, 102.466], ['A', ' CA ', 162.018, 117.437, 101.861], ['A', ' C ', 160.826, 117.006, 101.027], ['A', ' O ', 159.912, 117.804, 100.848], ['A', ' H ', 163.839, 116.46, 102.241], ['A', ' HA ', 161.635, 118.047, 102.672], ['A', ' HA ', 162.661, 118.084, 101.265]]
[['A', ' N ', 160.761, 115.784, 100.514], ['A', ' CA ', 159.559, 115.499, 99.749], ['A', ' C ', 158.361, 115.484, 100.711], ['A', ' O ', 157.318, 116.01, 100.383], ['A', ' CB ', 159.63, 114.205, 98.953], ['A', ' CG1', 160.701, 114.311, 97.893], ['A', ' CG2', 158.272, 114.053, 98.219], ['A', ' CD1', 161.045, 112.998, 97.258], ['A', ' H ', 161.505, 115.114, 100.63], ['A', ' HA ', 159.4, 116.307, 99.035], ['A', ' HB ', 159.834, 113.366, 99.599], ['A', ' HG1', 160.362, 114.991, 97.11], ['A', ' HG1', 161.611, 114.722, 98.332], ['A', ' HG2', 158.235, 113.166, 97.605], ['A', ' HG2', 157.49, 114.003, 98.918], ['A', ' HG2', 158.11, 114.925, 97.58], ['A', ' HD1', 161.814, 113.153, 96.508], ['A', ' HD1', 161.41, 112.32, 98.014], ['A', ' HD1', 160.184, 112.573, 96.789]]
[['A', ' N ', 158.47, 114.845, 101.868], ['A', ' CA ', 157.372, 114.845, 102.84], ['A', ' C ', 157.987, 115.033, 104.215], ['A', ' O ', 158.146, 114.054, 104.934], ['A', ' CB ', 156.517, 113.576, 102.802], ['A', ' CG ', 155.922, 113.343, 101.486], ['A', ' ND1', 154.934, 114.135, 100.944], ['A', ' CD2', 156.139, 112.38, 100.612], ['A', ' CE1', 154.629, 113.687, 99.779], ['A', ' NE2', 155.34, 112.613, 99.549], ['A', ' H ', 159.356, 114.418, 102.11], ['A', ' HA ', 156.692, 115.667, 102.642], ['A', ' HB ', 157.131, 112.711, 103.061], ['A', ' HB ', 155.715, 113.646, 103.534], ['A', ' HD1', 154.422, 114.926, 101.323], ['A', ' HD2', 156.783, 111.536, 100.618], ['A', ' HE1', 153.869, 114.193, 99.198]]
[['A', ' N ', 158.354, 116.261, 104.6], ['A', ' CA ', 159.181, 116.567, 105.749], ['A', ' C ', 158.715, 115.957, 107.056], ['A', ' O ', 157.554, 116.073, 107.44], ['A', ' CB ', 159.041, 118.071, 105.828], ['A', ' CG ', 158.776, 118.504, 104.441], ['A', ' CD ', 157.921, 117.441, 103.849], ['A', ' HA ', 160.221, 116.289, 105.538], ['A', ' HB ', 158.268, 118.354, 106.564], ['A', ' HB ', 159.98, 118.456, 106.181], ['A', ' HG ', 158.269, 119.462, 104.48], ['A', ' HG ', 159.717, 118.653, 103.897], ['A', ' HD ', 156.861, 117.645, 104.009], ['A', ' HD ', 158.179, 117.372, 102.784]]
[['A', ' N ', 159.64, 115.37, 107.789], ['A', ' CA ', 159.321, 114.742, 109.05], ['A', ' C ', 159.367, 115.702, 110.225], ['A', ' O ', 158.741, 115.451, 111.259], ['A', ' CB ', 160.271, 113.612, 109.251], ['A', ' OG ', 161.576, 114.091, 109.383], ['A', ' H ', 160.594, 115.3, 107.43], ['A', ' HA ', 158.313, 114.334, 108.975], ['A', ' HB ', 159.979, 113.064, 110.136], ['A', ' HB ', 160.21, 112.932, 108.4], ['A', ' HG ', 162.145, 113.333, 109.214]]
[['A', ' N ', 160.092, 116.807, 110.068], ['A', ' CA ', 160.15, 117.835, 111.092], ['A', ' C ', 158.995, 118.771, 110.759], ['A', ' O ', 158.29, 118.52, 109.791], ['A', ' CB ', 161.52, 118.523, 111.17], ['A', ' CG ', 161.82, 119.189, 112.578], ['A', ' OD1', 160.863, 119.576, 113.199], ['A', ' OD2', 162.948, 119.31, 112.997], ['A', ' H ', 160.627, 116.916, 109.219], ['A', ' HA ', 159.947, 117.398, 112.061], ['A', ' HB ', 162.308, 117.813, 110.922], ['A', ' HB ', 161.536, 119.31, 110.439]]
[['A', ' N ', 158.836, 119.809, 111.561], ['A', ' CA ', 157.747, 120.779, 111.533], ['A', ' C ', 156.57, 120.071, 112.164], ['A', ' O ', 155.669, 119.61, 111.47], ['A', ' CB ', 157.35, 121.271, 110.124], ['A', ' CG1', 156.245, 122.328, 110.25], ['A', ' CG2', 158.537, 121.867, 109.422], ['A', ' H ', 159.515, 119.863, 112.302], ['A', ' HA ', 158.006, 121.643, 112.138], ['A', ' HB ', 156.943, 120.443, 109.545], ['A', ' HG1', 155.966, 122.646, 109.267], ['A', ' HG1', 155.381, 121.919, 110.735], ['A', ' HG1', 156.61, 123.178, 110.82], ['A', ' HG2', 158.242, 122.216, 108.433], ['A', ' HG2', 158.888, 122.693, 110.008], ['A', ' HG2', 159.325, 121.129, 109.316]]
[['A', ' N ', 156.572, 119.958, 113.484], ['A', ' CA ', 155.515, 119.224, 114.139], ['A', ' C ', 154.765, 119.991, 115.213], ['A', ' O ', 155.171, 119.972, 116.375], ['A', ' CB ', 156.089, 117.974, 114.783], ['A', ' CG ', 156.764, 117.013, 113.837], ['A', ' CD ', 157.083, 115.723, 114.505], ['A', ' NE ', 158.077, 115.823, 115.526], ['A', ' CZ ', 159.399, 115.759, 115.314], ['A', ' NH1', 159.888, 115.602, 114.098], ['A', ' NH2', 160.223, 115.845, 116.346], ['A', ' H ', 157.33, 120.349, 114.021], ['A', ' HA ', 154.79, 118.915, 113.383], ['A', ' HB ', 156.816, 118.254, 115.543], ['A', ' HB ', 155.284, 117.424, 115.284], ['A', ' HG ', 156.117, 116.827, 112.985], ['A', ' HG ', 157.696, 117.45, 113.483], ['A', ' HD ', 156.175, 115.338, 114.97], ['A', ' HD ', 157.429, 115.011, 113.764], ['A', ' HE ', 157.754, 115.937, 116.48], ['A', ' HH1', 159.267, 115.525, 113.268], ['A', ' HH1', 160.886, 115.544, 113.967], ['A', ' HH2', 159.853, 115.956, 117.281], ['A', ' HH2', 161.223, 115.795, 116.204]]
[['A', ' N ', 153.692, 120.683, 114.824], ['A', ' CA ', 152.75, 121.429, 115.695], ['A', ' C ', 153.29, 122.596, 116.52], ['A', ' O ', 152.646, 123.627, 116.618], ['A', ' CB ', 151.992, 120.478, 116.631], ['A', ' CG1', 151.242, 119.38, 115.807], ['A', ' CG2', 150.96, 121.289, 117.461], ['A', ' CD1', 150.164, 119.862, 114.817], ['A', ' H ', 153.489, 120.649, 113.832], ['A', ' HA ', 152.004, 121.869, 115.044], ['A', ' HB ', 152.686, 119.972, 117.304], ['A', ' HG1', 151.99, 118.816, 115.252], ['A', ' HG1', 150.77, 118.694, 116.517], ['A', ' HG2', 150.413, 120.614, 118.113], ['A', ' HG2', 151.452, 122.032, 118.067], ['A', ' HG2', 150.263, 121.8, 116.81], ['A', ' HD1', 149.73, 119.015, 114.321], ['A', ' HD1', 149.392, 120.381, 115.339], ['A', ' HD1', 150.58, 120.511, 114.076]]
[['A', ' N ', 154.414, 122.402, 117.179], ['A', ' CA ', 155.024, 123.4, 118.038], ['A', ' C ', 155.95, 124.319, 117.269], ['A', ' O ', 156.65, 125.133, 117.86], ['A', ' H ', 154.857, 121.507, 117.054], ['A', ' HA ', 154.24, 123.983, 118.508], ['A', ' HA ', 155.565, 122.909, 118.84]]
[['A', ' N ', 155.996, 124.16, 115.957], ['A', ' CA ', 156.846, 125.007, 115.142], ['A', ' C ', 158.281, 124.563, 114.933], ['A', ' O ', 159.186, 125.356, 115.139], ['A', ' H ', 155.399, 123.463, 115.542], ['A', ' HA ', 156.373, 125.1, 114.167], ['A', ' HA ', 156.849, 126.001, 115.568]]
[['A', ' N ', 158.472, 123.323, 114.483], ['A', ' CA ', 159.793, 122.737, 114.194], ['A', ' C ', 160.43, 122.229, 115.468], ['A', ' O ', 160.363, 122.875, 116.5], ['A', ' CB ', 160.714, 123.783, 113.537], ['A', ' CG ', 161.987, 123.266, 112.937], ['A', ' SD ', 161.709, 122.305, 111.484], ['A', ' CE ', 161.488, 123.544, 110.271], ['A', ' H ', 157.648, 122.764, 114.363], ['A', ' HA ', 159.686, 121.884, 113.534], ['A', ' HB ', 160.165, 124.355, 112.798], ['A', ' HB ', 161.07, 124.465, 114.261], ['A', ' HG ', 162.629, 124.104, 112.675], ['A', ' HG ', 162.529, 122.65, 113.657], ['A', ' HE ', 161.319, 123.089, 109.305], ['A', ' HE ', 160.647, 124.182, 110.524], ['A', ' HE ', 162.371, 124.129, 110.224]]
[['A', ' N ', 161.004, 121.033, 115.428], ['A', ' CA ', 161.648, 120.471, 116.59], ['A', ' C ', 163.114, 120.858, 116.705], ['A', ' O ', 163.566, 121.32, 117.756], ['A', ' CB ', 161.519, 118.964, 116.553], ['A', ' H ', 161.026, 120.497, 114.566], ['A', ' HA ', 161.143, 120.832, 117.463], ['A', ' HB ', 161.97, 118.537, 117.445], ['A', ' HB ', 160.468, 118.698, 116.506], ['A', ' HB ', 162.035, 118.582, 115.666]]
[['A', ' N ', 163.862, 120.697, 115.624], ['A', ' CA ', 165.297, 120.931, 115.685], ['A', ' C ', 165.837, 122.195, 115.031], ['A', ' O ', 165.227, 122.765, 114.132], ['A', ' CB ', 165.974, 119.728, 115.091], ['A', ' CG ', 165.904, 118.517, 115.974], ['A', ' OD1', 166.522, 118.536, 117.028], ['A', ' OD2', 165.26, 117.554, 115.617], ['A', ' H ', 163.454, 120.32, 114.749], ['A', ' HA ', 165.572, 120.977, 116.737], ['A', ' HB ', 165.48, 119.487, 114.142], ['A', ' HB ', 167.015, 119.969, 114.888]]
[['A', ' N ', 167.027, 122.611, 115.475], ['A', ' CA ', 167.754, 123.714, 114.846], ['A', ' C ', 168.652, 123.2, 113.763], ['A', ' O ', 169.115, 122.062, 113.811], ['A', ' CB ', 168.669, 124.466, 115.805], ['A', ' CG ', 168.02, 125.368, 116.738], ['A', ' OD1', 167.404, 126.342, 116.292], ['A', ' ND2', 168.132, 125.08, 118.012], ['A', ' H ', 167.446, 122.114, 116.251], ['A', ' HA ', 167.039, 124.403, 114.395], ['A', ' HB ', 169.247, 123.743, 116.379], ['A', ' HB ', 169.392, 125.05, 115.226], ['A', ' HD2', 167.69, 125.656, 118.729], ['A', ' HD2', 168.653, 124.276, 118.294]]
[['A', ' N ', 168.959, 124.047, 112.815], ['A', ' CA ', 169.995, 123.697, 111.871], ['A', ' C ', 171.248, 123.936, 112.677], ['A', ' O ', 171.369, 125.016, 113.246], ['A', ' CB ', 169.972, 124.616, 110.628], ['A', ' CG1', 168.672, 124.442, 109.846], ['A', ' CG2', 171.121, 124.359, 109.778], ['A', ' CD1', 168.488, 125.451, 108.708], ['A', ' H ', 168.513, 124.956, 112.806], ['A', ' HA ', 169.934, 122.646, 111.586], ['A', ' HB ', 170.021, 125.648, 110.963], ['A', ' HG1', 168.64, 123.433, 109.431], ['A', ' HG1', 167.836, 124.556, 110.535], ['A', ' HG2', 171.146, 125.014, 108.932], ['A', ' HG2', 172.022, 124.507, 110.353], ['A', ' HG2', 171.048, 123.339, 109.44], ['A', ' HD1', 167.564, 125.283, 108.217], ['A', ' HD1', 168.491, 126.445, 109.097], ['A', ' HD1', 169.267, 125.362, 107.971]]
[['A', ' N ', 172.172, 122.986, 112.752], ['A', ' CA ', 173.342, 123.268, 113.587], ['A', ' C ', 174.385, 124.11, 112.88], ['A', ' O ', 174.312, 124.361, 111.667], ['A', ' CB ', 174.028, 122.005, 114.081], ['A', ' OG1', 174.973, 122.376, 115.097], ['A', ' CG2', 174.76, 121.344, 112.934], ['A', ' H ', 172.023, 122.08, 112.286], ['A', ' HA ', 173.005, 123.82, 114.465], ['A', ' HB ', 173.286, 121.319, 114.494], ['A', ' HG1', 175.282, 121.588, 115.558], ['A', ' HG2', 175.255, 120.442, 113.278], ['A', ' HG2', 174.045, 121.096, 112.161], ['A', ' HG2', 175.498, 121.994, 112.527]]
[['A', ' N ', 175.427, 124.509, 113.605], ['A', ' CA ', 176.441, 125.363, 112.987], ['A', ' C ', 177.503, 124.544, 112.248], ['A', ' O ', 178.669, 124.465, 112.625], ['A', ' CB ', 177.09, 126.276, 114.02], ['A', ' CG ', 177.958, 127.368, 113.406], ['A', ' CD ', 178.621, 128.26, 114.413], ['A', ' OE1', 178.683, 127.901, 115.563], ['A', ' OE2', 179.034, 129.336, 114.03], ['A', ' H ', 175.483, 124.225, 114.582], ['A', ' HA ', 175.948, 126.001, 112.257], ['A', ' HB ', 176.315, 126.758, 114.618], ['A', ' HB ', 177.708, 125.685, 114.696], ['A', ' HG ', 178.731, 126.921, 112.793], ['A', ' HG ', 177.329, 127.975, 112.756]]
[['A', ' N ', 177.038, 123.964, 111.181], ['A', ' CA ', 177.723, 123.124, 110.225], ['A', ' C ', 176.806, 123.117, 109.058], ['A', ' O ', 177.151, 123.577, 107.972], ['A', ' CB ', 177.95, 121.693, 110.742], ['A', ' CG ', 178.607, 120.67, 109.754], ['A', ' CD1', 180.003, 121.123, 109.335], ['A', ' CD2', 178.655, 119.296, 110.441], ['A', ' H ', 176.045, 124.131, 111.058], ['A', ' HA ', 178.667, 123.588, 109.947], ['A', ' HB ', 178.572, 121.744, 111.635], ['A', ' HB ', 177.002, 121.262, 111.02], ['A', ' HG ', 177.993, 120.585, 108.853], ['A', ' HD1', 180.431, 120.388, 108.655], ['A', ' HD1', 179.951, 122.083, 108.827], ['A', ' HD1', 180.638, 121.212, 110.215], ['A', ' HD2', 179.086, 118.562, 109.758], ['A', ' HD2', 179.262, 119.35, 111.345], ['A', ' HD2', 177.645, 118.989, 110.706]]
[['A', ' N ', 175.601, 122.636, 109.311], ['A', ' CA ', 174.578, 122.602, 108.311], ['A', ' C ', 174.233, 124.019, 107.865], ['A', ' O ', 174.078, 124.263, 106.676], ['A', ' CB ', 173.361, 121.909, 108.877], ['A', ' H ', 175.406, 122.253, 110.228], ['A', ' HA ', 174.949, 122.052, 107.447], ['A', ' HB ', 172.569, 121.869, 108.131], ['A', ' HB ', 173.599, 120.929, 109.189], ['A', ' HB ', 173.038, 122.452, 109.74]]
[['A', ' N ', 174.192, 124.977, 108.797], ['A', ' CA ', 173.866, 126.349, 108.435], ['A', ' C ', 174.878, 126.902, 107.466], ['A', ' O ', 174.517, 127.539, 106.478], ['A', ' CB ', 173.839, 127.222, 109.676], ['A', ' CG ', 173.566, 128.719, 109.477], ['A', ' CD ', 173.604, 129.39, 110.799], ['A', ' NE ', 173.483, 130.833, 110.766], ['A', ' CZ ', 174.493, 131.69, 110.477], ['A', ' NH1', 175.694, 131.252, 110.132], ['A', ' NH2', 174.256, 132.976, 110.549], ['A', ' H ', 174.323, 124.737, 109.779], ['A', ' HA ', 172.885, 126.363, 107.963], ['A', ' HB ', 173.076, 126.845, 110.359], ['A', ' HB ', 174.794, 127.132, 110.194], ['A', ' HG ', 174.309, 129.166, 108.818], ['A', ' HG ', 172.574, 128.869, 109.059], ['A', ' HD ', 172.739, 129.028, 111.339], ['A', ' HD ', 174.508, 129.125, 111.343], ['A', ' HE ', 172.569, 131.274, 111.086], ['A', ' HH1', 175.878, 130.267, 110.078], ['A', ' HH1', 176.423, 131.916, 109.921], ['A', ' HH2', 173.309, 133.276, 110.82], ['A', ' HH2', 174.961, 133.656, 110.335]]
[['A', ' N ', 176.15, 126.669, 107.753], ['A', ' CA ', 177.216, 127.17, 106.915], ['A', ' C ', 177.267, 126.47, 105.574], ['A', ' O ', 177.476, 127.12, 104.545], ['A', ' CB ', 178.542, 127.046, 107.642], ['A', ' CG ', 178.683, 128.02, 108.796], ['A', ' CD ', 179.998, 127.842, 109.533], ['A', ' CE ', 180.149, 128.883, 110.637], ['A', ' NZ ', 181.383, 128.673, 111.448], ['A', ' H ', 176.367, 126.148, 108.59], ['A', ' HA ', 177.029, 128.227, 106.727], ['A', ' HB ', 178.644, 126.03, 108.036], ['A', ' HB ', 179.361, 127.214, 106.944], ['A', ' HG ', 178.622, 129.039, 108.412], ['A', ' HG ', 177.862, 127.868, 109.497], ['A', ' HD ', 180.03, 126.846, 109.984], ['A', ' HD ', 180.829, 127.938, 108.836], ['A', ' HE ', 180.192, 129.871, 110.186], ['A', ' HE ', 179.286, 128.837, 111.291], ['A', ' HZ ', 181.43, 129.39, 112.167], ['A', ' HZ ', 181.343, 127.763, 111.889], ['A', ' HZ ', 182.199, 128.729, 110.858]]
[['A', ' N ', 177.045, 125.159, 105.555], ['A', ' CA ', 177.081, 124.467, 104.288], ['A', ' C ', 175.945, 124.906, 103.411], ['A', ' O ', 176.138, 125.162, 102.22], ['A', ' CB ', 176.974, 122.972, 104.477], ['A', ' CG ', 178.181, 122.339, 105.035], ['A', ' CD ', 178.033, 120.874, 105.183], ['A', ' NE ', 179.219, 120.329, 105.758], ['A', ' CZ ', 180.345, 120.061, 105.07], ['A', ' NH1', 180.405, 120.266, 103.771], ['A', ' NH2', 181.399, 119.599, 105.694], ['A', ' H ', 176.901, 124.639, 106.424], ['A', ' HA ', 178.023, 124.698, 103.792], ['A', ' HB ', 176.148, 122.756, 105.157], ['A', ' HB ', 176.749, 122.495, 103.523], ['A', ' HG ', 179.015, 122.551, 104.376], ['A', ' HG ', 178.394, 122.754, 106.012], ['A', ' HD ', 177.204, 120.661, 105.866], ['A', ' HD ', 177.843, 120.39, 104.224], ['A', ' HE ', 179.213, 120.137, 106.754], ['A', ' HH1', 179.603, 120.609, 103.27], ['A', ' HH1', 181.254, 120.053, 103.268], ['A', ' HH2', 181.365, 119.418, 106.686], ['A', ' HH2', 182.249, 119.395, 105.178]]
[['A', ' N ', 174.763, 125.054, 103.991], ['A', ' CA ', 173.639, 125.447, 103.191], ['A', ' C ', 173.808, 126.846, 102.704], ['A', ' O ', 173.446, 127.147, 101.566], ['A', ' CB ', 172.356, 125.383, 103.982], ['A', ' CG ', 171.853, 124.037, 104.413], ['A', ' CD1', 170.621, 124.303, 105.28], ['A', ' CD2', 171.593, 123.151, 103.195], ['A', ' H ', 174.631, 124.84, 104.984], ['A', ' HA ', 173.588, 124.807, 102.319], ['A', ' HB ', 172.505, 125.971, 104.893], ['A', ' HB ', 171.581, 125.855, 103.399], ['A', ' HG ', 172.572, 123.535, 105.033], ['A', ' HD1', 170.222, 123.38, 105.647], ['A', ' HD1', 170.913, 124.925, 106.125], ['A', ' HD1', 169.863, 124.818, 104.704], ['A', ' HD2', 171.203, 122.21, 103.514], ['A', ' HD2', 170.9, 123.614, 102.549], ['A', ' HD2', 172.507, 122.974, 102.651]]
[['A', ' N ', 174.371, 127.701, 103.543], ['A', ' CA ', 174.567, 129.063, 103.167], ['A', ' C ', 175.434, 129.126, 101.952], ['A', ' O ', 175.105, 129.806, 100.976], ['A', ' CB ', 175.236, 129.827, 104.277], ['A', ' CG ', 175.415, 131.18, 103.912], ['A', ' CD1', 174.358, 131.976, 104.042], ['A', ' CD2', 176.604, 131.651, 103.418], ['A', ' CE1', 174.422, 133.237, 103.712], ['A', ' CE2', 176.687, 132.963, 103.067], ['A', ' CZ ', 175.584, 133.765, 103.223], ['A', ' OH ', 175.616, 135.091, 102.885], ['A', ' H ', 174.621, 127.421, 104.495], ['A', ' HA ', 173.606, 129.511, 102.925], ['A', ' HB ', 174.632, 129.783, 105.182], ['A', ' HB ', 176.205, 129.392, 104.501], ['A', ' HD1', 173.448, 131.584, 104.415], ['A', ' HD2', 177.466, 130.993, 103.307], ['A', ' HE1', 173.533, 133.849, 103.831], ['A', ' HE2', 177.614, 133.369, 102.673], ['A', ' HH ', 174.887, 135.55, 103.381]]
[['A', ' N ', 176.557, 128.414, 101.997], ['A', ' CA ', 177.462, 128.437, 100.883], ['A', ' C ', 176.8, 127.908, 99.642], ['A', ' O ', 176.973, 128.481, 98.569], ['A', ' CB ', 178.677, 127.605, 101.192], ['A', ' H ', 176.793, 127.875, 102.837], ['A', ' HA ', 177.756, 129.47, 100.705], ['A', ' HB ', 179.365, 127.639, 100.35], ['A', ' HB ', 179.164, 127.997, 102.085], ['A', ' HB ', 178.365, 126.574, 101.372]]
[['A', ' N ', 175.993, 126.859, 99.769], ['A', ' CA ', 175.363, 126.321, 98.588], ['A', ' C ', 174.41, 127.301, 97.956], ['A', ' O ', 174.409, 127.443, 96.736], ['A', ' CB ', 174.573, 125.073, 98.917], ['A', ' CG ', 175.375, 123.852, 99.221], ['A', ' CD ', 174.49, 122.718, 99.577], ['A', ' NE ', 175.238, 121.546, 99.926], ['A', ' CZ ', 175.745, 120.657, 99.052], ['A', ' NH1', 175.586, 120.793, 97.736], ['A', ' NH2', 176.414, 119.617, 99.509], ['A', ' H ', 175.891, 126.393, 100.676], ['A', ' HA ', 176.143, 126.073, 97.867], ['A', ' HB ', 173.942, 125.27, 99.781], ['A', ' HB ', 173.914, 124.834, 98.083], ['A', ' HG ', 175.945, 123.582, 98.334], ['A', ' HG ', 176.057, 124.043, 100.037], ['A', ' HD ', 173.891, 122.998, 100.442], ['A', ' HD ', 173.831, 122.483, 98.757], ['A', ' HE ', 175.393, 121.37, 100.911], ['A', ' HH1', 175.046, 121.566, 97.326], ['A', ' HH1', 175.975, 120.095, 97.12], ['A', ' HH2', 176.555, 119.472, 100.525], ['A', ' HH2', 176.783, 118.944, 98.86]]
[['A', ' N ', 173.619, 128.003, 98.761], ['A', ' CA ', 172.656, 128.908, 98.174], ['A', ' C ', 173.322, 130.15, 97.622], ['A', ' O ', 172.899, 130.698, 96.599], ['A', ' CB ', 171.623, 129.344, 99.189], ['A', ' CG ', 170.675, 128.298, 99.757], ['A', ' CD1', 169.824, 129.041, 100.76], ['A', ' CD2', 169.836, 127.594, 98.647], ['A', ' H ', 173.644, 127.833, 99.773], ['A', ' HA ', 172.162, 128.395, 97.364], ['A', ' HB ', 172.165, 129.771, 100.038], ['A', ' HB ', 171.023, 130.12, 98.747], ['A', ' HG ', 171.247, 127.541, 100.296], ['A', ' HD1', 169.137, 128.384, 101.26], ['A', ' HD1', 170.466, 129.499, 101.484], ['A', ' HD1', 169.269, 129.813, 100.244], ['A', ' HD2', 169.167, 126.88, 99.076], ['A', ' HD2', 169.261, 128.31, 98.119], ['A', ' HD2', 170.487, 127.073, 97.954]]
[['A', ' N ', 174.363, 130.623, 98.287], ['A', ' CA ', 175.039, 131.803, 97.804], ['A', ' C ', 175.696, 131.489, 96.463], ['A', ' O ', 175.681, 132.314, 95.549], ['A', ' CB ', 176.04, 132.3, 98.836], ['A', ' CG ', 176.736, 133.595, 98.468], ['A', ' CD ', 177.632, 134.068, 99.604], ['A', ' CE ', 178.38, 135.338, 99.24], ['A', ' NZ ', 179.305, 135.781, 100.331], ['A', ' H ', 174.674, 130.18, 99.159], ['A', ' HA ', 174.3, 132.585, 97.64], ['A', ' HB ', 175.526, 132.448, 99.79], ['A', ' HB ', 176.8, 131.531, 98.997], ['A', ' HG ', 177.341, 133.442, 97.571], ['A', ' HG ', 175.988, 134.358, 98.255], ['A', ' HD ', 177.01, 134.278, 100.472], ['A', ' HD ', 178.342, 133.285, 99.866], ['A', ' HE ', 178.96, 135.161, 98.336], ['A', ' HE ', 177.659, 136.132, 99.046], ['A', ' HZ ', 179.781, 136.624, 100.041], ['A', ' HZ ', 178.793, 135.967, 101.184], ['A', ' HZ ', 179.986, 135.056, 100.506]]
[['A', ' N ', 176.279, 130.291, 96.352], ['A', ' CA ', 176.918, 129.821, 95.133], ['A', ' C ', 175.885, 129.535, 94.048], ['A', ' O ', 176.176, 129.688, 92.864], ['A', ' CB ', 177.727, 128.577, 95.435], ['A', ' CG ', 178.949, 128.829, 96.291], ['A', ' CD ', 179.546, 127.539, 96.769], ['A', ' OE1', 178.929, 126.482, 96.599], ['A', ' NE2', 180.731, 127.601, 97.365], ['A', ' H ', 176.304, 129.669, 97.166], ['A', ' HA ', 177.585, 130.6, 94.77], ['A', ' HB ', 177.089, 127.862, 95.956], ['A', ' HB ', 178.048, 128.114, 94.504], ['A', ' HG ', 179.692, 129.341, 95.683], ['A', ' HG ', 178.688, 129.445, 97.145], ['A', ' HE2', 181.167, 126.764, 97.699], ['A', ' HE2', 181.193, 128.481, 97.479]]
[['A', ' N ', 174.696, 129.091, 94.462], ['A', ' CA ', 173.569, 128.798, 93.592], ['A', ' C ', 172.984, 130.015, 92.922], ['A', ' O ', 172.678, 129.978, 91.731], ['A', ' CB ', 172.445, 128.149, 94.404], ['A', ' CG ', 171.162, 127.862, 93.696], ['A', ' CD1', 171.39, 126.978, 92.583], ['A', ' CD2', 170.155, 127.246, 94.669], ['A', ' H ', 174.585, 128.884, 95.454], ['A', ' HA ', 173.927, 128.114, 92.827], ['A', ' HB ', 172.812, 127.223, 94.837], ['A', ' HB ', 172.195, 128.817, 95.191], ['A', ' HG ', 170.753, 128.783, 93.32], ['A', ' HD1', 170.444, 126.838, 92.138], ['A', ' HD1', 172.061, 127.407, 91.866], ['A', ' HD1', 171.79, 126.036, 92.92], ['A', ' HD2', 169.208, 127.047, 94.154], ['A', ' HD2', 170.537, 126.324, 95.062], ['A', ' HD2', 169.981, 127.936, 95.487]]
[['A', ' N ', 172.823, 131.094, 93.669], ['A', ' CA ', 172.219, 132.308, 93.15], ['A', ' C ', 172.514, 132.614, 91.674], ['A', ' O ', 171.547, 132.794, 90.932], ['A', ' CB ', 172.52, 133.468, 94.086], ['A', ' CG ', 171.896, 134.768, 93.682], ['A', ' CD ', 172.16, 135.824, 94.735], ['A', ' CE ', 171.566, 137.157, 94.339], ['A', ' NZ ', 171.798, 138.19, 95.378], ['A', ' H ', 173.055, 131.035, 94.668], ['A', ' HA ', 171.155, 132.179, 93.185], ['A', ' HB ', 172.118, 133.216, 95.07], ['A', ' HB ', 173.582, 133.601, 94.224], ['A', ' HG ', 172.314, 135.099, 92.729], ['A', ' HG ', 170.819, 134.634, 93.562], ['A', ' HD ', 171.723, 135.506, 95.685], ['A', ' HD ', 173.236, 135.939, 94.87], ['A', ' HE ', 172.019, 137.486, 93.405], ['A', ' HE ', 170.491, 137.042, 94.19], ['A', ' HZ ', 171.389, 139.066, 95.085], ['A', ' HZ ', 171.366, 137.891, 96.239], ['A', ' HZ ', 172.79, 138.314, 95.521]]
[['A', ' N ', 173.765, 132.732, 91.188], ['A', ' CA ', 174.057, 133.009, 89.798], ['A', ' C ', 173.577, 131.941, 88.815], ['A', ' O ', 173.381, 132.258, 87.647], ['A', ' CB ', 175.58, 133.136, 89.79], ['A', ' CG ', 176.034, 132.431, 91.026], ['A', ' CD ', 174.963, 132.704, 92.037], ['A', ' HA ', 173.61, 133.979, 89.544], ['A', ' HB ', 175.986, 132.674, 88.875], ['A', ' HB ', 175.868, 134.196, 89.769], ['A', ' HG ', 176.157, 131.352, 90.834], ['A', ' HG ', 177.017, 132.805, 91.347], ['A', ' HD ', 174.985, 131.925, 92.766], ['A', ' HD ', 175.13, 133.684, 92.495]]
[['A', ' N ', 173.373, 130.695, 89.253], ['A', ' CA ', 172.92, 129.663, 88.336], ['A', ' C ', 171.437, 129.8, 88.185], ['A', ' O ', 170.884, 129.552, 87.11], ['A', ' CB ', 173.263, 128.265, 88.844], ['A', ' CG ', 174.762, 127.941, 88.953], ['A', ' CD ', 175.492, 128.016, 87.592], ['A', ' CE ', 175.089, 126.884, 86.635], ['A', ' NZ ', 175.761, 127.03, 85.312], ['A', ' H ', 173.512, 130.432, 90.223], ['A', ' HA ', 173.359, 129.831, 87.355], ['A', ' HB ', 172.859, 128.162, 89.843], ['A', ' HB ', 172.769, 127.519, 88.232], ['A', ' HG ', 175.224, 128.654, 89.644], ['A', ' HG ', 174.881, 126.938, 89.366], ['A', ' HD ', 175.338, 128.974, 87.102], ['A', ' HD ', 176.56, 127.921, 87.779], ['A', ' HE ', 175.371, 125.928, 87.075], ['A', ' HE ', 174.017, 126.897, 86.469], ['A', ' HZ ', 175.481, 126.282, 84.699], ['A', ' HZ ', 175.46, 127.941, 84.9], ['A', ' HZ ', 176.76, 127.02, 85.42]]
[['A', ' N ', 170.79, 130.227, 89.26], ['A', ' CA ', 169.368, 130.453, 89.191], ['A', ' C ', 169.168, 131.613, 88.275], ['A', ' O ', 168.25, 131.584, 87.464], ['A', ' CB ', 168.714, 130.686, 90.55], ['A', ' CG1', 167.238, 131.133, 90.393], ['A', ' CG2', 168.75, 129.395, 91.258], ['A', ' H ', 171.33, 130.381, 90.119], ['A', ' HA ', 168.896, 129.578, 88.748], ['A', ' HB ', 169.261, 131.452, 91.105], ['A', ' HG1', 166.791, 131.26, 91.38], ['A', ' HG1', 167.18, 132.083, 89.855], ['A', ' HG1', 166.684, 130.375, 89.839], ['A', ' HG2', 168.301, 129.473, 92.225], ['A', ' HG2', 168.204, 128.676, 90.674], ['A', ' HG2', 169.773, 129.085, 91.348]]
[['A', ' N ', 170.013, 132.635, 88.396], ['A', ' CA ', 169.873, 133.773, 87.527], ['A', ' C ', 170.073, 133.36, 86.065], ['A', ' O ', 169.302, 133.78, 85.209], ['A', ' CB ', 170.868, 134.839, 87.886], ['A', ' CG ', 170.565, 135.517, 89.167], ['A', ' OD1', 169.459, 135.459, 89.702], ['A', ' ND2', 171.547, 136.193, 89.685], ['A', ' H ', 170.728, 132.615, 89.129], ['A', ' HA ', 168.876, 134.181, 87.642], ['A', ' HB ', 171.858, 134.401, 87.944], ['A', ' HB ', 170.892, 135.587, 87.095], ['A', ' HD2', 171.411, 136.693, 90.538], ['A', ' HD2', 172.432, 136.227, 89.223]]
[['A', ' N ', 171.034, 132.475, 85.76], ['A', ' CA ', 171.193, 132.067, 84.364], ['A', ' C ', 169.958, 131.341, 83.866], ['A', ' O ', 169.496, 131.57, 82.741], ['A', ' CB ', 172.38, 131.114, 84.197], ['A', ' CG ', 173.762, 131.716, 84.351], ['A', ' CD ', 174.861, 130.644, 84.372], ['A', ' OE1', 174.53, 129.47, 84.35], ['A', ' OE2', 176.012, 130.992, 84.427], ['A', ' H ', 171.703, 132.161, 86.47], ['A', ' HA ', 171.347, 132.957, 83.755], ['A', ' HB ', 172.294, 130.317, 84.937], ['A', ' HB ', 172.33, 130.646, 83.215], ['A', ' HG ', 173.943, 132.387, 83.514], ['A', ' HG ', 173.804, 132.303, 85.254]]
[['A', ' N ', 169.408, 130.484, 84.717], ['A', ' CA ', 168.235, 129.71, 84.389], ['A', ' C ', 167.032, 130.56, 84.118], ['A', ' O ', 166.35, 130.38, 83.104], ['A', ' CB ', 167.903, 128.75, 85.513], ['A', ' CG ', 166.642, 128.06, 85.308], ['A', ' ND1', 166.456, 127.116, 84.34], ['A', ' CD2', 165.472, 128.182, 85.95], ['A', ' CE1', 165.221, 126.681, 84.398], ['A', ' NE2', 164.609, 127.308, 85.379], ['A', ' H ', 169.87, 130.322, 85.618], ['A', ' HA ', 168.435, 129.126, 83.493], ['A', ' HB ', 168.699, 128.01, 85.615], ['A', ' HB ', 167.844, 129.292, 86.451], ['A', ' HD1', 167.131, 126.803, 83.675], ['A', ' HD2', 165.152, 128.809, 86.779], ['A', ' HE1', 164.865, 125.919, 83.701]]
[['A', ' N ', 166.756, 131.501, 85.0], ['A', ' CA ', 165.577, 132.287, 84.784], ['A', ' C ', 165.77, 133.208, 83.613], ['A', ' O ', 164.859, 133.36, 82.817], ['A', ' CB ', 165.172, 133.063, 86.043], ['A', ' CG1', 164.898, 132.058, 87.164], ['A', ' CG2', 166.19, 134.015, 86.43], ['A', ' H ', 167.354, 131.619, 85.822], ['A', ' HA ', 164.757, 131.607, 84.553], ['A', ' HB ', 164.296, 133.62, 85.858], ['A', ' HG1', 164.596, 132.584, 88.06], ['A', ' HG1', 164.103, 131.382, 86.856], ['A', ' HG1', 165.788, 131.483, 87.377], ['A', ' HG2', 165.856, 134.504, 87.303], ['A', ' HG2', 167.079, 133.498, 86.628], ['A', ' HG2', 166.366, 134.757, 85.668]]
[['A', ' N ', 166.96, 133.75, 83.393], ['A', ' CA ', 167.059, 134.645, 82.265], ['A', ' C ', 166.868, 133.857, 80.972], ['A', ' O ', 166.268, 134.369, 80.017], ['A', ' CB ', 168.366, 135.416, 82.306], ['A', ' CG ', 168.457, 136.409, 83.507], ['A', ' CD ', 167.35, 137.428, 83.561], ['A', ' OE1', 166.976, 137.91, 82.524], ['A', ' OE2', 166.884, 137.75, 84.659], ['A', ' H ', 167.755, 133.618, 84.026], ['A', ' HA ', 166.251, 135.371, 82.332], ['A', ' HB ', 169.197, 134.711, 82.393], ['A', ' HB ', 168.496, 135.975, 81.381], ['A', ' HG ', 168.423, 135.855, 84.429], ['A', ' HG ', 169.414, 136.922, 83.465]]
[['A', ' N ', 167.33, 132.603, 80.924], ['A', ' CA ', 167.08, 131.802, 79.742], ['A', ' C ', 165.604, 131.547, 79.557], ['A', ' O ', 165.071, 131.756, 78.466], ['A', ' CB ', 167.756, 130.43, 79.833], ['A', ' CG ', 167.43, 129.421, 78.659], ['A', ' CD1', 167.894, 129.984, 77.315], ['A', ' CD2', 168.077, 128.065, 78.96], ['A', ' H ', 167.9, 132.226, 81.691], ['A', ' HA ', 167.458, 132.349, 78.883], ['A', ' HB ', 168.834, 130.58, 79.868], ['A', ' HB ', 167.453, 129.961, 80.771], ['A', ' HG ', 166.352, 129.276, 78.599], ['A', ' HD1', 167.646, 129.277, 76.525], ['A', ' HD1', 167.396, 130.927, 77.105], ['A', ' HD1', 168.971, 130.138, 77.336], ['A', ' HD2', 167.831, 127.356, 78.167], ['A', ' HD2', 169.161, 128.181, 79.021], ['A', ' HD2', 167.699, 127.689, 79.912]]
[['A', ' N ', 164.922, 131.119, 80.621], ['A', ' CA ', 163.514, 130.806, 80.475], ['A', ' C ', 162.679, 132.031, 80.204], ['A', ' O ', 161.658, 131.924, 79.558], ['A', ' CB ', 162.972, 130.075, 81.701], ['A', ' CG ', 163.47, 128.641, 81.873], ['A', ' SD ', 163.147, 127.567, 80.427], ['A', ' CE ', 161.34, 127.416, 80.344], ['A', ' H ', 165.4, 130.975, 81.516], ['A', ' HA ', 163.406, 130.153, 79.615], ['A', ' HB ', 163.28, 130.624, 82.596], ['A', ' HB ', 161.882, 130.079, 81.684], ['A', ' HG ', 164.546, 128.669, 82.049], ['A', ' HG ', 162.999, 128.197, 82.75], ['A', ' HE ', 161.067, 126.791, 79.496], ['A', ' HE ', 160.969, 126.957, 81.257], ['A', ' HE ', 160.888, 128.405, 80.218]]
[['A', ' N ', 163.092, 133.185, 80.705], ['A', ' CA ', 162.377, 134.427, 80.491], ['A', ' C ', 162.56, 134.9, 79.055], ['A', ' O ', 161.62, 135.428, 78.472], ['A', ' CB ', 162.781, 135.507, 81.506], ['A', ' CG1', 162.32, 135.052, 82.923], ['A', ' CG2', 162.128, 136.854, 81.119], ['A', ' CD1', 162.903, 135.869, 84.08], ['A', ' H ', 163.919, 133.192, 81.296], ['A', ' HA ', 161.316, 134.233, 80.638], ['A', ' HB ', 163.87, 135.608, 81.523], ['A', ' HG1', 161.253, 135.092, 82.967], ['A', ' HG1', 162.604, 134.02, 83.062], ['A', ' HG2', 162.402, 137.62, 81.833], ['A', ' HG2', 162.465, 137.169, 80.134], ['A', ' HG2', 161.044, 136.743, 81.102], ['A', ' HD1', 162.541, 135.483, 85.028], ['A', ' HD1', 163.996, 135.799, 84.056], ['A', ' HD1', 162.608, 136.906, 83.993]]
[['A', ' N ', 163.786, 134.813, 78.502], ['A', ' CA ', 163.996, 135.187, 77.1], ['A', ' C ', 163.144, 134.275, 76.202], ['A', ' O ', 162.48, 134.74, 75.26], ['A', ' H ', 164.581, 134.481, 79.055], ['A', ' HA ', 163.721, 136.23, 76.952], ['A', ' HA ', 165.051, 135.079, 76.852]]
[['A', ' N ', 163.122, 132.986, 76.545], ['A', ' CA ', 162.287, 132.009, 75.876], ['A', ' C ', 160.912, 132.37, 76.356], ['A', ' O ', 160.776, 133.311, 77.116], ['A', ' CB ', 162.628, 130.573, 76.273], ['A', ' CG ', 164.023, 130.045, 75.933], ['A', ' CD1', 164.172, 128.707, 76.57], ['A', ' CD2', 164.188, 129.913, 74.438], ['A', ' H ', 163.727, 132.664, 77.31], ['A', ' HA ', 162.334, 132.133, 74.8], ['A', ' HB ', 162.505, 130.493, 77.353], ['A', ' HB ', 161.912, 129.902, 75.805], ['A', ' HG ', 164.783, 130.709, 76.324], ['A', ' HD1', 165.156, 128.296, 76.348], ['A', ' HD1', 164.057, 128.798, 77.648], ['A', ' HD1', 163.403, 128.054, 76.175], ['A', ' HD2', 165.178, 129.515, 74.22], ['A', ' HD2', 163.427, 129.232, 74.044], ['A', ' HD2', 164.083, 130.885, 73.965]]
[['A', ' N ', 159.877, 131.755, 75.831], ['A', ' CA ', 158.486, 132.024, 76.229], ['A', ' C ', 158.007, 133.245, 75.496], ['A', ' O ', 156.985, 133.186, 74.833], ['A', ' CB ', 158.276, 132.324, 77.731], ['A', ' CG1', 158.739, 131.173, 78.546], ['A', ' CG2', 156.738, 132.547, 77.968], ['A', ' CD1', 158.795, 131.505, 80.019], ['A', ' H ', 160.052, 131.042, 75.133], ['A', ' HA ', 157.862, 131.189, 75.944], ['A', ' HB ', 158.762, 133.229, 78.063], ['A', ' HG1', 158.128, 130.333, 78.341], ['A', ' HG1', 159.742, 130.912, 78.259], ['A', ' HG2', 156.527, 132.756, 79.007], ['A', ' HG2', 156.388, 133.39, 77.385], ['A', ' HG2', 156.191, 131.651, 77.667], ['A', ' HD1', 159.182, 130.653, 80.572], ['A', ' HD1', 159.445, 132.353, 80.178], ['A', ' HD1', 157.83, 131.757, 80.403]]
[['A', ' N ', 158.679, 134.376, 75.666], ['A', ' CA ', 158.315, 135.517, 74.849], ['A', ' C ', 158.825, 135.246, 73.428], ['A', ' O ', 158.116, 135.453, 72.437], ['A', ' CB ', 158.874, 136.815, 75.419], ['A', ' CG ', 158.21, 137.248, 76.733], ['A', ' CD ', 158.729, 138.564, 77.262], ['A', ' OE1', 159.688, 139.062, 76.724], ['A', ' OE2', 158.15, 139.078, 78.193], ['A', ' H ', 159.467, 134.382, 76.326], ['A', ' HA ', 157.23, 135.598, 74.816], ['A', ' HB ', 159.945, 136.688, 75.614], ['A', ' HB ', 158.762, 137.617, 74.691], ['A', ' HG ', 157.133, 137.324, 76.579], ['A', ' HG ', 158.384, 136.469, 77.481]]
[['A', ' N ', 160.038, 134.69, 73.335], ['A', ' CA ', 160.637, 134.305, 72.069], ['A', ' C ', 159.969, 133.009, 71.65], ['A', ' O ', 159.959, 132.048, 72.419], ['A', ' CB ', 162.151, 134.107, 72.163], ['A', ' CG ', 162.807, 133.875, 70.78], ['A', ' OD1', 162.079, 133.82, 69.797], ['A', ' OD2', 164.006, 133.75, 70.703], ['A', ' H ', 160.613, 134.574, 74.175], ['A', ' HA ', 160.427, 135.07, 71.321], ['A', ' HB ', 162.605, 134.981, 72.635], ['A', ' HB ', 162.363, 133.256, 72.792]]
[['A', ' N ', 159.34, 133.001, 70.479], ['A', ' CA ', 158.557, 131.853, 70.012], ['A', ' C ', 157.432, 131.626, 70.993], ['A', ' O ', 157.121, 130.498, 71.384], ['A', ' CB ', 159.416, 130.584, 69.909], ['A', ' CG ', 160.719, 130.761, 69.138], ['A', ' CD ', 160.527, 130.996, 67.646], ['A', ' CE ', 161.884, 131.255, 66.975], ['A', ' NZ ', 162.353, 132.695, 67.167], ['A', ' H ', 159.427, 133.825, 69.9], ['A', ' HA ', 158.116, 132.085, 69.044], ['A', ' HB ', 159.648, 130.195, 70.898], ['A', ' HB ', 158.842, 129.814, 69.398], ['A', ' HG ', 161.28, 131.573, 69.561], ['A', ' HG ', 161.308, 129.857, 69.266], ['A', ' HD ', 160.057, 130.126, 67.189], ['A', ' HD ', 159.894, 131.863, 67.484], ['A', ' HE ', 162.619, 130.59, 67.425], ['A', ' HE ', 161.817, 131.041, 65.91], ['A', ' HZ ', 163.251, 132.821, 66.73], ['A', ' HZ ', 161.689, 133.317, 66.741], ['A', ' HZ ', 162.433, 132.961, 68.174]]
[['A', ' N ', 156.816, 132.734, 71.363], ['A', ' CA ', 155.73, 132.75, 72.298], ['A', ' C ', 154.363, 132.558, 71.694], ['A', ' O ', 154.193, 132.126, 70.55], ['A', ' H ', 157.158, 133.614, 71.0], ['A', ' HA ', 155.899, 131.977, 73.046], ['A', ' HA ', 155.748, 133.705, 72.824]]
[['A', ' N ', 153.383, 132.852, 72.519], ['A', ' CA ', 151.99, 132.661, 72.226], ['A', ' C ', 151.349, 134.028, 71.958], ['A', ' O ', 151.953, 135.037, 72.311], ['A', ' CB ', 151.414, 131.926, 73.429], ['A', ' CG ', 152.179, 130.601, 73.814], ['A', ' CD1', 151.597, 130.038, 75.061], ['A', ' CD2', 152.082, 129.575, 72.71], ['A', ' H ', 153.639, 133.23, 73.421], ['A', ' HA ', 151.923, 132.045, 71.342], ['A', ' HB ', 151.4, 132.594, 74.291], ['A', ' HB ', 150.418, 131.634, 73.201], ['A', ' HG ', 153.228, 130.826, 74.001], ['A', ' HD1', 152.131, 129.128, 75.328], ['A', ' HD1', 151.695, 130.755, 75.862], ['A', ' HD1', 150.548, 129.805, 74.901], ['A', ' HD2', 152.617, 128.672, 73.013], ['A', ' HD2', 151.05, 129.331, 72.54], ['A', ' HD2', 152.526, 129.952, 71.793]]
[['A', ' N ', 150.174, 134.108, 71.3], ['A', ' CA ', 149.45, 135.331, 70.971], ['A', ' C ', 149.127, 136.212, 72.159], ['A', ' O ', 148.792, 135.73, 73.246], ['A', ' CB ', 148.146, 134.785, 70.395], ['A', ' CG ', 148.495, 133.449, 69.846], ['A', ' CD ', 149.514, 132.894, 70.794], ['A', ' HA ', 150.015, 135.898, 70.217], ['A', ' HB ', 147.401, 134.726, 71.195], ['A', ' HB ', 147.753, 135.48, 69.637], ['A', ' HG ', 147.589, 132.823, 69.798], ['A', ' HG ', 148.871, 133.535, 68.817], ['A', ' HD ', 149.018, 132.351, 71.587], ['A', ' HD ', 150.18, 132.269, 70.202]]
[['A', ' N ', 149.203, 137.51, 71.933], ['A', ' CA ', 148.92, 138.473, 72.967], ['A', ' C ', 147.475, 138.36, 73.391], ['A', ' O ', 146.58, 138.218, 72.559], ['A', ' CB ', 149.206, 139.879, 72.453], ['A', ' CG ', 150.662, 140.105, 72.075], ['A', ' CD ', 150.979, 139.664, 70.662], ['A', ' OE1', 150.106, 139.111, 70.019], ['A', ' OE2', 152.081, 139.872, 70.229], ['A', ' H ', 149.483, 137.856, 71.009], ['A', ' HA ', 149.557, 138.265, 73.826], ['A', ' HB ', 148.588, 140.082, 71.578], ['A', ' HB ', 148.939, 140.607, 73.217], ['A', ' HG ', 150.895, 141.165, 72.175], ['A', ' HG ', 151.294, 139.553, 72.769]]
[['A', ' N ', 147.238, 138.435, 74.691], ['A', ' CA ', 145.885, 138.343, 75.207], ['A', ' C ', 145.533, 136.905, 75.562], ['A', ' O ', 144.452, 136.625, 76.098], ['A', ' H ', 148.01, 138.554, 75.333], ['A', ' HA ', 145.786, 138.977, 76.084], ['A', ' HA ', 145.185, 138.719, 74.462]]
[['A', ' N ', 146.42, 135.967, 75.247], ['A', ' CA ', 146.101, 134.608, 75.577], ['A', ' C ', 146.202, 134.453, 77.066], ['A', ' O ', 147.233, 134.766, 77.672], ['A', ' CB ', 147.042, 133.652, 74.849], ['A', ' CG ', 146.844, 132.165, 75.114], ['A', ' CD1', 145.497, 131.692, 74.593], ['A', ' CD2', 147.934, 131.416, 74.448], ['A', ' H ', 147.29, 136.177, 74.747], ['A', ' HA ', 145.082, 134.407, 75.276], ['A', ' HB ', 146.921, 133.817, 73.776], ['A', ' HB ', 148.068, 133.912, 75.107], ['A', ' HG ', 146.893, 131.995, 76.175], ['A', ' HD1', 145.374, 130.635, 74.788], ['A', ' HD1', 144.684, 132.219, 75.071], ['A', ' HD1', 145.463, 131.864, 73.525], ['A', ' HD2', 147.843, 130.359, 74.659], ['A', ' HD2', 147.884, 131.583, 73.383], ['A', ' HD2', 148.866, 131.768, 74.826]]
[['A', ' N ', 145.103, 134.007, 77.658], ['A', ' CA ', 144.992, 133.849, 79.091], ['A', ' C ', 144.642, 135.155, 79.808], ['A', ' O ', 144.813, 135.239, 81.019], ['A', ' H ', 144.303, 133.776, 77.077], ['A', ' HA ', 144.219, 133.107, 79.298], ['A', ' HA ', 145.918, 133.457, 79.493]]
[['A', ' N ', 144.2, 136.194, 79.091], ['A', ' CA ', 143.864, 137.449, 79.759], ['A', ' C ', 142.357, 137.61, 79.792], ['A', ' O ', 141.731, 137.787, 78.747], ['A', ' CB ', 144.477, 138.628, 78.999], ['A', ' CG1', 144.134, 139.921, 79.673], ['A', ' CG2', 145.94, 138.45, 78.941], ['A', ' H ', 144.079, 136.125, 78.076], ['A', ' HA ', 144.243, 137.43, 80.781], ['A', ' HB ', 144.067, 138.658, 77.989], ['A', ' HG1', 144.576, 140.747, 79.12], ['A', ' HG1', 143.054, 140.057, 79.709], ['A', ' HG1', 144.53, 139.903, 80.673], ['A', ' HG2', 146.403, 139.274, 78.408], ['A', ' HG2', 146.293, 138.428, 79.941], ['A', ' HG2', 146.182, 137.516, 78.439]]
[['A', ' N ', 141.767, 137.579, 80.987], ['A', ' CA ', 140.311, 137.593, 81.096], ['A', ' C ', 139.949, 137.64, 82.547], ['A', ' O ', 138.823, 137.939, 82.948], ['A', ' CB ', 139.744, 136.279, 80.565], ['A', ' CG ', 140.099, 135.169, 81.497], ['A', ' ND1', 141.397, 134.865, 81.799], ['A', ' CD2', 139.336, 134.287, 82.186], ['A', ' CE1', 141.429, 133.865, 82.636], ['A', ' NE2', 140.191, 133.48, 82.886], ['A', ' H ', 142.321, 137.474, 81.839], ['A', ' HA ', 139.88, 138.449, 80.578], ['A', ' HB ', 138.661, 136.342, 80.49], ['A', ' HB ', 140.135, 136.048, 79.576], ['A', ' HD2', 138.252, 134.232, 82.174], ['A', ' HE1', 142.329, 133.416, 83.045], ['A', ' HE2', 139.943, 132.679, 83.505]]
[['A', ' N ', 140.926, 137.232, 83.305], ['A', ' CA ', 140.841, 136.921, 84.695], ['A', ' C ', 140.528, 138.02, 85.645], ['A', ' O ', 140.961, 139.162, 85.493], ['A', ' CB ', 142.158, 136.356, 85.096], ['A', ' CG ', 143.192, 137.323, 84.736], ['A', ' OD1', 143.327, 137.708, 83.544], ['A', ' ND2', 143.924, 137.784, 85.701], ['A', ' H ', 141.824, 137.085, 82.852], ['A', ' HA ', 140.068, 136.16, 84.811], ['A', ' HB ', 142.168, 136.216, 86.168], ['A', ' HB ', 142.362, 135.409, 84.637], ['A', ' HD2', 144.635, 138.443, 85.505], ['A', ' HD2', 143.778, 137.465, 86.641]]
[['A', ' N ', 139.798, 137.621, 86.666], ['A', ' CA ', 139.493, 138.448, 87.791], ['A', ' C ', 140.613, 138.344, 88.826], ['A', ' O ', 140.968, 137.233, 89.229], ['A', ' CB ', 138.196, 137.983, 88.418], ['A', ' CG ', 137.855, 138.635, 89.743], ['A', ' CD ', 137.506, 140.071, 89.675], ['A', ' OE1', 136.562, 140.466, 88.979], ['A', ' NE2', 138.239, 140.894, 90.408], ['A', ' H ', 139.454, 136.671, 86.662], ['A', ' HA ', 139.356, 139.451, 87.42], ['A', ' HB ', 137.374, 138.18, 87.732], ['A', ' HB ', 138.237, 136.915, 88.558], ['A', ' HG ', 137.02, 138.1, 90.158], ['A', ' HG ', 138.696, 138.536, 90.414], ['A', ' HE2', 138.046, 141.878, 90.418], ['A', ' HE2', 139.034, 140.529, 90.955]]
[['A', ' N ', 141.278, 139.439, 89.174], ['A', ' CA ', 142.303, 139.503, 90.181], ['A', ' C ', 141.711, 139.504, 91.581], ['A', ' O ', 140.57, 139.938, 91.749], ['A', ' CB ', 142.976, 140.849, 89.855], ['A', ' CG ', 141.897, 141.688, 89.258], ['A', ' CD ', 141.058, 140.729, 88.463], ['A', ' HA ', 142.986, 138.658, 90.031], ['A', ' HB ', 143.369, 141.309, 90.772], ['A', ' HB ', 143.826, 140.696, 89.174], ['A', ' HG ', 141.324, 142.186, 90.056], ['A', ' HG ', 142.332, 142.483, 88.634], ['A', ' HD ', 140.04, 141.086, 88.53], ['A', ' HD ', 141.414, 140.672, 87.422]]
[['A', ' N ', 142.448, 139.081, 92.606], ['A', ' CA ', 143.728, 138.367, 92.618], ['A', ' C ', 143.876, 138.018, 94.08], ['A', ' O ', 143.489, 138.82, 94.934], ['A', ' CB ', 144.97, 139.17, 92.154], ['A', ' OG1', 146.071, 138.302, 92.127], ['A', ' CG2', 145.283, 140.322, 93.094], ['A', ' H ', 142.039, 139.213, 93.522], ['A', ' HA ', 143.657, 137.441, 92.045], ['A', ' HB ', 144.832, 139.543, 91.183], ['A', ' HG1', 145.95, 137.68, 91.395], ['A', ' HG2', 146.166, 140.848, 92.735], ['A', ' HG2', 144.44, 141.011, 93.122], ['A', ' HG2', 145.486, 139.963, 94.099]]
[['A', ' N ', 144.467, 136.896, 94.396], ['A', ' CA ', 144.665, 136.562, 95.789], ['A', ' C ', 146.109, 136.389, 96.234], ['A', ' O ', 146.846, 135.586, 95.668], ['A', ' CB ', 143.867, 135.296, 96.063], ['A', ' CG ', 143.993, 134.663, 97.412], ['A', ' CD1', 143.443, 135.56, 98.462], ['A', ' CD2', 143.236, 133.364, 97.398], ['A', ' H ', 144.713, 136.238, 93.658], ['A', ' HA ', 144.242, 137.368, 96.381], ['A', ' HB ', 142.831, 135.546, 95.94], ['A', ' HB ', 144.12, 134.561, 95.306], ['A', ' HG ', 145.045, 134.468, 97.639], ['A', ' HD1', 143.566, 135.048, 99.384], ['A', ' HD1', 143.98, 136.499, 98.504], ['A', ' HD1', 142.385, 135.756, 98.275], ['A', ' HD2', 143.316, 132.878, 98.37], ['A', ' HD2', 142.186, 133.558, 97.177], ['A', ' HD2', 143.645, 132.704, 96.637]]
[['A', ' N ', 146.489, 137.11, 97.289], ['A', ' CA ', 147.814, 136.989, 97.893], ['A', ' C ', 147.793, 137.534, 99.332], ['A', ' O ', 146.978, 138.407, 99.63], ['A', ' CB ', 148.819, 137.716, 97.046], ['A', ' H ', 145.82, 137.759, 97.684], ['A', ' HA ', 148.079, 135.929, 97.936], ['A', ' HB ', 149.782, 137.573, 97.487], ['A', ' HB ', 148.804, 137.295, 96.051], ['A', ' HB ', 148.573, 138.776, 97.001]]
[['A', ' N ', 148.702, 137.071, 100.202], ['A', ' CA ', 148.828, 137.622, 101.572], ['A', ' C ', 150.254, 138.107, 101.901], ['A', ' O ', 150.434, 139.025, 102.703], ['A', ' CB ', 148.486, 136.571, 102.606], ['A', ' OG ', 149.469, 135.572, 102.645], ['A', ' H ', 149.306, 136.323, 99.901], ['A', ' HA ', 148.15, 138.467, 101.669], ['A', ' HB ', 148.401, 137.033, 103.587], ['A', ' HB ', 147.52, 136.125, 102.367], ['A', ' HG ', 149.551, 135.219, 101.734]]
[['A', ' N ', 151.255, 137.537, 101.241], ['A', ' CA ', 152.662, 137.909, 101.45], ['A', ' C ', 153.385, 137.579, 100.17], ['A', ' O ', 152.767, 137.079, 99.245], ['A', ' CB ', 153.315, 137.14, 102.593], ['A', ' CG ', 154.562, 137.771, 103.143], ['A', ' ND1', 155.772, 137.801, 102.456], ['A', ' CD2', 154.786, 138.371, 104.329], ['A', ' CE1', 156.682, 138.398, 103.216], ['A', ' NE2', 156.105, 138.755, 104.35], ['A', ' H ', 151.026, 136.759, 100.625], ['A', ' HA ', 152.761, 138.976, 101.636], ['A', ' HB ', 152.605, 137.037, 103.413], ['A', ' HB ', 153.583, 136.14, 102.254], ['A', ' HD2', 154.055, 138.517, 105.125], ['A', ' HE1', 157.726, 138.567, 102.953], ['A', ' HE2', 156.557, 139.227, 105.12]]
[['A', ' N ', 154.679, 137.836, 100.086], ['A', ' CA ', 155.408, 137.505, 98.877], ['A', ' C ', 155.925, 136.074, 98.953], ['A', ' O ', 156.002, 135.38, 97.94], ['A', ' CB ', 156.579, 138.461, 98.656], ['A', ' CG ', 157.315, 138.226, 97.333], ['A', ' CD ', 156.44, 138.506, 96.156], ['A', ' OE1', 156.001, 139.632, 95.972], ['A', ' NE2', 156.143, 137.483, 95.383], ['A', ' H ', 155.158, 138.2, 100.894], ['A', ' HA ', 154.73, 137.585, 98.033], ['A', ' HB ', 156.214, 139.486, 98.665], ['A', ' HB ', 157.293, 138.353, 99.472], ['A', ' HG ', 158.166, 138.898, 97.288], ['A', ' HG ', 157.652, 137.196, 97.263], ['A', ' HE2', 155.482, 137.617, 94.607], ['A', ' HE2', 156.5, 136.566, 95.603]]
[['A', ' N ', 156.424, 135.697, 100.129], ['A', ' CA ', 156.97, 134.356, 100.383], ['A', ' C ', 156.453, 133.977, 101.748], ['A', ' O ', 156.609, 134.796, 102.631], ['A', ' CB ', 158.53, 134.351, 100.449], ['A', ' CG1', 159.183, 134.887, 99.127], ['A', ' CG2', 159.075, 132.922, 100.794], ['A', ' CD1', 159.039, 134.016, 97.89], ['A', ' H ', 156.326, 136.357, 100.918], ['A', ' HA ', 156.598, 133.651, 99.645], ['A', ' HB ', 158.842, 135.031, 101.242], ['A', ' HG1', 158.751, 135.85, 98.911], ['A', ' HG1', 160.249, 135.028, 99.309], ['A', ' HG2', 160.16, 132.966, 100.866], ['A', ' HG2', 158.675, 132.588, 101.748], ['A', ' HG2', 158.793, 132.207, 100.027], ['A', ' HD1', 159.528, 134.503, 97.046], ['A', ' HD1', 159.5, 133.048, 98.048], ['A', ' HD1', 157.989, 133.873, 97.648]]
[['A', ' N ', 155.927, 132.769, 101.983], ['A', ' CA ', 155.525, 132.451, 103.374], ['A', ' C ', 154.424, 133.393, 103.862], ['A', ' O ', 154.668, 134.446, 104.451], ['A', ' CB ', 156.726, 132.433, 104.334], ['A', ' CG ', 156.377, 132.088, 105.763], ['A', ' CD1', 156.048, 130.806, 106.112], ['A', ' CD2', 156.422, 133.056, 106.724], ['A', ' CE1', 155.761, 130.483, 107.391], ['A', ' CE2', 156.133, 132.737, 108.025], ['A', ' CZ ', 155.806, 131.446, 108.356], ['A', ' OH ', 155.513, 131.114, 109.652], ['A', ' H ', 155.794, 132.086, 101.217], ['A', ' HA ', 155.105, 131.447, 103.38], ['A', ' HB ', 157.454, 131.702, 103.984], ['A', ' HB ', 157.233, 133.385, 104.358], ['A', ' HD1', 156.006, 130.049, 105.385], ['A', ' HD2', 156.688, 134.08, 106.453], ['A', ' HE1', 155.495, 129.456, 107.646], ['A', ' HE2', 156.168, 133.508, 108.795], ['A', ' HH ', 155.474, 131.91, 110.187]]
[['A', ' N ', 153.199, 132.96, 103.674], ['A', ' CA ', 152.037, 133.78, 103.952], ['A', ' C ', 151.704, 133.98, 105.391], ['A', ' O ', 152.417, 133.556, 106.301], ['A', ' H ', 153.069, 132.058, 103.253], ['A', ' HA ', 152.153, 134.746, 103.477], ['A', ' HA ', 151.169, 133.318, 103.481]]
[['A', ' N ', 150.603, 134.68, 105.585], ['A', ' CA ', 150.17, 135.045, 106.911], ['A', ' C ', 148.676, 134.858, 107.086], ['A', ' O ', 147.958, 134.535, 106.14], ['A', ' CB ', 150.516, 136.528, 107.115], ['A', ' CG ', 150.651, 136.983, 108.551], ['A', ' OD1', 150.413, 136.18, 109.43], ['A', ' OD2', 150.941, 138.154, 108.765], ['A', ' H ', 150.065, 134.979, 104.769], ['A', ' HA ', 150.693, 134.424, 107.64], ['A', ' HB ', 151.446, 136.751, 106.59], ['A', ' HB ', 149.73, 137.126, 106.652]]
[['A', ' N ', 148.216, 135.152, 108.281], ['A', ' CA ', 146.807, 135.157, 108.611], ['A', ' C ', 146.434, 136.61, 108.515], ['A', ' O ', 147.333, 137.446, 108.438], ['A', ' CB ', 146.539, 134.572, 109.979], ['A', ' CG ', 147.136, 135.334, 111.119], ['A', ' CD ', 146.862, 134.669, 112.389], ['A', ' NE ', 147.44, 135.397, 113.499], ['A', ' CZ ', 147.304, 135.052, 114.795], ['A', ' NH1', 146.592, 133.999, 115.117], ['A', ' NH2', 147.89, 135.78, 115.736], ['A', ' H ', 148.913, 135.401, 108.988], ['A', ' HA ', 146.244, 134.597, 107.865], ['A', ' HB ', 145.466, 134.508, 110.146], ['A', ' HB ', 146.932, 133.553, 110.02], ['A', ' HG ', 148.217, 135.396, 110.991], ['A', ' HG ', 146.722, 136.338, 111.162], ['A', ' HD ', 145.784, 134.603, 112.537], ['A', ' HD ', 147.293, 133.664, 112.37], ['A', ' HE ', 147.999, 136.216, 113.281], ['A', ' HH1', 146.129, 133.447, 114.399], ['A', ' HH1', 146.469, 133.719, 116.086], ['A', ' HH2', 148.438, 136.591, 115.482], ['A', ' HH2', 147.788, 135.523, 116.707]]
[['A', ' N ', 145.148, 136.939, 108.503], ['A', ' CA ', 144.79, 138.334, 108.284], ['A', ' C ', 145.279, 138.577, 106.871], ['A', ' O ', 145.823, 137.652, 106.267], ['A', ' CB ', 145.301, 139.353, 109.352], ['A', ' OG1', 146.711, 139.348, 109.467], ['A', ' CG2', 144.713, 139.038, 110.7], ['A', ' H ', 144.432, 136.233, 108.588], ['A', ' HA ', 143.704, 138.428, 108.268], ['A', ' HB ', 144.985, 140.35, 109.056], ['A', ' HG1', 147.107, 139.097, 108.626], ['A', ' HG2', 145.06, 139.772, 111.427], ['A', ' HG2', 143.629, 139.071, 110.64], ['A', ' HG2', 145.029, 138.047, 111.009]]
[['A', ' N ', 144.966, 139.721, 106.267], ['A', ' CA ', 145.168, 139.922, 104.818], ['A', ' C ', 144.109, 139.041, 104.146], ['A', ' O ', 143.103, 139.534, 103.628], ['A', ' CB ', 146.575, 139.565, 104.283], ['A', ' CG ', 147.727, 140.509, 104.642], ['A', ' CD ', 148.331, 140.184, 106.033], ['A', ' CE ', 149.682, 140.903, 106.239], ['A', ' NZ ', 150.264, 140.705, 107.644], ['A', ' H ', 144.546, 140.459, 106.811], ['A', ' HA ', 144.954, 140.962, 104.561], ['A', ' HB ', 146.885, 138.579, 104.523], ['A', ' HB ', 146.52, 139.588, 103.196], ['A', ' HG ', 148.51, 140.414, 103.883], ['A', ' HG ', 147.366, 141.535, 104.641], ['A', ' HD ', 147.648, 140.506, 106.816], ['A', ' HD ', 148.473, 139.105, 106.13], ['A', ' HE ', 150.395, 140.522, 105.505], ['A', ' HE ', 149.535, 141.967, 106.068], ['A', ' HZ ', 151.135, 141.201, 107.719], ['A', ' HZ ', 149.618, 141.064, 108.331], ['A', ' HZ ', 150.446, 139.702, 107.871]]
[['A', ' N ', 144.286, 137.723, 104.214], ['A', ' CA ', 143.254, 136.835, 103.743], ['A', ' C ', 142.172, 136.85, 104.776], ['A', ' O ', 142.125, 136.072, 105.738], ['A', ' CB ', 143.733, 135.417, 103.547], ['A', ' CG ', 142.652, 134.554, 102.994], ['A', ' CD1', 142.186, 134.761, 101.739], ['A', ' CD2', 142.108, 133.541, 103.719], ['A', ' CE1', 141.207, 133.981, 101.2], ['A', ' CE2', 141.124, 132.768, 103.178], ['A', ' CZ ', 140.674, 132.983, 101.929], ['A', ' H ', 145.127, 137.369, 104.657], ['A', ' HA ', 142.847, 137.219, 102.809], ['A', ' HB ', 144.577, 135.405, 102.863], ['A', ' HB ', 144.067, 135.002, 104.497], ['A', ' HD1', 142.601, 135.571, 101.167], ['A', ' HD2', 142.464, 133.353, 104.735], ['A', ' HE1', 140.858, 134.171, 100.184], ['A', ' HE2', 140.705, 131.973, 103.742], ['A', ' HZ ', 139.887, 132.353, 101.519]]
[['A', ' N ', 141.275, 137.769, 104.568], ['A', ' CA ', 140.243, 137.977, 105.522], ['A', ' C ', 139.148, 136.988, 105.216], ['A', ' O ', 138.247, 137.252, 104.409], ['A', ' CB ', 139.735, 139.406, 105.426], ['A', ' CG ', 138.767, 139.769, 106.49], ['A', ' OD1', 138.55, 138.961, 107.364], ['A', ' OD2', 138.235, 140.853, 106.432], ['A', ' H ', 141.405, 138.395, 103.769], ['A', ' HA ', 140.628, 137.791, 106.525], ['A', ' HB ', 140.583, 140.092, 105.468], ['A', ' HB ', 139.27, 139.542, 104.479]]
[['A', ' N ', 139.18, 135.865, 105.918], ['A', ' CA ', 138.274, 134.74, 105.702], ['A', ' C ', 136.941, 134.986, 106.392], ['A', ' O ', 136.521, 134.29, 107.313], ['A', ' CB ', 138.996, 133.465, 106.203], ['A', ' CG ', 138.333, 132.041, 106.078], ['A', ' CD1', 137.794, 131.815, 104.755], ['A', ' CD2', 139.413, 130.99, 106.312], ['A', ' H ', 139.976, 135.768, 106.55], ['A', ' HA ', 138.104, 134.651, 104.631], ['A', ' HB ', 139.968, 133.425, 105.736], ['A', ' HB ', 139.157, 133.617, 107.26], ['A', ' HG ', 137.535, 131.934, 106.816], ['A', ' HD1', 137.357, 130.817, 104.703], ['A', ' HD1', 137.05, 132.535, 104.641], ['A', ' HD1', 138.537, 131.914, 103.991], ['A', ' HD2', 138.975, 129.996, 106.232], ['A', ' HD2', 140.196, 131.081, 105.593], ['A', ' HD2', 139.828, 131.119, 107.276]]
[['A', ' N ', 136.286, 136.01, 105.847], ['A', ' CA ', 135.008, 136.584, 106.209], ['A', ' C ', 134.414, 136.963, 104.867], ['A', ' O ', 133.203, 136.999, 104.66], ['A', ' CB ', 135.185, 137.816, 107.101], ['A', ' CG ', 133.888, 138.284, 107.799], ['A', ' OD1', 133.342, 137.514, 108.556], ['A', ' OD2', 133.466, 139.399, 107.577], ['A', ' H ', 136.775, 136.476, 105.09], ['A', ' HA ', 134.38, 135.841, 106.698], ['A', ' HB ', 135.938, 137.603, 107.864], ['A', ' HB ', 135.578, 138.644, 106.502]]
[['A', ' N ', 135.331, 137.22, 103.93], ['A', ' CA ', 135.036, 137.645, 102.566], ['A', ' C ', 134.988, 136.456, 101.636], ['A', ' O ', 134.903, 136.595, 100.423], ['A', ' CB ', 136.089, 138.612, 102.068], ['A', ' CG ', 136.084, 139.967, 102.697], ['A', ' CD ', 137.32, 140.734, 102.37], ['A', ' NE ', 137.521, 140.984, 100.944], ['A', ' CZ ', 138.645, 141.549, 100.429], ['A', ' NH1', 139.626, 141.939, 101.229], ['A', ' NH2', 138.77, 141.704, 99.125], ['A', ' H ', 136.32, 137.152, 104.192], ['A', ' HA ', 134.066, 138.142, 102.554], ['A', ' HB ', 137.057, 138.192, 102.265], ['A', ' HB ', 136.001, 138.734, 100.991], ['A', ' HG ', 135.227, 140.528, 102.334], ['A', ' HG ', 136.025, 139.863, 103.783], ['A', ' HD ', 137.288, 141.691, 102.887], ['A', ' HD ', 138.162, 140.169, 102.716], ['A', ' HE ', 136.778, 140.688, 100.272], ['A', ' HH1', 139.549, 141.818, 102.229], ['A', ' HH1', 140.462, 142.352, 100.84], ['A', ' HH2', 138.022, 141.365, 98.502], ['A', ' HH2', 139.597, 142.113, 98.734]]
[['A', ' N ', 135.091, 135.28, 102.201], ['A', ' CA ', 135.131, 134.06, 101.435], ['A', ' C ', 133.874, 133.199, 101.446], ['A', ' O ', 133.295, 132.939, 102.502], ['A', ' CB ', 136.229, 133.229, 101.988], ['A', ' CG ', 136.244, 131.967, 101.427], ['A', ' CD1', 136.718, 131.795, 100.2], ['A', ' CD2', 135.729, 130.905, 102.12], ['A', ' CE1', 136.693, 130.602, 99.646], ['A', ' CE2', 135.697, 129.693, 101.568], ['A', ' CZ ', 136.176, 129.535, 100.322], ['A', ' H ', 135.132, 135.232, 103.209], ['A', ' HA ', 135.347, 134.317, 100.399], ['A', ' HB ', 137.197, 133.697, 101.868], ['A', ' HB ', 136.017, 133.14, 103.005], ['A', ' HD1', 137.109, 132.637, 99.652], ['A', ' HD2', 135.327, 131.056, 103.125], ['A', ' HE1', 137.078, 130.489, 98.663], ['A', ' HE2', 135.283, 128.842, 102.108], ['A', ' HZ ', 136.143, 128.547, 99.871]]
[['A', ' N ', 133.51, 132.691, 100.263], ['A', ' CA ', 132.404, 131.759, 100.092], ['A', ' C ', 132.853, 130.395, 99.545], ['A', ' O ', 133.663, 130.306, 98.623], ['A', ' CB ', 131.338, 132.359, 99.157], ['A', ' OG1', 130.832, 133.561, 99.731], ['A', ' CG2', 130.191, 131.394, 98.956], ['A', ' H ', 133.999, 132.993, 99.418], ['A', ' HA ', 131.948, 131.592, 101.067], ['A', ' HB ', 131.792, 132.591, 98.191], ['A', ' HG1', 131.534, 134.218, 99.73], ['A', ' HG2', 129.456, 131.854, 98.301], ['A', ' HG2', 130.541, 130.478, 98.503], ['A', ' HG2', 129.729, 131.169, 99.914]]
[['A', ' N ', 132.341, 129.317, 100.133], ['A', ' CA ', 132.643, 127.97, 99.642], ['A', ' C ', 131.541, 127.468, 98.71], ['A', ' O ', 130.387, 127.339, 99.126], ['A', ' CB ', 132.786, 126.995, 100.809], ['A', ' CG ', 133.098, 125.542, 100.419], ['A', ' CD ', 134.486, 125.335, 99.905], ['A', ' OE1', 135.321, 126.133, 100.21], ['A', ' OE2', 134.714, 124.359, 99.229], ['A', ' H ', 131.705, 129.436, 100.91], ['A', ' HA ', 133.58, 127.997, 99.083], ['A', ' HB ', 133.576, 127.335, 101.471], ['A', ' HB ', 131.862, 126.989, 101.384], ['A', ' HG ', 132.956, 124.912, 101.296], ['A', ' HG ', 132.39, 125.214, 99.664]]
[['A', ' N ', 131.881, 127.178, 97.461], ['A', ' CA ', 130.907, 126.718, 96.488], ['A', ' C ', 131.05, 125.281, 96.022], ['A', ' O ', 132.118, 124.799, 95.643], ['A', ' CB ', 130.9, 127.664, 95.279], ['A', ' CG1', 130.501, 129.071, 95.697], ['A', ' CG2', 130.075, 127.16, 94.141], ['A', ' CD1', 129.116, 129.245, 96.307], ['A', ' H ', 132.842, 127.316, 97.135], ['A', ' HA ', 129.931, 126.763, 96.954], ['A', ' HB ', 131.915, 127.764, 94.923], ['A', ' HG1', 131.247, 129.454, 96.395], ['A', ' HG1', 130.518, 129.664, 94.822], ['A', ' HG2', 130.148, 127.867, 93.346], ['A', ' HG2', 130.446, 126.204, 93.791], ['A', ' HG2', 129.038, 127.052, 94.437], ['A', ' HD1', 128.96, 130.299, 96.514], ['A', ' HD1', 128.352, 128.912, 95.612], ['A', ' HD1', 129.02, 128.696, 97.236]]
[['A', ' N ', 129.933, 124.583, 96.03], ['A', ' CA ', 129.909, 123.224, 95.542], ['A', ' C ', 129.923, 123.354, 94.037], ['A', ' O ', 129.107, 124.116, 93.505], ['A', ' CB ', 128.693, 122.501, 96.073], ['A', ' CG ', 128.691, 122.383, 97.565], ['A', ' SD ', 130.065, 121.386, 98.169], ['A', ' CE ', 131.235, 122.608, 98.801], ['A', ' H ', 129.091, 125.027, 96.377], ['A', ' HA ', 130.807, 122.721, 95.874], ['A', ' HB ', 127.792, 123.037, 95.775], ['A', ' HB ', 128.622, 121.498, 95.655], ['A', ' HG ', 128.753, 123.371, 98.02], ['A', ' HG ', 127.76, 121.915, 97.887], ['A', ' HE ', 132.101, 122.103, 99.217], ['A', ' HE ', 131.563, 123.271, 98.015], ['A', ' HE ', 130.758, 123.194, 99.586]]
[['A', ' N ', 130.721, 122.539, 93.331], ['A', ' CA ', 130.993, 122.629, 91.917], ['A', ' C ', 129.776, 122.531, 91.055], ['A', ' O ', 129.745, 123.103, 89.978], ['A', ' CB ', 131.897, 121.426, 91.664], ['A', ' CG ', 131.585, 120.465, 92.768], ['A', ' CD ', 131.261, 121.321, 93.961], ['A', ' HA ', 131.53, 123.563, 91.719], ['A', ' HB ', 131.68, 120.993, 90.679], ['A', ' HB ', 132.956, 121.743, 91.655], ['A', ' HG ', 130.744, 119.805, 92.476], ['A', ' HG ', 132.454, 119.805, 92.935], ['A', ' HD ', 130.501, 120.794, 94.553], ['A', ' HD ', 132.155, 121.522, 94.531]]
[['A', ' N ', 128.708, 121.923, 91.53], ['A', ' CA ', 127.554, 121.826, 90.678], ['A', ' C ', 127.042, 123.194, 90.249], ['A', ' O ', 126.563, 123.346, 89.127], ['A', ' CB ', 126.453, 121.043, 91.38], ['A', ' CG ', 126.793, 119.571, 91.623], ['A', ' CD ', 127.618, 119.332, 92.862], ['A', ' OE1', 127.975, 120.29, 93.514], ['A', ' OE2', 127.9, 118.195, 93.157], ['A', ' H ', 128.676, 121.445, 92.436], ['A', ' HA ', 127.858, 121.294, 89.789], ['A', ' HB ', 126.235, 121.507, 92.344], ['A', ' HB ', 125.543, 121.083, 90.784], ['A', ' HG ', 125.87, 118.999, 91.695], ['A', ' HG ', 127.347, 119.198, 90.767]]
[['A', ' N ', 127.218, 124.209, 91.094], ['A', ' CA ', 126.725, 125.544, 90.809], ['A', ' C ', 127.474, 126.244, 89.678], ['A', ' O ', 127.027, 127.278, 89.188], ['A', ' CB ', 126.814, 126.398, 92.054], ['A', ' OG ', 125.94, 125.95, 93.058], ['A', ' H ', 127.671, 124.052, 92.001], ['A', ' HA ', 125.678, 125.463, 90.519], ['A', ' HB ', 127.833, 126.367, 92.423], ['A', ' HB ', 126.59, 127.433, 91.804], ['A', ' HG ', 126.09, 126.525, 93.814]]
[['A', ' N ', 128.646, 125.735, 89.311], ['A', ' CA ', 129.449, 126.328, 88.255], ['A', ' C ', 129.372, 125.681, 86.904], ['A', ' O ', 130.029, 126.155, 85.959], ['A', ' CB ', 130.882, 126.405, 88.667], ['A', ' CG ', 131.091, 127.567, 89.44], ['A', ' CD1', 130.499, 127.909, 90.588], ['A', ' CD2', 131.953, 128.636, 89.099], ['A', ' NE1', 130.927, 129.125, 90.982], ['A', ' CE2', 131.812, 129.588, 90.08], ['A', ' CE3', 132.813, 128.867, 88.04], ['A', ' CZ2', 132.487, 130.758, 90.045], ['A', ' CZ3', 133.498, 130.049, 88.008], ['A', ' CH2', 133.332, 130.971, 88.987], ['A', ' H ', 128.97, 124.863, 89.734], ['A', ' HA ', 129.105, 127.355, 88.135], ['A', ' HB ', 131.119, 125.522, 89.257], ['A', ' HB ', 131.527, 126.406, 87.8], ['A', ' HD1', 129.774, 127.312, 91.119], ['A', ' HE1', 130.625, 129.615, 91.811], ['A', ' HE3', 132.943, 128.134, 87.248], ['A', ' HZ2', 132.364, 131.513, 90.81], ['A', ' HZ3', 134.178, 130.235, 87.171], ['A', ' HH2', 133.875, 131.897, 88.927]]
[['A', ' N ', 128.608, 124.615, 86.763], ['A', ' CA ', 128.593, 124.011, 85.461], ['A', ' C ', 127.158, 123.876, 85.028], ['A', ' O ', 126.296, 123.471, 85.798], ['A', ' CB ', 129.316, 122.672, 85.498], ['A', ' CG ', 130.744, 122.788, 86.024], ['A', ' CD1', 130.986, 122.49, 87.328], ['A', ' CD2', 131.777, 123.217, 85.234], ['A', ' CE1', 132.249, 122.609, 87.86], ['A', ' CE2', 133.06, 123.336, 85.767], ['A', ' CZ ', 133.285, 123.037, 87.069], ['A', ' OH ', 134.55, 123.156, 87.599], ['A', ' H ', 128.041, 124.238, 87.536], ['A', ' HA ', 129.087, 124.66, 84.739], ['A', ' HB ', 128.778, 121.992, 86.134], ['A', ' HB ', 129.341, 122.242, 84.499], ['A', ' HD1', 130.167, 122.153, 87.94], ['A', ' HD2', 131.589, 123.46, 84.198], ['A', ' HE1', 132.422, 122.368, 88.902], ['A', ' HE2', 133.888, 123.671, 85.15], ['A', ' HH ', 135.172, 123.44, 86.907]]
[['A', ' N ', 126.892, 124.249, 83.791], ['A', ' CA ', 125.557, 124.139, 83.249], ['A', ' C ', 125.266, 122.73, 82.795], ['A', ' O ', 124.146, 122.237, 82.907], ['A', ' CB ', 125.448, 125.143, 82.119], ['A', ' CG ', 126.61, 124.977, 81.143], ['A', ' OD1', 127.552, 124.239, 81.47], ['A', ' OD2', 126.602, 125.618, 80.113], ['A', ' H ', 127.639, 124.575, 83.178], ['A', ' HA ', 124.841, 124.405, 84.028], ['A', ' HB ', 124.507, 124.993, 81.588], ['A', ' HB ', 125.449, 126.155, 82.521]]
[['A', ' N ', 126.317, 122.086, 82.336], ['A', ' CA ', 126.309, 120.728, 81.834], ['A', ' C ', 126.465, 119.743, 82.997], ['A', ' O ', 127.534, 119.75, 83.624], ['A', ' CB ', 127.461, 120.509, 80.843], ['A', ' CG ', 127.395, 119.128, 80.196], ['A', ' OD1', 126.533, 118.366, 80.629], ['A', ' OD2', 128.173, 118.824, 79.299], ['A', ' H ', 127.154, 122.661, 82.249], ['A', ' HA ', 125.39, 120.574, 81.286], ['A', ' HB ', 127.42, 121.278, 80.066], ['A', ' HB ', 128.418, 120.619, 81.36]]
[['A', ' N ', 125.453, 118.896, 83.319], ['A', ' CA ', 125.454, 117.911, 84.389], ['A', ' C ', 126.623, 116.944, 84.239], ['A', ' O ', 127.093, 116.368, 85.216], ['A', ' CB ', 124.13, 117.18, 84.191], ['A', ' CG ', 123.253, 118.169, 83.497], ['A', ' CD ', 124.173, 118.934, 82.583], ['A', ' HA ', 125.467, 118.427, 85.35], ['A', ' HB ', 124.293, 116.266, 83.596], ['A', ' HB ', 123.729, 116.862, 85.162], ['A', ' HG ', 122.454, 117.652, 82.948], ['A', ' HG ', 122.763, 118.821, 84.234], ['A', ' HD ', 124.269, 118.439, 81.602], ['A', ' HD ', 123.768, 119.937, 82.507]]
[['A', ' N ', 127.142, 116.812, 83.013], ['A', ' CA ', 128.266, 115.929, 82.774], ['A', ' C ', 129.455, 116.407, 83.561], ['A', ' O ', 130.263, 115.607, 84.017], ['A', ' CB ', 128.645, 115.9, 81.297], ['A', ' CG ', 129.84, 115.011, 80.932], ['A', ' CD ', 129.636, 113.56, 81.181], ['A', ' OE1', 128.509, 113.138, 81.307], ['A', ' OE2', 130.621, 112.857, 81.23], ['A', ' H ', 126.754, 117.319, 82.203], ['A', ' HA ', 128.003, 114.922, 83.103], ['A', ' HB ', 127.783, 115.596, 80.702], ['A', ' HB ', 128.91, 116.904, 80.986], ['A', ' HG ', 130.045, 115.148, 79.872], ['A', ' HG ', 130.719, 115.348, 81.477]]
[['A', ' N ', 129.604, 117.71, 83.71], ['A', ' CA ', 130.736, 118.184, 84.44], ['A', ' C ', 130.332, 118.334, 85.875], ['A', ' O ', 131.038, 117.9, 86.787], ['A', ' CB ', 131.258, 119.508, 83.928], ['A', ' CG1', 131.732, 119.335, 82.486], ['A', ' CG2', 132.384, 119.906, 84.85], ['A', ' CD1', 132.09, 120.635, 81.782], ['A', ' H ', 128.914, 118.373, 83.353], ['A', ' HA ', 131.54, 117.452, 84.377], ['A', ' HB ', 130.48, 120.259, 83.923], ['A', ' HG1', 132.566, 118.668, 82.471], ['A', ' HG1', 130.926, 118.869, 81.917], ['A', ' HG2', 132.836, 120.813, 84.522], ['A', ' HG2', 132.04, 120.042, 85.865], ['A', ' HG2', 133.105, 119.123, 84.84], ['A', ' HD1', 132.389, 120.414, 80.76], ['A', ' HD1', 131.222, 121.297, 81.768], ['A', ' HD1', 132.911, 121.129, 82.29]]
[['A', ' N ', 129.151, 118.882, 86.102], ['A', ' CA ', 128.743, 119.142, 87.466], ['A', ' C ', 128.817, 117.893, 88.329], ['A', ' O ', 129.263, 117.962, 89.468], ['A', ' CB ', 127.314, 119.639, 87.471], ['A', ' H ', 128.574, 119.191, 85.315], ['A', ' HA ', 129.409, 119.894, 87.885], ['A', ' HB ', 126.988, 119.838, 88.466], ['A', ' HB ', 127.217, 120.541, 86.873], ['A', ' HB ', 126.695, 118.872, 87.064]]
[['A', ' N ', 128.464, 116.737, 87.774], ['A', ' CA ', 128.462, 115.499, 88.526], ['A', ' C ', 129.755, 114.699, 88.451], ['A', ' O ', 129.824, 113.612, 89.026], ['A', ' CB ', 127.303, 114.625, 88.069], ['A', ' CG ', 125.942, 115.22, 88.368], ['A', ' CD ', 124.824, 114.294, 87.926], ['A', ' CE ', 123.459, 114.883, 88.255], ['A', ' NZ ', 122.345, 113.985, 87.827], ['A', ' H ', 128.113, 116.715, 86.813], ['A', ' HA ', 128.301, 115.752, 89.574], ['A', ' HB ', 127.376, 114.467, 86.991], ['A', ' HB ', 127.364, 113.652, 88.552], ['A', ' HG ', 125.857, 115.416, 89.437], ['A', ' HG ', 125.848, 116.167, 87.834], ['A', ' HD ', 124.894, 114.141, 86.847], ['A', ' HD ', 124.93, 113.331, 88.422], ['A', ' HE ', 123.391, 115.042, 89.331], ['A', ' HE ', 123.354, 115.843, 87.748], ['A', ' HZ ', 121.459, 114.411, 88.064], ['A', ' HZ ', 122.391, 113.839, 86.829], ['A', ' HZ ', 122.426, 113.097, 88.301]]
[['A', ' N ', 130.751, 115.178, 87.715], ['A', ' CA ', 132.031, 114.481, 87.6], ['A', ' C ', 133.158, 115.23, 88.263], ['A', ' O ', 134.122, 114.619, 88.714], ['A', ' CB ', 132.426, 114.211, 86.165], ['A', ' CG ', 131.597, 113.174, 85.46], ['A', ' CD ', 132.039, 112.988, 84.059], ['A', ' NE ', 133.41, 112.462, 83.962], ['A', ' CZ ', 134.152, 112.474, 82.827], ['A', ' NH1', 133.645, 112.954, 81.705], ['A', ' NH2', 135.388, 111.99, 82.812], ['A', ' H ', 130.642, 116.093, 87.284], ['A', ' HA ', 131.937, 113.518, 88.1], ['A', ' HB ', 132.344, 115.137, 85.592], ['A', ' HB ', 133.468, 113.9, 86.131], ['A', ' HG ', 131.682, 112.223, 85.98], ['A', ' HG ', 130.552, 113.492, 85.451], ['A', ' HD ', 131.366, 112.285, 83.571], ['A', ' HD ', 132.001, 113.941, 83.539], ['A', ' HE ', 133.828, 112.072, 84.795], ['A', ' HH1', 132.668, 113.279, 81.661], ['A', ' HH1', 134.2, 112.954, 80.856], ['A', ' HH2', 135.812, 111.546, 83.634], ['A', ' HH2', 135.92, 112.006, 81.951]]
[['A', ' N ', 133.056, 116.547, 88.316], ['A', ' CA ', 134.121, 117.34, 88.878], ['A', ' C ', 134.356, 116.904, 90.307], ['A', ' O ', 133.418, 116.765, 91.096], ['A', ' CB ', 133.763, 118.817, 88.792], ['A', ' H ', 132.253, 117.012, 87.898], ['A', ' HA ', 135.032, 117.147, 88.32], ['A', ' HB ', 134.567, 119.417, 89.21], ['A', ' HB ', 133.605, 119.088, 87.746], ['A', ' HB ', 132.845, 118.997, 89.351]]
[['A', ' N ', 135.627, 116.764, 90.644], ['A', ' CA ', 136.073, 116.302, 91.954], ['A', ' C ', 136.732, 117.355, 92.822], ['A', ' O ', 137.601, 117.046, 93.637], ['A', ' CB ', 137.049, 115.156, 91.772], ['A', ' SG ', 136.325, 113.705, 91.011], ['A', ' H ', 136.315, 116.902, 89.897], ['A', ' HA ', 135.203, 115.921, 92.489], ['A', ' HB ', 137.879, 115.48, 91.143], ['A', ' HB ', 137.465, 114.858, 92.733], ['A', ' HG ', 137.46, 112.981, 91.037]]
[['A', ' N ', 136.333, 118.598, 92.663], ['A', ' CA ', 136.869, 119.652, 93.497], ['A', ' C ', 135.828, 120.69, 93.8], ['A', ' O ', 134.856, 120.839, 93.066], ['A', ' CB ', 138.016, 120.314, 92.816], ['A', ' OG ', 137.604, 120.96, 91.647], ['A', ' H ', 135.647, 118.82, 91.957], ['A', ' HA ', 137.205, 119.22, 94.441], ['A', ' HB ', 138.409, 121.023, 93.484], ['A', ' HB ', 138.794, 119.59, 92.595], ['A', ' HG ', 138.388, 121.377, 91.295]]
[['A', ' N ', 136.019, 121.415, 94.89], ['A', ' CA ', 135.106, 122.48, 95.242], ['A', ' C ', 135.63, 123.772, 94.693], ['A', ' O ', 136.758, 123.828, 94.21], ['A', ' CB ', 134.882, 122.583, 96.751], ['A', ' OG1', 136.099, 122.925, 97.396], ['A', ' CG2', 134.367, 121.256, 97.304], ['A', ' H ', 136.82, 121.248, 95.484], ['A', ' HA ', 134.15, 122.301, 94.771], ['A', ' HB ', 134.148, 123.368, 96.951], ['A', ' HG1', 135.862, 123.408, 98.231], ['A', ' HG2', 134.214, 121.354, 98.375], ['A', ' HG2', 133.424, 121.003, 96.824], ['A', ' HG2', 135.092, 120.466, 97.118]]
[['A', ' N ', 134.814, 124.813, 94.744], ['A', ' CA ', 135.192, 126.111, 94.245], ['A', ' C ', 135.263, 127.188, 95.306], ['A', ' O ', 134.239, 127.681, 95.77], ['A', ' CB ', 134.19, 126.518, 93.165], ['A', ' CG1', 134.293, 125.461, 92.052], ['A', ' CG2', 134.307, 128.001, 92.735], ['A', ' CD1', 133.378, 125.649, 90.938], ['A', ' H ', 133.88, 124.704, 95.145], ['A', ' HA ', 136.154, 126.016, 93.753], ['A', ' HB ', 133.194, 126.381, 93.574], ['A', ' HG1', 135.308, 125.411, 91.693], ['A', ' HG1', 134.04, 124.494, 92.477], ['A', ' HG2', 133.552, 128.232, 92.002], ['A', ' HG2', 134.16, 128.665, 93.578], ['A', ' HG2', 135.255, 128.191, 92.332], ['A', ' HD1', 133.498, 124.83, 90.224], ['A', ' HD1', 132.361, 125.659, 91.316], ['A', ' HD1', 133.596, 126.584, 90.44]]
[['A', ' N ', 136.444, 127.529, 95.789], ['A', ' CA ', 136.636, 128.604, 96.7], ['A', ' C ', 136.212, 129.836, 95.931], ['A', ' O ', 136.578, 129.955, 94.763], ['A', ' CB ', 138.137, 128.554, 96.934], ['A', ' CG ', 138.537, 127.182, 96.601], ['A', ' CD ', 137.641, 126.789, 95.48], ['A', ' HA ', 136.029, 128.442, 97.603], ['A', ' HB ', 138.589, 129.221, 96.254], ['A', ' HB ', 138.411, 128.862, 97.941], ['A', ' HG ', 139.602, 127.159, 96.307], ['A', ' HG ', 138.443, 126.516, 97.474], ['A', ' HD ', 138.061, 127.105, 94.515], ['A', ' HD ', 137.494, 125.711, 95.548]]
[['A', ' N ', 135.525, 130.782, 96.538], ['A', ' CA ', 135.156, 131.94, 95.767], ['A', ' C ', 135.293, 133.224, 96.614], ['A', ' O ', 134.427, 133.555, 97.439], ['A', ' CB ', 133.711, 131.673, 95.338], ['A', ' CG ', 133.107, 132.568, 94.396], ['A', ' CD1', 133.783, 132.403, 93.079], ['A', ' CD2', 131.662, 132.287, 94.262], ['A', ' H ', 135.167, 130.664, 97.487], ['A', ' HA ', 135.83, 132.019, 94.922], ['A', ' HB ', 133.668, 130.669, 94.915], ['A', ' HB ', 133.092, 131.673, 96.236], ['A', ' HG ', 133.26, 133.555, 94.734], ['A', ' HD1', 133.334, 133.086, 92.366], ['A', ' HD1', 134.815, 132.606, 93.165], ['A', ' HD1', 133.655, 131.381, 92.735], ['A', ' HD2', 131.217, 132.981, 93.543], ['A', ' HD2', 131.55, 131.285, 93.902], ['A', ' HD2', 131.169, 132.398, 95.228]]
[['A', ' N ', 136.372, 133.972, 96.41], ['A', ' CA ', 136.655, 135.105, 97.293], ['A', ' C ', 135.918, 136.339, 96.808], ['A', ' O ', 135.983, 136.691, 95.635], ['A', ' CB ', 138.158, 135.337, 97.39], ['A', ' CG ', 138.572, 136.176, 98.533], ['A', ' CD1', 138.415, 135.626, 99.78], ['A', ' CD2', 139.138, 137.407, 98.394], ['A', ' CE1', 138.798, 136.286, 100.891], ['A', ' CE2', 139.541, 138.083, 99.534], ['A', ' CZ ', 139.362, 137.507, 100.778], ['A', ' OH ', 139.753, 138.138, 101.925], ['A', ' H ', 137.011, 133.732, 95.662], ['A', ' HA ', 136.276, 134.877, 98.285], ['A', ' HB ', 138.664, 134.416, 97.481], ['A', ' HB ', 138.509, 135.811, 96.472], ['A', ' HD1', 137.981, 134.648, 99.876], ['A', ' HD2', 139.278, 137.85, 97.406], ['A', ' HE1', 138.663, 135.831, 101.876], ['A', ' HE2', 140.0, 139.064, 99.447], ['A', ' HH ', 139.424, 137.619, 102.688]]
[['A', ' N ', 135.136, 136.947, 97.687], ['A', ' CA ', 134.286, 138.085, 97.373], ['A', ' C ', 133.209, 137.707, 96.378], ['A', ' O ', 132.613, 138.573, 95.74], ['A', ' CB ', 135.064, 139.287, 96.817], ['A', ' CG ', 135.962, 139.96, 97.821], ['A', ' OD1', 135.577, 140.081, 98.969], ['A', ' OD2', 137.023, 140.4, 97.429], ['A', ' H ', 135.121, 136.625, 98.651], ['A', ' HA ', 133.797, 138.4, 98.296], ['A', ' HB ', 135.659, 139.001, 95.959], ['A', ' HB ', 134.35, 140.029, 96.463]]
[['A', ' N ', 132.942, 136.416, 96.226], ['A', ' CA ', 131.901, 135.997, 95.313], ['A', ' C ', 132.389, 135.89, 93.873], ['A', ' O ', 131.593, 135.634, 92.967], ['A', ' H ', 133.457, 135.707, 96.758], ['A', ' HA ', 131.509, 135.035, 95.639], ['A', ' HA ', 131.075, 136.704, 95.362]]
[['A', ' N ', 133.683, 136.074, 93.641], ['A', ' CA ', 134.205, 136.003, 92.294], ['A', ' C ', 135.399, 135.077, 92.276], ['A', ' O ', 136.129, 134.974, 93.254], ['A', ' CB ', 134.572, 137.393, 91.827], ['A', ' CG ', 133.379, 138.335, 91.796], ['A', ' CD ', 133.701, 139.711, 91.381], ['A', ' NE ', 134.13, 139.795, 90.011], ['A', ' CZ ', 133.355, 139.828, 88.926], ['A', ' NH1', 132.041, 139.74, 89.0], ['A', ' NH2', 133.967, 139.95, 87.774], ['A', ' H ', 134.324, 136.299, 94.409], ['A', ' HA ', 133.443, 135.595, 91.63], ['A', ' HB ', 135.335, 137.815, 92.484], ['A', ' HB ', 134.984, 137.334, 90.825], ['A', ' HG ', 132.621, 137.925, 91.135], ['A', ' HG ', 132.967, 138.416, 92.801], ['A', ' HD ', 132.828, 140.349, 91.513], ['A', ' HD ', 134.51, 140.086, 92.009], ['A', ' HE ', 135.118, 139.904, 89.826], ['A', ' HH1', 131.588, 139.644, 89.896], ['A', ' HH1', 131.485, 139.768, 88.157], ['A', ' HH2', 134.993, 140.025, 87.797], ['A', ' HH2', 133.453, 139.983, 86.909]]
[['A', ' N ', 135.607, 134.367, 91.189], ['A', ' CA ', 136.776, 133.526, 91.134], ['A', ' C ', 137.973, 134.419, 91.043], ['A', ' O ', 137.904, 135.441, 90.372], ['A', ' CB ', 136.666, 132.602, 89.973], ['A', ' CG ', 136.38, 133.371, 88.776], ['A', ' OD1', 135.272, 133.933, 88.674], ['A', ' ND2', 137.305, 133.457, 87.879], ['A', ' H ', 134.989, 134.439, 90.383], ['A', ' HA ', 136.864, 132.948, 92.057], ['A', ' HB ', 137.6, 132.063, 89.841], ['A', ' HB ', 135.883, 131.876, 90.149], ['A', ' HD2', 137.148, 133.987, 87.051], ['A', ' HD2', 138.195, 133.009, 88.029]]
[['A', ' N ', 139.054, 134.075, 91.721], ['A', ' CA ', 140.244, 134.901, 91.603], ['A', ' C ', 141.473, 134.104, 91.307], ['A', ' O ', 141.643, 133.021, 91.857], ['A', ' CB ', 140.487, 135.707, 92.896], ['A', ' CG1', 139.347, 136.681, 93.124], ['A', ' CG2', 140.624, 134.764, 94.115], ['A', ' H ', 139.049, 133.223, 92.264], ['A', ' HA ', 140.094, 135.604, 90.786], ['A', ' HB ', 141.398, 136.288, 92.78], ['A', ' HG1', 139.543, 137.267, 94.019], ['A', ' HG1', 139.273, 137.343, 92.272], ['A', ' HG1', 138.409, 136.148, 93.247], ['A', ' HG2', 140.786, 135.365, 95.001], ['A', ' HG2', 139.709, 134.191, 94.24], ['A', ' HG2', 141.462, 134.081, 93.994]]
[['A', ' N ', 142.387, 134.684, 90.548], ['A', ' CA ', 143.648, 133.985, 90.347], ['A', ' C ', 144.475, 134.047, 91.591], ['A', ' O ', 144.518, 135.089, 92.253], ['A', ' CB ', 144.523, 134.597, 89.271], ['A', ' CG ', 144.068, 134.484, 87.892], ['A', ' CD ', 145.082, 135.078, 86.968], ['A', ' OE1', 145.947, 135.763, 87.464], ['A', ' OE2', 145.033, 134.833, 85.79], ['A', ' H ', 142.158, 135.58, 90.098], ['A', ' HA ', 143.437, 132.944, 90.108], ['A', ' HB ', 144.639, 135.659, 89.486], ['A', ' HB ', 145.517, 134.147, 89.331], ['A', ' HG ', 143.899, 133.444, 87.643], ['A', ' HG ', 143.13, 135.014, 87.814]]
[['A', ' N ', 145.165, 132.969, 91.866], ['A', ' CA ', 146.109, 132.925, 92.959], ['A', ' C ', 147.369, 132.325, 92.339], ['A', ' O ', 147.263, 131.535, 91.406], ['A', ' CB ', 145.548, 132.082, 94.101], ['A', ' CG1', 145.487, 130.669, 93.716], ['A', ' CG2', 146.321, 132.283, 95.296], ['A', ' H ', 145.019, 132.148, 91.27], ['A', ' HA ', 146.32, 133.934, 93.32], ['A', ' HB ', 144.519, 132.39, 94.295], ['A', ' HG1', 145.074, 130.16, 94.54], ['A', ' HG1', 144.858, 130.548, 92.845], ['A', ' HG1', 146.471, 130.264, 93.503], ['A', ' HG2', 145.895, 131.684, 96.105], ['A', ' HG2', 147.302, 132.0, 95.109], ['A', ' HG2', 146.295, 133.315, 95.568]]
[['A', ' N ', 148.559, 132.665, 92.797], ['A', ' CA ', 149.707, 132.067, 92.143], ['A', ' C ', 150.839, 133.054, 92.118], ['A', ' O ', 150.829, 133.985, 92.906], ['A', ' H ', 148.677, 133.313, 93.569], ['A', ' HA ', 150.004, 131.158, 92.65], ['A', ' HA ', 149.417, 131.798, 91.134]]
[['A', ' N ', 151.926, 132.759, 91.393], ['A', ' CA ', 153.107, 133.584, 91.23], ['A', ' C ', 152.933, 134.862, 90.414], ['A', ' O ', 153.746, 135.755, 90.555], ['A', ' CB ', 154.072, 132.632, 90.557], ['A', ' CG ', 153.209, 131.632, 89.897], ['A', ' CD ', 152.018, 131.469, 90.747], ['A', ' HA ', 153.488, 133.847, 92.229], ['A', ' HB ', 154.699, 133.19, 89.843], ['A', ' HB ', 154.76, 132.199, 91.307], ['A', ' HG ', 152.993, 131.897, 88.851], ['A', ' HG ', 153.748, 130.715, 89.893], ['A', ' HD ', 151.178, 131.258, 90.084], ['A', ' HD ', 152.182, 130.663, 91.491]]
[['A', ' N ', 151.908, 134.984, 89.531], ['A', ' CA ', 151.79, 136.306, 88.891], ['A', ' C ', 150.895, 137.103, 89.801], ['A', ' O ', 150.883, 138.326, 89.811], ['A', ' CB ', 151.239, 136.33, 87.483], ['A', ' CG ', 149.779, 135.995, 87.309], ['A', ' CD ', 149.312, 136.364, 85.951], ['A', ' NE ', 149.358, 137.796, 85.758], ['A', ' CZ ', 148.444, 138.676, 86.201], ['A', ' NH1', 147.368, 138.299, 86.869], ['A', ' NH2', 148.636, 139.947, 85.952], ['A', ' H ', 151.267, 134.236, 89.325], ['A', ' HA ', 152.759, 136.793, 88.865], ['A', ' HB ', 151.403, 137.321, 87.075], ['A', ' HB ', 151.809, 135.645, 86.879], ['A', ' HG ', 149.627, 134.926, 87.434], ['A', ' HG ', 149.164, 136.531, 88.02], ['A', ' HD ', 149.985, 135.934, 85.227], ['A', ' HD ', 148.294, 136.005, 85.772], ['A', ' HE ', 150.149, 138.176, 85.24], ['A', ' HH1', 147.166, 137.304, 87.06], ['A', ' HH1', 146.712, 138.992, 87.19], ['A', ' HH2', 149.459, 140.239, 85.406], ['A', ' HH2', 147.975, 140.635, 86.267]]
[['A', ' N ', 150.101, 136.383, 90.556], ['A', ' CA ', 149.32, 136.976, 91.588], ['A', ' C ', 150.408, 137.142, 92.584], ['A', ' O ', 151.48, 136.618, 92.34], ['A', ' CB ', 148.189, 136.111, 92.06], ['A', ' H ', 150.078, 135.386, 90.436], ['A', ' HA ', 148.944, 137.949, 91.277], ['A', ' HB ', 147.69, 136.575, 92.911], ['A', ' HB ', 147.472, 135.958, 91.254], ['A', ' HB ', 148.59, 135.184, 92.36]]
[['A', ' N ', 150.282, 137.958, 93.594], ['A', ' CA ', 151.415, 138.012, 94.516], ['A', ' C ', 152.699, 138.414, 93.77], ['A', ' O ', 153.795, 137.951, 94.077], ['A', ' CB ', 151.617, 136.633, 95.122], ['A', ' CG ', 152.474, 136.535, 96.285], ['A', ' CD ', 152.534, 135.156, 96.702], ['A', ' NE ', 153.234, 134.364, 95.74], ['A', ' CZ ', 153.185, 133.03, 95.62], ['A', ' NH1', 152.447, 132.286, 96.415], ['A', ' NH2', 153.903, 132.477, 94.692], ['A', ' H ', 149.41, 138.435, 93.783], ['A', ' HA ', 151.21, 138.74, 95.301], ['A', ' HB ', 150.668, 136.173, 95.35], ['A', ' HB ', 152.102, 135.983, 94.417], ['A', ' HG ', 153.48, 136.851, 96.107], ['A', ' HG ', 152.043, 137.131, 97.053], ['A', ' HD ', 153.037, 135.07, 97.661], ['A', ' HD ', 151.523, 134.795, 96.762], ['A', ' HE ', 153.815, 134.874, 95.08], ['A', ' HH1', 151.885, 132.721, 97.163], ['A', ' HH1', 152.47, 131.259, 96.306], ['A', ' HH2', 154.512, 133.068, 94.122], ['A', ' HH2', 153.922, 131.479, 94.562]]
[['A', ' N ', 152.544, 139.288, 92.793], ['A', ' CA ', 153.644, 139.822, 92.008], ['A', ' C ', 153.155, 141.166, 91.548], ['A', ' O ', 153.913, 142.03, 91.142], ['A', ' CB ', 153.987, 138.903, 90.857], ['A', ' CG ', 155.254, 139.213, 90.109], ['A', ' SD ', 156.716, 139.005, 91.097], ['A', ' CE ', 156.913, 137.237, 91.155], ['A', ' H ', 151.61, 139.578, 92.577], ['A', ' HA ', 154.516, 139.967, 92.644], ['A', ' HB ', 154.043, 137.918, 91.239], ['A', ' HB ', 153.192, 138.932, 90.133], ['A', ' HG ', 155.327, 138.576, 89.232], ['A', ' HG ', 155.236, 140.218, 89.786], ['A', ' HE ', 157.797, 136.992, 91.738], ['A', ' HE ', 156.036, 136.773, 91.616], ['A', ' HE ', 157.031, 136.852, 90.148]]
[['A', ' N ', 151.835, 141.309, 91.637], ['A', ' CA ', 151.074, 142.493, 91.277], ['A', ' C ', 150.614, 143.138, 92.576], ['A', ' O ', 149.813, 144.069, 92.587], ['A', ' CB ', 149.851, 142.129, 90.407], ['A', ' CG1', 150.292, 141.508, 89.115], ['A', ' CG2', 148.961, 141.144, 91.159], ['A', ' H ', 151.326, 140.517, 91.971], ['A', ' HA ', 151.719, 143.188, 90.735], ['A', ' HB ', 149.292, 143.033, 90.173], ['A', ' HG1', 149.427, 141.258, 88.512], ['A', ' HG1', 150.899, 142.214, 88.581], ['A', ' HG1', 150.863, 140.622, 89.307], ['A', ' HG2', 148.099, 140.895, 90.543], ['A', ' HG2', 149.508, 140.242, 91.377], ['A', ' HG2', 148.615, 141.591, 92.078]]
[['A', ' N ', 151.103, 142.543, 93.654], ['A', ' CA ', 150.927, 142.885, 95.044], ['A', ' C ', 152.314, 142.691, 95.59], ['A', ' O ', 153.019, 141.801, 95.117], ['A', ' CB ', 149.971, 141.946, 95.783], ['A', ' CG ', 148.523, 141.946, 95.353], ['A', ' CD ', 147.779, 143.194, 95.744], ['A', ' OE1', 148.329, 144.005, 96.46], ['A', ' OE2', 146.642, 143.33, 95.349], ['A', ' H ', 151.758, 141.804, 93.473], ['A', ' HA ', 150.623, 143.926, 95.157], ['A', ' HB ', 150.333, 140.929, 95.688], ['A', ' HB ', 149.99, 142.189, 96.847], ['A', ' HG ', 148.477, 141.841, 94.285], ['A', ' HG ', 148.025, 141.081, 95.791]]
[['A', ' N ', 152.716, 143.479, 96.572], ['A', ' CA ', 154.031, 143.383, 97.231], ['A', ' C ', 155.129, 143.899, 96.284], ['A', ' O ', 155.791, 144.897, 96.57], ['A', ' CB ', 154.313, 141.945, 97.667], ['A', ' CG ', 153.206, 141.444, 98.467], ['A', ' CD1', 152.45, 140.419, 97.987], ['A', ' CD2', 152.847, 142.038, 99.643], ['A', ' CE1', 151.366, 140.004, 98.657], ['A', ' CE2', 151.748, 141.611, 100.315], ['A', ' CZ ', 151.007, 140.599, 99.808], ['A', ' H ', 152.06, 144.172, 96.902], ['A', ' HA ', 154.025, 144.024, 98.112], ['A', ' HB ', 154.474, 141.292, 96.838], ['A', ' HB ', 155.214, 141.918, 98.271], ['A', ' HD1', 152.729, 139.949, 97.037], ['A', ' HD2', 153.433, 142.868, 100.035], ['A', ' HE1', 150.784, 139.214, 98.279], ['A', ' HE2', 151.45, 142.088, 101.252], ['A', ' HZ ', 150.123, 140.268, 100.334]]
[['A', ' N ', 155.287, 143.233, 95.149], ['A', ' CA ', 156.14, 143.668, 94.054], ['A', ' C ', 155.23, 144.26, 92.994], ['A', ' O ', 154.032, 143.999, 92.998], ['A', ' CB ', 156.978, 142.525, 93.478], ['A', ' CG ', 158.008, 141.964, 94.447], ['A', ' CD ', 158.882, 140.879, 93.826], ['A', ' OE1', 158.938, 140.755, 92.603], ['A', ' NE2', 159.579, 140.122, 94.66], ['A', ' H ', 154.706, 142.408, 95.028], ['A', ' HA ', 156.809, 144.451, 94.405], ['A', ' HB ', 156.314, 141.708, 93.188], ['A', ' HB ', 157.488, 142.862, 92.576], ['A', ' HG ', 158.653, 142.773, 94.778], ['A', ' HG ', 157.485, 141.542, 95.298], ['A', ' HE2', 160.194, 139.384, 94.309], ['A', ' HE2', 159.524, 140.287, 95.643]]
[['A', ' N ', 155.747, 145.113, 92.122], ['A', ' CA ', 154.884, 145.582, 91.046], ['A', ' C ', 155.047, 144.686, 89.829], ['A', ' O ', 156.148, 144.204, 89.554], ['A', ' H ', 156.721, 145.37, 92.158], ['A', ' HA ', 153.844, 145.573, 91.371], ['A', ' HA ', 155.138, 146.609, 90.789]]
[['A', ' N ', 153.971, 144.516, 89.079], ['A', ' CA ', 153.959, 143.724, 87.859], ['A', ' C ', 152.713, 144.155, 87.118], ['A', ' O ', 151.696, 144.434, 87.752], ['A', ' CB ', 154.007, 142.249, 88.227], ['A', ' CG ', 154.229, 141.232, 87.195], ['A', ' CD1', 155.49, 141.01, 86.697], ['A', ' CD2', 153.212, 140.439, 86.772], ['A', ' CE1', 155.715, 140.018, 85.778], ['A', ' CE2', 153.431, 139.453, 85.869], ['A', ' CZ ', 154.686, 139.235, 85.364], ['A', ' H ', 153.108, 144.947, 89.379], ['A', ' HA ', 154.832, 143.967, 87.251], ['A', ' HB ', 154.817, 142.152, 88.92], ['A', ' HB ', 153.123, 141.987, 88.759], ['A', ' HD1', 156.318, 141.634, 87.046], ['A', ' HD2', 152.211, 140.593, 87.169], ['A', ' HE1', 156.715, 139.853, 85.383], ['A', ' HE2', 152.604, 138.838, 85.552], ['A', ' HZ ', 154.855, 138.438, 84.635]]
[['A', ' N ', 152.807, 144.354, 85.816], ['A', ' CA ', 151.645, 144.801, 85.059], ['A', ' C ', 151.191, 143.783, 84.04], ['A', ' O ', 150.047, 143.802, 83.585], ['A', ' CB ', 151.943, 146.132, 84.386], ['A', ' CG ', 152.18, 147.261, 85.371], ['A', ' CD ', 152.443, 148.577, 84.661], ['A', ' CE ', 152.676, 149.705, 85.659], ['A', ' NZ ', 152.973, 151.0, 84.981], ['A', ' H ', 153.674, 144.118, 85.319], ['A', ' HA ', 150.818, 144.951, 85.751], ['A', ' HB ', 152.831, 146.027, 83.759], ['A', ' HB ', 151.112, 146.407, 83.74], ['A', ' HG ', 151.306, 147.364, 86.015], ['A', ' HG ', 153.037, 147.017, 85.995], ['A', ' HD ', 153.322, 148.479, 84.022], ['A', ' HD ', 151.586, 148.827, 84.036], ['A', ' HE ', 151.785, 149.825, 86.274], ['A', ' HE ', 153.516, 149.442, 86.302], ['A', ' HZ ', 153.121, 151.718, 85.677], ['A', ' HZ ', 153.806, 150.905, 84.416], ['A', ' HZ ', 152.196, 151.26, 84.391]]
[['A', ' N ', 152.104, 142.923, 83.653], ['A', ' CA ', 151.886, 141.952, 82.617], ['A', ' C ', 150.768, 140.993, 82.997], ['A', ' O ', 150.664, 140.575, 84.154], ['A', ' CB ', 153.197, 141.209, 82.374], ['A', ' CG ', 154.359, 142.083, 81.852], ['A', ' CD ', 155.204, 142.822, 82.943], ['A', ' OE1', 154.681, 143.166, 84.002], ['A', ' OE2', 156.367, 143.03, 82.696], ['A', ' H ', 153.03, 142.966, 84.066], ['A', ' HA ', 151.596, 142.475, 81.706], ['A', ' HB ', 153.519, 140.737, 83.284], ['A', ' HB ', 153.039, 140.431, 81.638], ['A', ' HG ', 155.029, 141.449, 81.271], ['A', ' HG ', 153.942, 142.827, 81.174]]
[['A', ' N ', 149.947, 140.644, 82.004], ['A', ' CA ', 148.825, 139.722, 82.145], ['A', ' C ', 148.911, 138.653, 81.07], ['A', ' O ', 149.488, 138.893, 80.011], ['A', ' CB ', 147.503, 140.451, 81.969], ['A', ' CG ', 147.24, 141.583, 82.941], ['A', ' CD ', 145.922, 142.222, 82.712], ['A', ' NE ', 144.842, 141.316, 83.046], ['A', ' CZ ', 143.525, 141.543, 82.854], ['A', ' NH1', 143.106, 142.676, 82.324], ['A', ' NH2', 142.661, 140.609, 83.204], ['A', ' H ', 150.116, 141.048, 81.094], ['A', ' HA ', 148.865, 139.25, 83.123], ['A', ' HB ', 147.449, 140.862, 80.963], ['A', ' HB ', 146.691, 139.734, 82.069], ['A', ' HG ', 147.254, 141.203, 83.951], ['A', ' HG ', 148.01, 142.346, 82.832], ['A', ' HD ', 145.837, 143.112, 83.335], ['A', ' HD ', 145.833, 142.495, 81.66], ['A', ' HE ', 145.102, 140.446, 83.483], ['A', ' HH1', 143.767, 143.39, 82.057], ['A', ' HH1', 142.117, 142.832, 82.188], ['A', ' HH2', 143.005, 139.726, 83.586], ['A', ' HH2', 141.666, 140.749, 83.089]]
[['A', ' N ', 148.322, 137.484, 81.313], ['A', ' CA ', 148.298, 136.428, 80.297], ['A', ' C ', 149.246, 135.293, 80.605], ['A', ' O ', 149.942, 135.31, 81.623], ['A', ' H ', 147.848, 137.317, 82.188], ['A', ' HA ', 147.288, 136.032, 80.217], ['A', ' HA ', 148.54, 136.847, 79.321]]
[['A', ' N ', 149.281, 134.315, 79.713], ['A', ' CA ', 150.078, 133.113, 79.935], ['A', ' C ', 151.567, 133.38, 79.939], ['A', ' O ', 152.314, 132.717, 80.663], ['A', ' CB ', 149.776, 132.041, 78.879], ['A', ' CG1', 148.391, 131.67, 78.945], ['A', ' CG2', 150.063, 132.517, 77.486], ['A', ' H ', 148.669, 134.417, 78.898], ['A', ' HA ', 149.801, 132.704, 80.908], ['A', ' HB ', 150.368, 131.157, 79.095], ['A', ' HG1', 148.244, 130.907, 78.199], ['A', ' HG1', 148.157, 131.293, 79.941], ['A', ' HG1', 147.778, 132.511, 78.724], ['A', ' HG2', 149.815, 131.714, 76.821], ['A', ' HG2', 149.456, 133.385, 77.243], ['A', ' HG2', 151.1, 132.759, 77.359]]
[['A', ' N ', 152.011, 134.351, 79.155], ['A', ' CA ', 153.424, 134.635, 79.159], ['A', ' C ', 153.76, 135.324, 80.456], ['A', ' O ', 154.858, 135.185, 80.958], ['A', ' CB ', 153.866, 135.465, 77.941], ['A', ' CG1', 153.566, 134.685, 76.651], ['A', ' CG2', 153.169, 136.815, 77.926], ['A', ' H ', 151.362, 134.868, 78.577], ['A', ' HA ', 153.969, 133.691, 79.121], ['A', ' HB ', 154.949, 135.615, 77.988], ['A', ' HG1', 153.911, 135.264, 75.791], ['A', ' HG1', 154.085, 133.729, 76.672], ['A', ' HG1', 152.501, 134.512, 76.56], ['A', ' HG2', 153.508, 137.376, 77.056], ['A', ' HG2', 152.092, 136.681, 77.868], ['A', ' HG2', 153.413, 137.386, 78.814]]
[['A', ' N ', 152.832, 136.097, 81.004], ['A', ' CA ', 153.11, 136.742, 82.264], ['A', ' C ', 153.237, 135.692, 83.357], ['A', ' O ', 154.166, 135.725, 84.161], ['A', ' CB ', 152.007, 137.715, 82.6], ['A', ' H ', 151.934, 136.203, 80.552], ['A', ' HA ', 154.055, 137.276, 82.175], ['A', ' HB ', 152.221, 138.211, 83.519], ['A', ' HB ', 151.928, 138.442, 81.807], ['A', ' HB ', 151.072, 137.19, 82.693]]
[['A', ' N ', 152.37, 134.686, 83.316], ['A', ' CA ', 152.358, 133.644, 84.335], ['A', ' C ', 153.606, 132.799, 84.327], ['A', ' O ', 154.171, 132.475, 85.381], ['A', ' CB ', 151.189, 132.703, 84.103], ['A', ' CG ', 149.849, 133.265, 84.352], ['A', ' CD ', 148.815, 132.326, 83.926], ['A', ' OE1', 149.014, 131.126, 84.049], ['A', ' NE2', 147.723, 132.832, 83.413], ['A', ' H ', 151.635, 134.709, 82.605], ['A', ' HA ', 152.27, 134.11, 85.308], ['A', ' HB ', 151.209, 132.379, 83.068], ['A', ' HB ', 151.309, 131.81, 84.721], ['A', ' HG ', 149.73, 133.441, 85.415], ['A', ' HG ', 149.731, 134.177, 83.791], ['A', ' HE2', 146.992, 132.22, 83.099], ['A', ' HE2', 147.598, 133.825, 83.356]]
[['A', ' N ', 154.122, 132.516, 83.145], ['A', ' CA ', 155.239, 131.604, 83.082], ['A', ' C ', 156.572, 132.355, 83.076], ['A', ' O ', 157.639, 131.766, 82.918], ['A', ' CB ', 155.003, 130.645, 81.896], ['A', ' CG ', 156.004, 129.555, 81.732], ['A', ' ND1', 156.29, 128.624, 82.698], ['A', ' CD2', 156.71, 129.208, 80.677], ['A', ' CE1', 157.204, 127.795, 82.242], ['A', ' NE2', 157.498, 128.136, 81.023], ['A', ' H ', 153.636, 132.806, 82.287], ['A', ' HA ', 155.237, 130.982, 83.973], ['A', ' HB ', 154.021, 130.183, 82.007], ['A', ' HB ', 154.982, 131.227, 80.972], ['A', ' HD1', 155.866, 128.482, 83.602], ['A', ' HD2', 156.744, 129.624, 79.708], ['A', ' HE1', 157.583, 126.99, 82.868]]
[['A', ' N ', 156.494, 133.652, 83.364], ['A', ' CA ', 157.617, 134.545, 83.571], ['A', ' C ', 157.676, 134.918, 85.03], ['A', ' O ', 158.741, 134.867, 85.644], ['A', ' CB ', 157.535, 135.783, 82.683], ['A', ' CG1', 158.59, 136.817, 83.079], ['A', ' CG2', 157.832, 135.33, 81.242], ['A', ' H ', 155.568, 134.067, 83.478], ['A', ' HA ', 158.536, 134.017, 83.313], ['A', ' HB ', 156.54, 136.227, 82.759], ['A', ' HG1', 158.521, 137.672, 82.409], ['A', ' HG1', 158.425, 137.155, 84.1], ['A', ' HG1', 159.561, 136.393, 83.007], ['A', ' HG2', 157.776, 136.184, 80.566], ['A', ' HG2', 158.83, 134.896, 81.195], ['A', ' HG2', 157.118, 134.581, 80.932]]
[['A', ' N ', 156.522, 135.22, 85.621], ['A', ' CA ', 156.463, 135.608, 87.01], ['A', ' C ', 157.066, 134.527, 87.874], ['A', ' O ', 157.713, 134.829, 88.869], ['A', ' CB ', 155.043, 135.863, 87.42], ['A', ' H ', 155.664, 135.259, 85.075], ['A', ' HA ', 157.038, 136.513, 87.139], ['A', ' HB ', 155.025, 136.165, 88.459], ['A', ' HB ', 154.621, 136.65, 86.802], ['A', ' HB ', 154.46, 134.949, 87.29]]
[['A', ' N ', 156.894, 133.27, 87.497], ['A', ' CA ', 157.47, 132.188, 88.274], ['A', ' C ', 158.983, 132.266, 88.334], ['A', ' O ', 159.594, 131.975, 89.362], ['A', ' CB ', 157.119, 130.897, 87.621], ['A', ' CG ', 155.734, 130.598, 87.741], ['A', ' CD ', 155.395, 129.436, 87.048], ['A', ' NE ', 153.991, 129.271, 86.992], ['A', ' CZ ', 153.23, 128.727, 87.924], ['A', ' NH1', 153.745, 128.228, 89.037], ['A', ' NH2', 151.947, 128.701, 87.684], ['A', ' H ', 156.302, 133.065, 86.683], ['A', ' HA ', 157.065, 132.225, 89.287], ['A', ' HB ', 157.37, 130.938, 86.559], ['A', ' HB ', 157.694, 130.082, 88.066], ['A', ' HG ', 155.57, 130.412, 88.779], ['A', ' HG ', 155.115, 131.42, 87.407], ['A', ' HD ', 155.765, 129.526, 86.029], ['A', ' HD ', 155.837, 128.578, 87.543], ['A', ' HE ', 153.515, 129.612, 86.158], ['A', ' HH1', 154.747, 128.239, 89.187], ['A', ' HH1', 153.146, 127.796, 89.724], ['A', ' HH2', 151.607, 129.04, 86.766], ['A', ' HH2', 151.271, 128.282, 88.336]]
[['A', ' N ', 159.597, 132.642, 87.226], ['A', ' CA ', 161.032, 132.707, 87.141], ['A', ' C ', 161.533, 133.869, 87.996], ['A', ' O ', 162.562, 133.79, 88.682], ['A', ' CB ', 161.396, 132.828, 85.686], ['A', ' H ', 159.058, 132.947, 86.421], ['A', ' HA ', 161.449, 131.783, 87.541], ['A', ' HB ', 162.42, 132.846, 85.557], ['A', ' HB ', 160.993, 131.968, 85.152], ['A', ' HB ', 160.96, 133.733, 85.283]]
[['A', ' N ', 160.76, 134.946, 87.995], ['A', ' CA ', 161.127, 136.111, 88.772], ['A', ' C ', 161.01, 135.757, 90.25], ['A', ' O ', 161.812, 136.197, 91.092], ['A', ' CB ', 160.182, 137.26, 88.446], ['A', ' CG ', 160.227, 137.794, 87.001], ['A', ' CD1', 159.125, 138.817, 86.837], ['A', ' CD2', 161.576, 138.389, 86.676], ['A', ' H ', 159.939, 134.955, 87.38], ['A', ' HA ', 162.159, 136.372, 88.565], ['A', ' HB ', 159.168, 136.927, 88.639], ['A', ' HB ', 160.396, 138.089, 89.121], ['A', ' HG ', 160.029, 136.976, 86.31], ['A', ' HD1', 159.124, 139.184, 85.812], ['A', ' HD1', 158.169, 138.376, 87.056], ['A', ' HD1', 159.294, 139.647, 87.52], ['A', ' HD2', 161.564, 138.755, 85.648], ['A', ' HD2', 161.783, 139.217, 87.354], ['A', ' HD2', 162.352, 137.64, 86.769]]
[['A', ' N ', 159.995, 134.961, 90.567], ['A', ' CA ', 159.787, 134.516, 91.918], ['A', ' C ', 160.936, 133.649, 92.39], ['A', ' O ', 161.385, 133.796, 93.521], ['A', ' CB ', 158.482, 133.785, 92.082], ['A', ' CG ', 158.252, 133.372, 93.479], ['A', ' CD ', 156.935, 132.888, 93.693], ['A', ' OE1', 156.02, 133.629, 93.481], ['A', ' OE2', 156.781, 131.737, 94.002], ['A', ' H ', 159.326, 134.697, 89.838], ['A', ' HA ', 159.744, 135.397, 92.556], ['A', ' HB ', 157.657, 134.412, 91.753], ['A', ' HB ', 158.481, 132.893, 91.463], ['A', ' HG ', 158.954, 132.578, 93.743], ['A', ' HG ', 158.439, 134.218, 94.142]]
[['A', ' N ', 161.48, 132.786, 91.533], ['A', ' CA ', 162.591, 131.957, 91.985], ['A', ' C ', 163.705, 132.832, 92.505], ['A', ' O ', 164.272, 132.545, 93.563], ['A', ' CB ', 163.163, 131.138, 90.849], ['A', ' CG ', 162.271, 130.126, 90.383], ['A', ' SD ', 162.814, 129.267, 88.927], ['A', ' CE ', 163.985, 128.176, 89.591], ['A', ' H ', 161.042, 132.653, 90.615], ['A', ' HA ', 162.247, 131.308, 92.789], ['A', ' HB ', 163.393, 131.79, 90.013], ['A', ' HB ', 164.089, 130.674, 91.171], ['A', ' HG ', 162.173, 129.414, 91.183], ['A', ' HG ', 161.307, 130.548, 90.191], ['A', ' HE ', 164.363, 127.563, 88.791], ['A', ' HE ', 164.796, 128.726, 90.052], ['A', ' HE ', 163.511, 127.536, 90.329]]
[['A', ' N ', 164.008, 133.92, 91.792], ['A', ' CA ', 165.064, 134.802, 92.271], ['A', ' C ', 164.698, 135.388, 93.638], ['A', ' O ', 165.54, 135.444, 94.542], ['A', ' CB ', 165.334, 135.925, 91.27], ['A', ' CG ', 166.003, 135.45, 89.994], ['A', ' CD ', 166.522, 136.614, 89.089], ['A', ' CE ', 165.391, 137.363, 88.377], ['A', ' NZ ', 165.904, 138.347, 87.329], ['A', ' H ', 163.524, 134.073, 90.896], ['A', ' HA ', 165.975, 134.216, 92.392], ['A', ' HB ', 164.391, 136.398, 91.002], ['A', ' HB ', 165.968, 136.681, 91.73], ['A', ' HG ', 166.841, 134.796, 90.245], ['A', ' HG ', 165.27, 134.862, 89.447], ['A', ' HD ', 167.082, 137.321, 89.703], ['A', ' HD ', 167.204, 136.212, 88.34], ['A', ' HE ', 164.722, 136.647, 87.896], ['A', ' HE ', 164.828, 137.92, 89.123], ['A', ' HZ ', 165.118, 138.824, 86.916], ['A', ' HZ ', 166.506, 139.023, 87.77], ['A', ' HZ ', 166.429, 137.89, 86.548]]
[['A', ' N ', 163.435, 135.782, 93.81], ['A', ' CA ', 162.997, 136.348, 95.086], ['A', ' C ', 163.101, 135.353, 96.234], ['A', ' O ', 163.592, 135.681, 97.326], ['A', ' CB ', 161.532, 136.83, 95.001], ['A', ' OG1', 161.417, 137.89, 94.034], ['A', ' CG2', 161.039, 137.326, 96.349], ['A', ' H ', 162.8, 135.747, 93.005], ['A', ' HA ', 163.633, 137.202, 95.316], ['A', ' HB ', 160.902, 136.003, 94.688], ['A', ' HG1', 161.629, 137.547, 93.149], ['A', ' HG2', 160.012, 137.647, 96.247], ['A', ' HG2', 161.087, 136.538, 97.095], ['A', ' HG2', 161.652, 138.165, 96.675]]
[['A', ' N ', 162.632, 134.14, 95.997], ['A', ' CA ', 162.633, 133.12, 97.018], ['A', ' C ', 164.039, 132.769, 97.433], ['A', ' O ', 164.322, 132.626, 98.623], ['A', ' CB ', 161.926, 131.888, 96.503], ['A', ' H ', 162.243, 133.946, 95.076], ['A', ' HA ', 162.107, 133.506, 97.889], ['A', ' HB ', 161.91, 131.129, 97.271], ['A', ' HB ', 160.904, 132.142, 96.219], ['A', ' HB ', 162.455, 131.512, 95.629]]
[['A', ' N ', 164.95, 132.706, 96.479], ['A', ' CA ', 166.297, 132.352, 96.833], ['A', ' C ', 166.949, 133.425, 97.668], ['A', ' O ', 167.638, 133.104, 98.642], ['A', ' CB ', 167.102, 132.035, 95.592], ['A', ' CG ', 168.549, 131.635, 95.809], ['A', ' CD1', 168.674, 130.483, 96.738], ['A', ' CD2', 169.076, 131.196, 94.526], ['A', ' H ', 164.677, 132.814, 95.498], ['A', ' HA ', 166.232, 131.447, 97.429], ['A', ' HB ', 166.602, 131.248, 95.045], ['A', ' HB ', 167.097, 132.929, 94.959], ['A', ' HG ', 169.123, 132.481, 96.193], ['A', ' HD1', 169.73, 130.225, 96.811], ['A', ' HD1', 168.308, 130.734, 97.727], ['A', ' HD1', 168.117, 129.633, 96.348], ['A', ' HD2', 170.11, 130.889, 94.657], ['A', ' HD2', 168.492, 130.356, 94.194], ['A', ' HD2', 169.003, 132.007, 93.805]]
[['A', ' N ', 166.725, 134.695, 97.342], ['A', ' CA ', 167.333, 135.728, 98.15], ['A', ' C ', 166.838, 135.646, 99.583], ['A', ' O ', 167.633, 135.796, 100.517], ['A', ' CB ', 167.03, 137.096, 97.584], ['A', ' OG ', 167.676, 137.295, 96.357], ['A', ' H ', 166.189, 134.944, 96.502], ['A', ' HA ', 168.412, 135.577, 98.147], ['A', ' HB ', 165.951, 137.188, 97.444], ['A', ' HB ', 167.336, 137.863, 98.294], ['A', ' HG ', 167.357, 138.14, 96.028]]
[['A', ' N ', 165.554, 135.338, 99.787], ['A', ' CA ', 165.089, 135.262, 101.163], ['A', ' C ', 165.703, 134.07, 101.888], ['A', ' O ', 165.995, 134.161, 103.084], ['A', ' CB ', 163.576, 135.182, 101.259], ['A', ' CG ', 163.021, 135.14, 102.716], ['A', ' CD ', 163.395, 136.369, 103.497], ['A', ' NE ', 162.815, 136.386, 104.819], ['A', ' CZ ', 163.216, 137.196, 105.828], ['A', ' NH1', 164.207, 138.063, 105.664], ['A', ' NH2', 162.611, 137.123, 107.006], ['A', ' H ', 164.911, 135.255, 98.988], ['A', ' HA ', 165.412, 136.175, 101.658], ['A', ' HB ', 163.134, 136.037, 100.751], ['A', ' HB ', 163.231, 134.282, 100.739], ['A', ' HG ', 161.932, 135.085, 102.688], ['A', ' HG ', 163.404, 134.269, 103.25], ['A', ' HD ', 164.469, 136.393, 103.627], ['A', ' HD ', 163.074, 137.262, 102.963], ['A', ' HE ', 162.029, 135.74, 105.013], ['A', ' HH1', 164.705, 138.148, 104.763], ['A', ' HH1', 164.492, 138.654, 106.429], ['A', ' HH2', 161.851, 136.433, 107.157], ['A', ' HH2', 162.901, 137.715, 107.765]]
[['A', ' N ', 165.865, 132.938, 101.202], ['A', ' CA ', 166.461, 131.777, 101.849], ['A', ' C ', 167.877, 132.103, 102.333], ['A', ' O ', 168.281, 131.728, 103.441], ['A', ' CB ', 166.504, 130.611, 100.871], ['A', ' H ', 165.532, 132.886, 100.231], ['A', ' HA ', 165.856, 131.518, 102.713], ['A', ' HB ', 166.937, 129.743, 101.341], ['A', ' HB ', 165.513, 130.372, 100.529], ['A', ' HB ', 167.11, 130.897, 100.014]]
[['A', ' N ', 168.604, 132.876, 101.535], ['A', ' CA ', 169.956, 133.25, 101.896], ['A', ' C ', 169.929, 134.14, 103.127], ['A', ' O ', 170.723, 133.924, 104.046], ['A', ' CB ', 170.675, 133.927, 100.72], ['A', ' CG1', 170.876, 132.865, 99.609], ['A', ' CG2', 172.041, 134.474, 101.191], ['A', ' CD1', 171.286, 133.391, 98.247], ['A', ' H ', 168.218, 133.133, 100.618], ['A', ' HA ', 170.508, 132.348, 102.145], ['A', ' HB ', 170.058, 134.734, 100.321], ['A', ' HG1', 171.642, 132.175, 99.943], ['A', ' HG1', 169.945, 132.316, 99.484], ['A', ' HG2', 172.565, 134.942, 100.367], ['A', ' HG2', 171.909, 135.22, 101.983], ['A', ' HG2', 172.638, 133.653, 101.572], ['A', ' HD1', 171.391, 132.555, 97.557], ['A', ' HD1', 170.513, 134.066, 97.877], ['A', ' HD1', 172.227, 133.919, 98.309]]
[['A', ' N ', 169.012, 135.107, 103.17], ['A', ' CA ', 168.914, 136.008, 104.313], ['A', ' C ', 168.621, 135.257, 105.611], ['A', ' O ', 169.155, 135.614, 106.666], ['A', ' CB ', 167.807, 137.032, 104.089], ['A', ' CG ', 168.1, 138.062, 103.024], ['A', ' CD ', 166.919, 138.951, 102.724], ['A', ' OE1', 165.851, 138.698, 103.251], ['A', ' OE2', 167.078, 139.88, 101.969], ['A', ' H ', 168.408, 135.254, 102.353], ['A', ' HA ', 169.866, 136.531, 104.416], ['A', ' HB ', 166.897, 136.513, 103.804], ['A', ' HB ', 167.603, 137.557, 105.021], ['A', ' HG ', 168.929, 138.681, 103.364], ['A', ' HG ', 168.417, 137.557, 102.119]]
[['A', ' N ', 167.79, 134.218, 105.563], ['A', ' CA ', 167.529, 133.514, 106.807], ['A', ' C ', 168.789, 132.868, 107.304], ['A', ' O ', 169.067, 132.924, 108.495], ['A', ' CB ', 166.44, 132.44, 106.7], ['A', ' CG1', 165.088, 133.066, 106.345], ['A', ' CG2', 166.355, 131.622, 108.061], ['A', ' CD1', 164.523, 134.065, 107.34], ['A', ' H ', 167.312, 133.992, 104.68], ['A', ' HA ', 167.238, 134.24, 107.559], ['A', ' HB ', 166.687, 131.765, 105.883], ['A', ' HG1', 165.186, 133.571, 105.391], ['A', ' HG1', 164.367, 132.261, 106.233], ['A', ' HG2', 165.587, 130.86, 107.999], ['A', ' HG2', 167.3, 131.135, 108.269], ['A', ' HG2', 166.121, 132.287, 108.881], ['A', ' HD1', 163.579, 134.415, 106.964], ['A', ' HD1', 164.359, 133.597, 108.306], ['A', ' HD1', 165.179, 134.916, 107.458]]
[['A', ' N ', 169.555, 132.25, 106.419], ['A', ' CA ', 170.79, 131.64, 106.873], ['A', ' C ', 171.826, 132.691, 107.291], ['A', ' O ', 172.63, 132.423, 108.173], ['A', ' CB ', 171.333, 130.701, 105.816], ['A', ' CG ', 170.522, 129.427, 105.554], ['A', ' CD1', 171.088, 128.749, 104.383], ['A', ' CD2', 170.585, 128.464, 106.739], ['A', ' H ', 169.253, 132.186, 105.439], ['A', ' HA ', 170.566, 131.064, 107.764], ['A', ' HB ', 171.356, 131.253, 104.876], ['A', ' HB ', 172.345, 130.411, 106.093], ['A', ' HG ', 169.508, 129.7, 105.347], ['A', ' HD1', 170.516, 127.854, 104.16], ['A', ' HD1', 171.06, 129.417, 103.549], ['A', ' HD1', 172.1, 128.487, 104.61], ['A', ' HD2', 170.021, 127.567, 106.505], ['A', ' HD2', 171.623, 128.194, 106.925], ['A', ' HD2', 170.167, 128.917, 107.618]]
[['A', ' N ', 171.787, 133.91, 106.717], ['A', ' CA ', 172.693, 134.971, 107.194], ['A', ' C ', 172.44, 135.24, 108.671], ['A', ' O ', 173.373, 135.545, 109.422], ['A', ' CB ', 172.476, 136.337, 106.502], ['A', ' CG ', 173.016, 136.545, 105.102], ['A', ' OD1', 173.912, 135.866, 104.716], ['A', ' OD2', 172.525, 137.418, 104.435], ['A', ' H ', 171.171, 134.065, 105.914], ['A', ' HA ', 173.723, 134.644, 107.061], ['A', ' HB ', 171.415, 136.54, 106.475], ['A', ' HB ', 172.912, 137.106, 107.136]]
[['A', ' N ', 171.178, 135.122, 109.091], ['A', ' CA ', 170.793, 135.33, 110.477], ['A', ' C ', 170.656, 133.964, 111.143], ['A', ' O ', 171.65, 133.257, 111.301], ['A', ' CB ', 169.473, 136.102, 110.557], ['A', ' CG ', 169.549, 137.534, 110.068], ['A', ' CD ', 168.217, 138.264, 110.15], ['A', ' OE1', 167.225, 137.636, 110.454], ['A', ' OE2', 168.199, 139.451, 109.914], ['A', ' H ', 170.448, 134.917, 108.398], ['A', ' HA ', 171.572, 135.894, 110.988], ['A', ' HB ', 168.722, 135.593, 109.944], ['A', ' HB ', 169.116, 136.129, 111.585], ['A', ' HG ', 170.288, 138.071, 110.66], ['A', ' HG ', 169.89, 137.527, 109.031]]
[['A', ' N ', 169.45, 133.587, 111.559], ['A', ' CA ', 169.248, 132.279, 112.166], ['A', ' C ', 170.287, 131.859, 113.191], ['A', ' O ', 171.266, 131.177, 112.872], ['A', ' CB ', 169.205, 131.199, 111.096], ['A', ' CG ', 169.026, 129.744, 111.585], ['A', ' CD1', 167.67, 129.577, 112.282], ['A', ' CD2', 169.195, 128.853, 110.407], ['A', ' H ', 168.658, 134.195, 111.416], ['A', ' HA ', 168.288, 132.312, 112.669], ['A', ' HB ', 168.377, 131.421, 110.436], ['A', ' HB ', 170.126, 131.25, 110.507], ['A', ' HG ', 169.786, 129.476, 112.309], ['A', ' HD1', 167.563, 128.545, 112.614], ['A', ' HD1', 167.612, 130.223, 113.153], ['A', ' HD1', 166.869, 129.828, 111.591], ['A', ' HD2', 169.095, 127.83, 110.74], ['A', ' HD2', 168.443, 129.081, 109.652], ['A', ' HD2', 170.187, 129.005, 109.989]]
[['A', ' N ', 170.128, 132.289, 114.427], ['A', ' CA ', 171.051, 131.797, 115.429], ['A', ' C ', 170.748, 130.306, 115.535], ['A', ' O ', 169.578, 129.926, 115.47], ['A', ' CB ', 170.894, 132.477, 116.777], ['A', ' CG ', 172.11, 132.208, 117.643], ['A', ' OD1', 172.325, 131.07, 118.025], ['A', ' OD2', 172.838, 133.141, 117.904], ['A', ' H ', 169.359, 132.892, 114.675], ['A', ' HA ', 172.077, 131.925, 115.08], ['A', ' HB ', 170.778, 133.552, 116.641], ['A', ' HB ', 170.004, 132.099, 117.286]]
[['A', ' N ', 171.773, 129.473, 115.686], ['A', ' CA ', 171.604, 128.024, 115.753], ['A', ' C ', 171.398, 127.494, 117.159], ['A', ' O ', 171.207, 126.29, 117.356], ['A', ' CB ', 172.824, 127.32, 115.159], ['A', ' OG1', 173.989, 127.677, 115.915], ['A', ' CG2', 173.007, 127.743, 113.737], ['A', ' H ', 172.71, 129.854, 115.762], ['A', ' HA ', 170.728, 127.756, 115.161], ['A', ' HB ', 172.684, 126.24, 115.198], ['A', ' HG1', 173.985, 127.196, 116.752], ['A', ' HG2', 173.874, 127.24, 113.317], ['A', ' HG2', 172.117, 127.472, 113.166], ['A', ' HG2', 173.152, 128.819, 113.696]]
[['A', ' N ', 171.452, 128.366, 118.156], ['A', ' CA ', 171.232, 127.917, 119.521], ['A', ' C ', 170.037, 128.666, 120.061], ['A', ' O ', 170.108, 129.818, 120.491], ['A', ' CB ', 172.442, 128.176, 120.379], ['A', ' OG ', 172.209, 127.775, 121.702], ['A', ' H ', 171.644, 129.363, 117.97], ['A', ' HA ', 171.006, 126.852, 119.528], ['A', ' HB ', 173.296, 127.636, 119.975], ['A', ' HB ', 172.683, 129.241, 120.35], ['A', ' HG ', 173.011, 127.986, 122.185]]
[['A', ' N ', 168.913, 127.988, 120.044], ['A', ' CA ', 167.662, 128.609, 120.385], ['A', ' C ', 166.649, 127.545, 120.731], ['A', ' O ', 166.817, 126.393, 120.323], ['A', ' CB ', 167.184, 129.424, 119.191], ['A', ' H ', 168.939, 127.032, 119.721], ['A', ' HA ', 167.827, 129.248, 121.25], ['A', ' HB ', 166.236, 129.913, 119.394], ['A', ' HB ', 167.927, 130.182, 118.937], ['A', ' HB ', 167.056, 128.749, 118.345]]
[['A', ' N ', 165.612, 127.857, 121.502], ['A', ' CA ', 164.488, 126.991, 121.666], ['A', ' C ', 163.875, 127.017, 120.303], ['A', ' O ', 163.915, 128.062, 119.662], ['A', ' CB ', 163.651, 127.692, 122.728], ['A', ' CG ', 164.059, 129.151, 122.621], ['A', ' CD ', 165.526, 129.125, 122.225], ['A', ' HA ', 164.815, 125.982, 121.957], ['A', ' HB ', 162.581, 127.534, 122.522], ['A', ' HB ', 163.855, 127.256, 123.718], ['A', ' HG ', 163.435, 129.658, 121.866], ['A', ' HG ', 163.88, 129.667, 123.576], ['A', ' HD ', 165.711, 129.986, 121.581], ['A', ' HD ', 166.178, 129.115, 123.111]]
[['A', ' N ', 163.319, 125.922, 119.855], ['A', ' CA ', 162.738, 125.924, 118.53], ['A', ' C ', 161.269, 125.618, 118.624], ['A', ' O ', 160.441, 126.341, 118.081], ['A', ' CB ', 163.452, 124.906, 117.645], ['A', ' CG1', 162.874, 124.877, 116.304], ['A', ' CG2', 164.844, 125.247, 117.549], ['A', ' H ', 163.287, 125.1, 120.441], ['A', ' HA ', 162.858, 126.91, 118.086], ['A', ' HB ', 163.329, 123.913, 118.074], ['A', ' HG1', 163.383, 124.128, 115.698], ['A', ' HG1', 161.84, 124.644, 116.366], ['A', ' HG1', 162.996, 125.84, 115.851], ['A', ' HG2', 165.33, 124.514, 116.923], ['A', ' HG2', 164.944, 126.232, 117.111], ['A', ' HG2', 165.303, 125.244, 118.532]]
[['A', ' N ', 160.96, 124.504, 119.269], ['A', ' CA ', 159.598, 124.051, 119.373], ['A', ' C ', 158.963, 124.659, 120.601], ['A', ' O ', 159.594, 124.712, 121.658], ['A', ' CB ', 159.563, 122.551, 119.487], ['A', ' CG ', 158.217, 121.924, 119.36], ['A', ' CD ', 158.323, 120.464, 119.287], ['A', ' NE ', 157.03, 119.829, 119.056], ['A', ' CZ ', 156.166, 119.433, 120.016], ['A', ' NH1', 156.433, 119.624, 121.293], ['A', ' NH2', 155.04, 118.842, 119.658], ['A', ' H ', 161.685, 123.939, 119.675], ['A', ' HA ', 159.05, 124.363, 118.48], ['A', ' HB ', 160.205, 122.139, 118.783], ['A', ' HB ', 159.947, 122.27, 120.463], ['A', ' HG ', 157.579, 122.203, 120.2], ['A', ' HG ', 157.78, 122.268, 118.428], ['A', ' HD ', 158.975, 120.204, 118.452], ['A', ' HD ', 158.754, 120.076, 120.205], ['A', ' HE ', 156.76, 119.651, 118.085], ['A', ' HH1', 157.29, 120.077, 121.573], ['A', ' HH1', 155.777, 119.32, 121.998], ['A', ' HH2', 154.843, 118.687, 118.669], ['A', ' HH2', 154.383, 118.527, 120.355]]
[['A', ' N ', 157.73, 125.104, 120.452], ['A', ' CA ', 156.919, 125.662, 121.508], ['A', ' C ', 156.434, 124.608, 122.488], ['A', ' O ', 156.179, 123.463, 122.125], ['A', ' CB ', 155.73, 126.353, 120.898], ['A', ' H ', 157.327, 125.06, 119.518], ['A', ' HA ', 157.524, 126.385, 122.055], ['A', ' HB ', 155.123, 126.804, 121.681], ['A', ' HB ', 156.07, 127.12, 120.21], ['A', ' HB ', 155.159, 125.611, 120.36]]
[['A', ' N ', 156.284, 125.011, 123.737], ['A', ' CA ', 155.735, 124.179, 124.806], ['A', ' C ', 154.234, 124.448, 124.911], ['A', ' O ', 153.839, 125.593, 125.144], ['A', ' CB ', 156.408, 124.475, 126.143], ['A', ' CG ', 155.974, 123.507, 127.24], ['A', ' OD1', 155.334, 122.526, 126.922], ['A', ' OD2', 156.295, 123.747, 128.382], ['A', ' H ', 156.547, 125.96, 123.962], ['A', ' HA ', 155.884, 123.129, 124.554], ['A', ' HB ', 157.491, 124.414, 126.027], ['A', ' HB ', 156.165, 125.489, 126.458]]
[['A', ' N ', 153.39, 123.469, 124.619], ['A', ' CA ', 151.958, 123.739, 124.609], ['A', ' C ', 151.08, 122.569, 125.021], ['A', ' O ', 151.507, 121.419, 125.034], ['A', ' CB ', 151.542, 124.165, 123.219], ['A', ' CG ', 151.753, 123.083, 122.257], ['A', ' CD1', 150.748, 122.181, 121.972], ['A', ' CD2', 152.971, 122.936, 121.652], ['A', ' CE1', 150.971, 121.155, 121.115], ['A', ' CE2', 153.195, 121.918, 120.799], ['A', ' CZ ', 152.199, 121.019, 120.531], ['A', ' H ', 153.745, 122.539, 124.437], ['A', ' HA ', 151.764, 124.558, 125.302], ['A', ' HB ', 150.488, 124.44, 123.209], ['A', ' HB ', 152.127, 125.032, 122.912], ['A', ' HD1', 149.773, 122.286, 122.446], ['A', ' HD2', 153.766, 123.644, 121.871], ['A', ' HE1', 150.177, 120.442, 120.899], ['A', ' HE2', 154.169, 121.811, 120.336], ['A', ' HZ ', 152.384, 120.197, 119.845]]
[['A', ' N ', 149.838, 122.911, 125.373], ['A', ' CA ', 148.758, 121.992, 125.734], ['A', ' C ', 147.792, 121.839, 124.558], ['A', ' O ', 147.184, 122.823, 124.132], ['A', ' CB ', 148.044, 122.491, 126.995], ['A', ' CG ', 146.983, 121.521, 127.588], ['A', ' OD1', 146.354, 120.749, 126.876], ['A', ' OD2', 146.831, 121.554, 128.799], ['A', ' H ', 149.613, 123.895, 125.366], ['A', ' HA ', 149.189, 121.011, 125.944], ['A', ' HB ', 148.787, 122.699, 127.767], ['A', ' HB ', 147.546, 123.435, 126.767]]
[['A', ' N ', 147.707, 120.637, 123.99], ['A', ' CA ', 146.902, 120.367, 122.797], ['A', ' C ', 145.392, 120.369, 123.038], ['A', ' O ', 144.595, 120.278, 122.094], ['A', ' CB ', 147.296, 119.036, 122.151], ['A', ' CG ', 146.876, 117.762, 122.915], ['A', ' CD ', 147.843, 117.353, 123.984], ['A', ' OE1', 148.55, 118.207, 124.468], ['A', ' OE2', 147.875, 116.198, 124.321], ['A', ' H ', 148.236, 119.862, 124.404], ['A', ' HA ', 147.111, 121.148, 122.09], ['A', ' HB ', 146.861, 118.979, 121.154], ['A', ' HB ', 148.378, 119.004, 122.031], ['A', ' HG ', 145.898, 117.898, 123.366], ['A', ' HG ', 146.789, 116.952, 122.192]]
[['A', ' N ', 144.967, 120.414, 124.286], ['A', ' CA ', 143.545, 120.365, 124.539], ['A', ' C ', 142.92, 121.725, 124.34], ['A', ' O ', 142.677, 122.457, 125.299], ['A', ' CB ', 143.256, 119.901, 125.945], ['A', ' CG ', 143.683, 118.488, 126.243], ['A', ' CD ', 143.484, 118.161, 127.667], ['A', ' NE ', 144.352, 118.974, 128.507], ['A', ' CZ ', 144.333, 119.024, 129.859], ['A', ' NH1', 143.487, 118.281, 130.565], ['A', ' NH2', 145.178, 119.832, 130.469], ['A', ' H ', 145.634, 120.509, 125.071], ['A', ' HA ', 143.098, 119.668, 123.846], ['A', ' HB ', 143.758, 120.567, 126.645], ['A', ' HB ', 142.185, 119.97, 126.134], ['A', ' HG ', 143.105, 117.792, 125.634], ['A', ' HG ', 144.748, 118.38, 126.014], ['A', ' HD ', 142.45, 118.357, 127.943], ['A', ' HD ', 143.723, 117.112, 127.836], ['A', ' HE ', 145.045, 119.582, 128.017], ['A', ' HH1', 142.841, 117.663, 130.099], ['A', ' HH1', 143.489, 118.334, 131.574], ['A', ' HH2', 145.825, 120.417, 129.895], ['A', ' HH2', 145.196, 119.899, 131.469]]
[['A', ' N ', 142.635, 122.035, 123.09], ['A', ' CA ', 142.105, 123.331, 122.725], ['A', ' C ', 140.641, 123.468, 123.093], ['A', ' O ', 139.96, 122.495, 123.463], ['A', ' H ', 142.929, 121.364, 122.383], ['A', ' HA ', 142.687, 124.117, 123.208], ['A', ' HA ', 142.208, 123.468, 121.649]]
[['A', ' N ', 140.137, 124.694, 122.941], ['A', ' CA ', 138.748, 125.009, 123.244], ['A', ' C ', 137.927, 125.144, 121.983], ['A', ' O ', 136.699, 125.182, 122.026], ['A', ' CB ', 138.666, 126.327, 124.013], ['A', ' OG1', 139.183, 127.382, 123.186], ['A', ' CG2', 139.5, 126.225, 125.273], ['A', ' H ', 140.751, 125.445, 122.65], ['A', ' HA ', 138.326, 124.204, 123.847], ['A', ' HB ', 137.63, 126.542, 124.272], ['A', ' HG1', 138.514, 127.626, 122.519], ['A', ' HG2', 139.447, 127.167, 125.818], ['A', ' HG2', 139.113, 125.42, 125.897], ['A', ' HG2', 140.536, 126.016, 125.02]]
[['A', ' N ', 138.628, 125.288, 120.876], ['A', ' CA ', 138.065, 125.435, 119.552], ['A', ' C ', 137.934, 126.889, 119.118], ['A', ' O ', 137.233, 127.67, 119.76], ['A', ' H ', 139.629, 125.221, 120.96], ['A', ' HA ', 138.705, 124.897, 118.857], ['A', ' HA ', 137.087, 124.955, 119.519]]
[['A', ' N ', 138.577, 127.271, 118.011], ['A', ' CA ', 138.417, 128.637, 117.533], ['A', ' C ', 138.587, 128.806, 116.02], ['A', ' O ', 138.813, 129.925, 115.572], ['A', ' CB ', 139.351, 129.601, 118.265], ['A', ' CG ', 140.817, 129.426, 117.987], ['A', ' CD ', 141.664, 130.526, 118.656], ['A', ' CE ', 141.964, 130.226, 120.13], ['A', ' NZ ', 142.846, 131.274, 120.759], ['A', ' H ', 139.189, 126.635, 117.532], ['A', ' HA ', 137.397, 128.947, 117.765], ['A', ' HB ', 139.083, 130.624, 118.003], ['A', ' HB ', 139.198, 129.493, 119.336], ['A', ' HG ', 141.127, 128.463, 118.387], ['A', ' HG ', 141.01, 129.441, 116.913], ['A', ' HD ', 142.615, 130.612, 118.122], ['A', ' HD ', 141.147, 131.478, 118.587], ['A', ' HE ', 141.039, 130.163, 120.694], ['A', ' HE ', 142.483, 129.267, 120.187], ['A', ' HZ ', 143.082, 131.024, 121.732], ['A', ' HZ ', 143.754, 131.344, 120.288], ['A', ' HZ ', 142.409, 132.168, 120.742]]
[['A', ' N ', 138.526, 127.723, 115.234], ['A', ' CA ', 138.711, 127.835, 113.78], ['A', ' C ', 139.949, 128.628, 113.42], ['A', ' O ', 139.857, 129.721, 112.859], ['A', ' CB ', 137.486, 128.47, 113.131], ['A', ' CG ', 136.162, 127.708, 113.286], ['A', ' CD1', 135.043, 128.575, 112.766], ['A', ' CD2', 136.19, 126.385, 112.471], ['A', ' H ', 138.322, 126.823, 115.626], ['A', ' HA ', 138.848, 126.836, 113.378], ['A', ' HB ', 137.349, 129.469, 113.54], ['A', ' HB ', 137.682, 128.571, 112.087], ['A', ' HG ', 135.993, 127.495, 114.337], ['A', ' HD1', 134.094, 128.053, 112.877], ['A', ' HD1', 135.013, 129.506, 113.332], ['A', ' HD1', 135.216, 128.797, 111.712], ['A', ' HD2', 135.244, 125.864, 112.591], ['A', ' HD2', 136.331, 126.597, 111.436], ['A', ' HD2', 136.971, 125.751, 112.786]]
[['A', ' N ', 141.099, 128.112, 113.822], ['A', ' CA ', 142.349, 128.798, 113.618], ['A', ' C ', 142.637, 128.82, 112.147], ['A', ' O ', 142.347, 127.857, 111.436], ['A', ' H ', 141.087, 127.181, 114.218], ['A', ' HA ', 142.281, 129.811, 114.009], ['A', ' HA ', 143.147, 128.285, 114.146]]
[['A', ' N ', 143.241, 129.896, 111.682], ['A', ' CA ', 143.546, 130.027, 110.266], ['A', ' C ', 145.013, 130.215, 110.032], ['A', ' O ', 145.624, 131.128, 110.584], ['A', ' CB ', 142.833, 131.245, 109.671], ['A', ' CG1', 141.342, 131.104, 109.872], ['A', ' CG2', 143.163, 131.33, 108.143], ['A', ' CD1', 140.573, 132.373, 109.639], ['A', ' H ', 143.487, 130.634, 112.36], ['A', ' HA ', 143.228, 129.125, 109.745], ['A', ' HB ', 143.159, 132.151, 110.179], ['A', ' HG1', 140.992, 130.336, 109.204], ['A', ' HG1', 141.133, 130.791, 110.889], ['A', ' HG2', 142.667, 132.178, 107.69], ['A', ' HG2', 144.233, 131.444, 107.983], ['A', ' HG2', 142.825, 130.413, 107.653], ['A', ' HD1', 139.51, 132.187, 109.799], ['A', ' HD1', 140.915, 133.13, 110.344], ['A', ' HD1', 140.721, 132.731, 108.642]]
[['A', ' N ', 145.568, 129.407, 109.161], ['A', ' CA ', 146.961, 129.569, 108.82], ['A', ' C ', 147.081, 129.557, 107.325], ['A', ' O ', 146.361, 128.819, 106.652], ['A', ' H ', 144.991, 128.677, 108.727], ['A', ' HA ', 147.355, 130.501, 109.227], ['A', ' HA ', 147.53, 128.743, 109.238]]
[['A', ' N ', 148.015, 130.308, 106.768], ['A', ' CA ', 148.103, 130.247, 105.334], ['A', ' C ', 149.502, 130.454, 104.84], ['A', ' O ', 150.251, 131.289, 105.336], ['A', ' CB ', 147.179, 131.263, 104.729], ['A', ' H ', 148.621, 130.912, 107.309], ['A', ' HA ', 147.798, 129.257, 105.037], ['A', ' HB ', 147.229, 131.155, 103.66], ['A', ' HB ', 146.166, 131.084, 105.069], ['A', ' HB ', 147.487, 132.265, 105.021]]
[['A', ' N ', 149.844, 129.691, 103.834], ['A', ' CA ', 151.161, 129.75, 103.269], ['A', ' C ', 151.218, 130.141, 101.817], ['A', ' O ', 150.517, 129.618, 100.952], ['A', ' CB ', 151.866, 128.406, 103.472], ['A', ' CG1', 151.927, 128.041, 104.98], ['A', ' CG2', 153.251, 128.444, 102.869], ['A', ' CD1', 152.762, 128.932, 105.897], ['A', ' H ', 149.15, 129.019, 103.493], ['A', ' HA ', 151.719, 130.502, 103.814], ['A', ' HB ', 151.289, 127.61, 102.992], ['A', ' HG1', 150.92, 128.05, 105.369], ['A', ' HG1', 152.301, 127.036, 105.048], ['A', ' HG2', 153.721, 127.509, 103.031], ['A', ' HG2', 153.216, 128.624, 101.806], ['A', ' HG2', 153.833, 129.22, 103.336], ['A', ' HD1', 152.695, 128.541, 106.917], ['A', ' HD1', 153.798, 128.923, 105.587], ['A', ' HD1', 152.395, 129.956, 105.896]]
[['A', ' N ', 152.13, 131.033, 101.518], ['A', ' CA ', 152.316, 131.404, 100.133], ['A', ' C ', 153.194, 130.375, 99.457], ['A', ' O ', 154.426, 130.497, 99.404], ['A', ' CB ', 152.93, 132.772, 99.976], ['A', ' CG ', 152.099, 133.869, 100.412], ['A', ' CD ', 150.946, 134.17, 99.599], ['A', ' OE1', 150.726, 133.609, 98.558], ['A', ' OE2', 150.24, 135.037, 100.024], ['A', ' H ', 152.659, 131.454, 102.268], ['A', ' HA ', 151.349, 131.401, 99.631], ['A', ' HB ', 153.823, 132.825, 100.536], ['A', ' HB ', 153.202, 132.941, 98.946], ['A', ' HG ', 151.726, 133.628, 101.352], ['A', ' HG ', 152.72, 134.748, 100.507]]
[['A', ' N ', 152.5, 129.321, 99.052], ['A', ' CA ', 152.935, 128.12, 98.354], ['A', ' C ', 153.33, 128.527, 96.937], ['A', ' O ', 152.829, 129.531, 96.428], ['A', ' CB ', 151.796, 127.097, 98.364], ['A', ' H ', 151.518, 129.395, 99.327], ['A', ' HA ', 153.802, 127.719, 98.872], ['A', ' HB ', 152.026, 126.175, 97.889], ['A', ' HB ', 151.523, 126.895, 99.379], ['A', ' HB ', 150.962, 127.491, 97.879]]
[['A', ' N ', 154.162, 127.777, 96.215], ['A', ' CA ', 154.606, 128.107, 94.875], ['A', ' C ', 153.478, 128.153, 93.857], ['A', ' O ', 153.645, 128.678, 92.76], ['A', ' CB ', 155.579, 126.992, 94.569], ['A', ' CG ', 155.172, 125.865, 95.463], ['A', ' CD ', 154.654, 126.495, 96.702], ['A', ' HA ', 155.134, 129.074, 94.905], ['A', ' HB ', 155.517, 126.729, 93.5], ['A', ' HB ', 156.587, 127.345, 94.739], ['A', ' HG ', 154.436, 125.217, 94.966], ['A', ' HG ', 156.04, 125.226, 95.682], ['A', ' HD ', 153.881, 125.845, 97.028], ['A', ' HD ', 155.427, 126.61, 97.45]]
[['A', ' N ', 152.338, 127.569, 94.184], ['A', ' CA ', 151.234, 127.571, 93.258], ['A', ' C ', 150.171, 128.572, 93.673], ['A', ' O ', 149.135, 128.649, 93.022], ['A', ' CB ', 150.586, 126.197, 93.204], ['A', ' CG ', 151.509, 125.021, 92.912], ['A', ' CD ', 152.247, 125.165, 91.668], ['A', ' NE ', 153.085, 124.018, 91.391], ['A', ' CZ ', 152.756, 122.928, 90.667], ['A', ' NH1', 151.593, 122.78, 90.102], ['A', ' NH2', 153.657, 122.006, 90.489], ['A', ' H ', 152.214, 127.133, 95.084], ['A', ' HA ', 151.591, 127.847, 92.267], ['A', ' HB ', 150.118, 125.991, 94.159], ['A', ' HB ', 149.799, 126.192, 92.447], ['A', ' HG ', 152.232, 124.918, 93.717], ['A', ' HG ', 150.911, 124.115, 92.845], ['A', ' HD ', 151.579, 125.319, 90.85], ['A', ' HD ', 152.907, 126.022, 91.741], ['A', ' HE ', 154.02, 124.045, 91.76], ['A', ' HH1', 150.89, 123.516, 90.151], ['A', ' HH1', 151.416, 121.961, 89.538], ['A', ' HH2', 154.585, 122.133, 90.865], ['A', ' HH2', 153.447, 121.202, 89.919]]
[['A', ' N ', 150.416, 129.341, 94.737], ['A', ' CA ', 149.431, 130.296, 95.248], ['A', ' C ', 149.095, 130.061, 96.719], ['A', ' O ', 149.503, 129.072, 97.299], ['A', ' H ', 151.321, 129.276, 95.202], ['A', ' HA ', 149.826, 131.306, 95.134], ['A', ' HA ', 148.536, 130.24, 94.644]]
[['A', ' N ', 148.343, 130.961, 97.34], ['A', ' CA ', 148.067, 130.872, 98.767], ['A', ' C ', 147.3, 129.63, 99.204], ['A', ' O ', 146.169, 129.394, 98.791], ['A', ' CB ', 147.23, 132.094, 99.151], ['A', ' CG ', 146.917, 132.306, 100.619], ['A', ' CD1', 148.198, 132.656, 101.376], ['A', ' CD2', 145.872, 133.411, 100.742], ['A', ' H ', 148.001, 131.76, 96.832], ['A', ' HA ', 149.023, 130.888, 99.283], ['A', ' HB ', 147.755, 132.986, 98.799], ['A', ' HB ', 146.278, 132.035, 98.622], ['A', ' HG ', 146.532, 131.398, 101.044], ['A', ' HD1', 147.982, 132.827, 102.418], ['A', ' HD1', 148.925, 131.866, 101.294], ['A', ' HD1', 148.599, 133.556, 100.962], ['A', ' HD2', 145.636, 133.562, 101.794], ['A', ' HD2', 146.26, 134.34, 100.316], ['A', ' HD2', 144.967, 133.115, 100.21]]
[['A', ' N ', 147.915, 128.893, 100.122], ['A', ' CA ', 147.451, 127.647, 100.728], ['A', ' C ', 146.854, 127.913, 102.107], ['A', ' O ', 147.602, 128.121, 103.061], ['A', ' CB ', 148.67, 126.686, 100.785], ['A', ' CG ', 148.428, 125.285, 101.328], ['A', ' OD1', 147.451, 125.097, 101.932], ['A', ' OD2', 149.185, 124.385, 101.069], ['A', ' H ', 148.846, 129.204, 100.378], ['A', ' HA ', 146.684, 127.222, 100.106], ['A', ' HB ', 149.062, 126.583, 99.77], ['A', ' HB ', 149.459, 127.148, 101.373]]
[['A', ' N ', 145.522, 127.973, 102.221], ['A', ' CA ', 144.889, 128.359, 103.485], ['A', ' C ', 144.225, 127.197, 104.204], ['A', ' O ', 143.281, 126.594, 103.698], ['A', ' CB ', 143.763, 129.375, 103.225], ['A', ' CG1', 143.12, 129.803, 104.553], ['A', ' CG2', 144.264, 130.533, 102.425], ['A', ' H ', 144.932, 127.778, 101.409], ['A', ' HA ', 145.641, 128.787, 104.14], ['A', ' HB ', 143.0, 128.889, 102.661], ['A', ' HG1', 142.316, 130.48, 104.352], ['A', ' HG1', 142.723, 128.946, 105.089], ['A', ' HG1', 143.864, 130.299, 105.174], ['A', ' HG2', 143.448, 131.215, 102.22], ['A', ' HG2', 145.025, 131.05, 102.962], ['A', ' HG2', 144.663, 130.168, 101.48]]
[['A', ' N ', 144.648, 126.901, 105.42], ['A', ' CA ', 144.019, 125.799, 106.13], ['A', ' C ', 143.34, 126.333, 107.359], ['A', ' O ', 143.856, 127.209, 108.06], ['A', ' CB ', 144.983, 124.711, 106.598], ['A', ' CG ', 145.729, 123.983, 105.553], ['A', ' ND1', 146.348, 122.777, 105.792], ['A', ' CD2', 146.024, 124.297, 104.294], ['A', ' CE1', 146.983, 122.401, 104.694], ['A', ' NE2', 146.794, 123.322, 103.797], ['A', ' H ', 145.406, 127.445, 105.837], ['A', ' HA ', 143.257, 125.327, 105.518], ['A', ' HB ', 145.703, 125.155, 107.263], ['A', ' HB ', 144.423, 123.982, 107.181], ['A', ' HD2', 145.761, 125.163, 103.731], ['A', ' HE1', 147.584, 121.497, 104.571], ['A', ' HE2', 147.173, 123.406, 102.846]]
[['A', ' N ', 142.188, 125.779, 107.645], ['A', ' CA ', 141.458, 126.119, 108.841], ['A', ' C ', 141.332, 124.904, 109.728], ['A', ' O ', 141.084, 123.798, 109.245], ['A', ' CB ', 140.1, 126.702, 108.496], ['A', ' CG ', 139.221, 127.01, 109.717], ['A', ' SD ', 137.666, 127.756, 109.284], ['A', ' CE ', 138.152, 129.43, 109.256], ['A', ' H ', 141.813, 125.076, 107.001], ['A', ' HA ', 142.018, 126.868, 109.38], ['A', ' HB ', 140.245, 127.62, 107.934], ['A', ' HB ', 139.565, 126.004, 107.847], ['A', ' HG ', 139.011, 126.105, 110.281], ['A', ' HG ', 139.761, 127.7, 110.377], ['A', ' HE ', 137.305, 130.061, 108.986], ['A', ' HE ', 138.529, 129.725, 110.24], ['A', ' HE ', 138.922, 129.538, 108.546]]
[['A', ' N ', 141.462, 125.097, 111.035], ['A', ' CA ', 141.312, 123.964, 111.928], ['A', ' C ', 140.691, 124.327, 113.264], ['A', ' O ', 140.922, 125.39, 113.85], ['A', ' CB ', 142.67, 123.337, 112.187], ['A', ' H ', 141.691, 126.036, 111.382], ['A', ' HA ', 140.666, 123.24, 111.442], ['A', ' HB ', 142.553, 122.46, 112.828], ['A', ' HB ', 143.122, 123.043, 111.251], ['A', ' HB ', 143.318, 124.066, 112.681]]
[['A', ' N ', 139.93, 123.402, 113.797], ['A', ' CA ', 139.371, 123.586, 115.113], ['A', ' C ', 139.688, 122.378, 115.94], ['A', ' O ', 139.297, 121.262, 115.594], ['A', ' CB ', 137.865, 123.781, 115.058], ['A', ' CG ', 137.233, 124.084, 116.358], ['A', ' CD ', 135.765, 124.5, 116.232], ['A', ' CE ', 134.839, 123.309, 116.026], ['A', ' NZ ', 133.4, 123.715, 116.059], ['A', ' H ', 139.759, 122.546, 113.262], ['A', ' HA ', 139.836, 124.447, 115.588], ['A', ' HB ', 137.623, 124.536, 114.367], ['A', ' HB ', 137.422, 122.86, 114.737], ['A', ' HG ', 137.305, 123.22, 117.02], ['A', ' HG ', 137.767, 124.895, 116.789], ['A', ' HD ', 135.463, 125.012, 117.152], ['A', ' HD ', 135.646, 125.189, 115.398], ['A', ' HE ', 135.049, 122.841, 115.066], ['A', ' HE ', 135.016, 122.583, 116.82], ['A', ' HZ ', 132.82, 122.899, 115.93], ['A', ' HZ ', 133.177, 124.145, 116.955], ['A', ' HZ ', 133.219, 124.378, 115.321]]
[['A', ' N ', 140.346, 122.606, 117.056], ['A', ' CA ', 140.729, 121.543, 117.954], ['A', ' C ', 140.027, 121.704, 119.271], ['A', ' O ', 140.095, 122.765, 119.89], ['A', ' CB ', 142.243, 121.553, 118.18], ['A', ' CG1', 142.632, 120.463, 119.182], ['A', ' CG2', 142.945, 121.329, 116.851], ['A', ' H ', 140.602, 123.554, 117.28], ['A', ' HA ', 140.435, 120.593, 117.522], ['A', ' HB ', 142.543, 122.516, 118.599], ['A', ' HG1', 143.702, 120.485, 119.339], ['A', ' HG1', 142.142, 120.627, 120.137], ['A', ' HG1', 142.344, 119.488, 118.796], ['A', ' HG2', 144.026, 121.342, 117.0], ['A', ' HG2', 142.642, 120.37, 116.461], ['A', ' HG2', 142.67, 122.106, 116.147]]
[['A', ' N ', 139.351, 120.652, 119.687], ['A', ' CA ', 138.646, 120.652, 120.949], ['A', ' C ', 138.948, 119.376, 121.699], ['A', ' O ', 138.844, 118.277, 121.159], ['A', ' CB ', 137.133, 120.739, 120.759], ['A', ' CG ', 136.625, 121.998, 120.069], ['A', ' CD ', 135.104, 122.024, 119.881], ['A', ' OE1', 134.48, 121.029, 120.16], ['A', ' OE2', 134.574, 123.032, 119.466], ['A', ' H ', 139.395, 119.809, 119.11], ['A', ' HA ', 138.976, 121.498, 121.541], ['A', ' HB ', 136.789, 119.87, 120.23], ['A', ' HB ', 136.661, 120.713, 121.741], ['A', ' HG ', 136.916, 122.841, 120.669], ['A', ' HG ', 137.107, 122.089, 119.103]]
[['A', ' N ', 139.3, 119.505, 122.958], ['A', ' CA ', 139.521, 118.348, 123.815], ['A', ' C ', 140.551, 117.362, 123.264], ['A', ' O ', 140.411, 116.152, 123.427], ['A', ' CB ', 138.209, 117.623, 124.04], ['A', ' CG ', 137.203, 118.486, 124.684], ['A', ' OD1', 137.492, 119.209, 125.646], ['A', ' ND2', 136.003, 118.445, 124.169], ['A', ' H ', 139.415, 120.457, 123.331], ['A', ' HA ', 139.898, 118.705, 124.775], ['A', ' HB ', 137.806, 117.237, 123.107], ['A', ' HB ', 138.384, 116.766, 124.688], ['A', ' HD2', 135.272, 119.01, 124.552], ['A', ' HD2', 135.816, 117.852, 123.384]]
[['A', ' N ', 141.588, 117.87, 122.62], ['A', ' CA ', 142.663, 117.032, 122.108], ['A', ' C ', 142.387, 116.397, 120.748], ['A', ' O ', 143.182, 115.579, 120.28], ['A', ' H ', 141.645, 118.872, 122.519], ['A', ' HA ', 143.571, 117.634, 122.039], ['A', ' HA ', 142.872, 116.246, 122.831]]
[['A', ' N ', 141.267, 116.73, 120.117], ['A', ' CA ', 140.936, 116.174, 118.812], ['A', ' C ', 140.564, 117.258, 117.832], ['A', ' O ', 140.01, 118.299, 118.19], ['A', ' CB ', 139.801, 115.162, 118.905], ['A', ' CG ', 140.074, 113.927, 119.758], ['A', ' CD ', 141.122, 113.011, 119.114], ['A', ' CE ', 141.25, 111.679, 119.84], ['A', ' NZ ', 141.747, 111.834, 121.243], ['A', ' H ', 140.595, 117.355, 120.57], ['A', ' HA ', 141.799, 115.675, 118.408], ['A', ' HB ', 138.939, 115.654, 119.341], ['A', ' HB ', 139.524, 114.838, 117.897], ['A', ' HG ', 140.419, 114.248, 120.741], ['A', ' HG ', 139.147, 113.374, 119.884], ['A', ' HD ', 140.866, 112.83, 118.067], ['A', ' HD ', 142.089, 113.491, 119.152], ['A', ' HE ', 140.279, 111.188, 119.861], ['A', ' HE ', 141.951, 111.053, 119.289], ['A', ' HZ ', 141.82, 110.924, 121.673], ['A', ' HZ ', 142.657, 112.279, 121.247], ['A', ' HZ ', 141.1, 112.399, 121.772]]
[['A', ' N ', 140.828, 117.012, 116.58], ['A', ' CA ', 140.415, 117.936, 115.567], ['A', ' C ', 138.923, 117.707, 115.39], ['A', ' O ', 138.446, 116.579, 115.419], ['A', ' CB ', 141.204, 117.699, 114.274], ['A', ' CG1', 142.698, 117.951, 114.546], ['A', ' CG2', 140.697, 118.629, 113.181], ['A', ' CD1', 143.609, 117.461, 113.467], ['A', ' H ', 141.299, 116.148, 116.303], ['A', ' HA ', 140.578, 118.956, 115.899], ['A', ' HB ', 141.094, 116.66, 113.96], ['A', ' HG1', 142.863, 119.01, 114.667], ['A', ' HG1', 142.978, 117.444, 115.469], ['A', ' HG2', 141.247, 118.46, 112.279], ['A', ' HG2', 139.648, 118.436, 112.989], ['A', ' HG2', 140.818, 119.667, 113.496], ['A', ' HD1', 144.637, 117.661, 113.744], ['A', ' HD1', 143.474, 116.375, 113.348], ['A', ' HD1', 143.398, 117.951, 112.53]]
[['A', ' N ', 138.159, 118.775, 115.382], ['A', ' CA ', 136.726, 118.671, 115.195], ['A', ' C ', 136.395, 119.135, 113.82], ['A', ' O ', 135.421, 118.705, 113.204], ['A', ' CB ', 135.99, 119.514, 116.207], ['A', ' CG ', 136.242, 119.104, 117.586], ['A', ' CD ', 135.797, 117.718, 117.836], ['A', ' OE1', 134.636, 117.38, 117.602], ['A', ' NE2', 136.697, 116.885, 118.293], ['A', ' H ', 138.604, 119.678, 115.435], ['A', ' HA ', 136.42, 117.63, 115.283], ['A', ' HB ', 136.315, 120.549, 116.111], ['A', ' HB ', 134.92, 119.479, 116.017], ['A', ' HG ', 137.308, 119.184, 117.809], ['A', ' HG ', 135.669, 119.754, 118.227], ['A', ' HE2', 136.457, 115.931, 118.467], ['A', ' HE2', 137.638, 117.204, 118.455]]
[['A', ' N ', 137.227, 120.031, 113.345], ['A', ' CA ', 137.061, 120.595, 112.031], ['A', ' C ', 138.38, 120.816, 111.366], ['A', ' O ', 139.328, 121.301, 111.988], ['A', ' CB ', 136.364, 121.939, 112.092], ['A', ' CG ', 136.221, 122.558, 110.799], ['A', ' CD1', 135.166, 122.249, 110.004], ['A', ' CD2', 137.168, 123.456, 110.344], ['A', ' CE1', 135.039, 122.82, 108.785], ['A', ' CE2', 137.038, 124.016, 109.123], ['A', ' CZ ', 135.971, 123.702, 108.348], ['A', ' H ', 137.972, 120.355, 113.965], ['A', ' HA ', 136.478, 119.905, 111.419], ['A', ' HB ', 135.384, 121.833, 112.544], ['A', ' HB ', 136.931, 122.603, 112.682], ['A', ' HD1', 134.418, 121.537, 110.356], ['A', ' HD2', 138.03, 123.708, 110.969], ['A', ' HE1', 134.188, 122.57, 108.152], ['A', ' HE2', 137.779, 124.712, 108.753], ['A', ' HZ ', 135.866, 124.155, 107.37]]
[['A', ' N ', 138.44, 120.482, 110.105], ['A', ' CA ', 139.591, 120.779, 109.302], ['A', ' C ', 139.192, 120.865, 107.857], ['A', ' O ', 138.457, 120.011, 107.358], ['A', ' CB ', 140.69, 119.749, 109.501], ['A', ' CG ', 141.82, 119.964, 108.589], ['A', ' CD1', 142.793, 120.886, 108.863], ['A', ' CD2', 141.859, 119.243, 107.45], ['A', ' CE1', 143.806, 121.086, 107.97], ['A', ' CE2', 142.855, 119.429, 106.557], ['A', ' CZ ', 143.821, 120.347, 106.803], ['A', ' OH ', 144.801, 120.517, 105.88], ['A', ' H ', 137.645, 120.036, 109.664], ['A', ' HA ', 139.969, 121.75, 109.593], ['A', ' HB ', 141.063, 119.824, 110.509], ['A', ' HB ', 140.306, 118.745, 109.355], ['A', ' HD1', 142.747, 121.458, 109.775], ['A', ' HD2', 141.073, 118.519, 107.258], ['A', ' HE1', 144.582, 121.823, 108.172], ['A', ' HE2', 142.879, 118.848, 105.634], ['A', ' HH ', 145.332, 121.306, 106.085]]
[['A', ' N ', 139.675, 121.896, 107.186], ['A', ' CA ', 139.443, 122.056, 105.758], ['A', ' C ', 140.502, 122.939, 105.156], ['A', ' O ', 141.187, 123.671, 105.88], ['A', ' CB ', 138.093, 122.661, 105.476], ['A', ' OG ', 138.043, 123.989, 105.902], ['A', ' H ', 140.226, 122.591, 107.702], ['A', ' HA ', 139.495, 121.081, 105.288], ['A', ' HB ', 137.893, 122.607, 104.405], ['A', ' HB ', 137.322, 122.081, 105.981], ['A', ' HG ', 137.192, 124.321, 105.617]]
[['A', ' N ', 140.626, 122.942, 103.831], ['A', ' CA ', 141.593, 123.854, 103.259], ['A', ' C ', 141.172, 124.41, 101.894], ['A', ' O ', 140.51, 123.746, 101.103], ['A', ' CB ', 142.919, 123.138, 103.174], ['A', ' H ', 140.075, 122.3, 103.246], ['A', ' HA ', 141.686, 124.703, 103.928], ['A', ' HB ', 143.654, 123.823, 102.818], ['A', ' HB ', 143.21, 122.787, 104.166], ['A', ' HB ', 142.837, 122.289, 102.5]]
[['A', ' N ', 141.579, 125.659, 101.651], ['A', ' CA ', 141.384, 126.395, 100.404], ['A', ' C ', 142.757, 126.607, 99.851], ['A', ' O ', 143.483, 127.495, 100.304], ['A', ' CB ', 140.792, 127.763, 100.697], ['A', ' CG ', 139.575, 127.787, 101.541], ['A', ' CD1', 139.258, 129.244, 101.857], ['A', ' CD2', 138.451, 127.081, 100.824], ['A', ' H ', 142.113, 126.11, 102.392], ['A', ' HA ', 140.797, 125.811, 99.693], ['A', ' HB ', 141.529, 128.385, 101.152], ['A', ' HB ', 140.523, 128.211, 99.741], ['A', ' HG ', 139.764, 127.277, 102.486], ['A', ' HD1', 138.38, 129.295, 102.49], ['A', ' HD1', 140.103, 129.694, 102.379], ['A', ' HD1', 139.078, 129.78, 100.937], ['A', ' HD2', 137.552, 127.1, 101.44], ['A', ' HD2', 138.252, 127.569, 99.887], ['A', ' HD2', 138.715, 126.043, 100.632]]
[['A', ' N ', 143.12, 125.81, 98.902], ['A', ' CA ', 144.485, 125.757, 98.468], ['A', ' C ', 144.493, 126.153, 96.947], ['A', ' O ', 143.415, 126.274, 96.349], ['A', ' CB ', 144.962, 124.355, 98.958], ['A', ' CG1', 146.304, 124.095, 98.729], ['A', ' CG2', 144.705, 124.189, 100.391], ['A', ' H ', 142.424, 125.158, 98.524], ['A', ' HA ', 145.037, 126.506, 99.007], ['A', ' HB ', 144.417, 123.657, 98.472], ['A', ' HG1', 146.521, 123.096, 99.071], ['A', ' HG1', 146.499, 124.192, 97.713], ['A', ' HG1', 146.888, 124.778, 99.275], ['A', ' HG2', 145.015, 123.197, 100.7], ['A', ' HG2', 145.261, 124.933, 100.959], ['A', ' HG2', 143.677, 124.284, 100.586]]
[['A', ' N ', 145.615, 126.617, 96.343], ['A', ' CA ', 145.691, 127.116, 94.991], ['A', ' C ', 145.193, 126.339, 93.816], ['A', ' O ', 144.802, 126.952, 92.818], ['A', ' CB ', 147.183, 127.302, 94.832], ['A', ' CG ', 147.795, 126.556, 95.942], ['A', ' CD ', 146.864, 126.833, 97.011], ['A', ' HA ', 145.224, 128.089, 94.982], ['A', ' HB ', 147.5, 126.932, 93.846], ['A', ' HB ', 147.402, 128.351, 94.855], ['A', ' HG ', 147.905, 125.495, 95.705], ['A', ' HG ', 148.804, 126.941, 96.145], ['A', ' HD ', 147.062, 126.327, 97.867], ['A', ' HD ', 146.949, 127.887, 97.174]]
[['A', ' N ', 145.176, 125.035, 93.844], ['A', ' CA ', 144.67, 124.464, 92.622], ['A', ' C ', 143.204, 124.766, 92.432], ['A', ' O ', 142.798, 125.084, 91.309], ['A', ' CB ', 144.923, 122.978, 92.505], ['A', ' OG1', 146.349, 122.742, 92.46], ['A', ' CG2', 144.265, 122.441, 91.253], ['A', ' H ', 145.456, 124.457, 94.649], ['A', ' HA ', 145.203, 124.927, 91.792], ['A', ' HB ', 144.508, 122.485, 93.372], ['A', ' HG1', 146.747, 123.009, 93.321], ['A', ' HG2', 144.435, 121.401, 91.178], ['A', ' HG2', 143.202, 122.603, 91.293], ['A', ' HG2', 144.669, 122.941, 90.388]]
[['A', ' N ', 142.386, 124.675, 93.484], ['A', ' CA ', 140.987, 124.885, 93.212], ['A', ' C ', 140.676, 126.349, 93.208], ['A', ' O ', 139.683, 126.753, 92.613], ['A', ' CB ', 140.057, 124.177, 94.177], ['A', ' OG1', 140.169, 124.726, 95.471], ['A', ' CG2', 140.371, 122.703, 94.202], ['A', ' H ', 142.706, 124.436, 94.431], ['A', ' HA ', 140.765, 124.498, 92.22], ['A', ' HB ', 139.049, 124.314, 93.84], ['A', ' HG1', 141.067, 124.594, 95.817], ['A', ' HG2', 139.689, 122.213, 94.89], ['A', ' HG2', 140.258, 122.305, 93.201], ['A', ' HG2', 141.385, 122.537, 94.524]]
[['A', ' N ', 141.542, 127.185, 93.782], ['A', ' CA ', 141.276, 128.603, 93.635], ['A', ' C ', 141.335, 128.925, 92.139], ['A', ' O ', 140.512, 129.688, 91.638], ['A', ' CB ', 142.322, 129.479, 94.323], ['A', ' CG ', 142.219, 129.702, 95.812], ['A', ' CD1', 143.054, 129.257, 96.764], ['A', ' CD2', 141.259, 130.478, 96.493], ['A', ' NE1', 142.658, 129.671, 97.978], ['A', ' CE2', 141.571, 130.414, 97.844], ['A', ' CE3', 140.186, 131.209, 96.09], ['A', ' CZ2', 140.842, 131.051, 98.779], ['A', ' CZ3', 139.447, 131.843, 97.035], ['A', ' CH2', 139.77, 131.77, 98.349], ['A', ' H ', 142.317, 126.832, 94.356], ['A', ' HA ', 140.284, 128.833, 94.021], ['A', ' HB ', 143.262, 129.008, 94.142], ['A', ' HB ', 142.352, 130.456, 93.832], ['A', ' HD1', 143.907, 128.672, 96.6], ['A', ' HE1', 143.132, 129.455, 98.868], ['A', ' HE3', 139.919, 131.272, 95.034], ['A', ' HZ2', 141.097, 131.0, 99.836], ['A', ' HZ3', 138.593, 132.401, 96.698], ['A', ' HH2', 139.175, 132.292, 99.072]]
[['A', ' N ', 142.309, 128.332, 91.43], ['A', ' CA ', 142.482, 128.573, 90.004], ['A', ' C ', 141.578, 127.8, 89.037], ['A', ' O ', 141.227, 128.342, 87.988], ['A', ' CB ', 143.926, 128.378, 89.636], ['A', ' CG ', 144.755, 129.504, 90.121], ['A', ' OD1', 144.266, 130.634, 90.257], ['A', ' ND2', 145.984, 129.255, 90.384], ['A', ' H ', 142.995, 127.749, 91.924], ['A', ' HA ', 142.252, 129.625, 89.838], ['A', ' HB ', 144.289, 127.448, 90.085], ['A', ' HB ', 144.032, 128.291, 88.557], ['A', ' HD2', 146.586, 130.006, 90.706], ['A', ' HD2', 146.363, 128.336, 90.28]]
[['A', ' N ', 141.115, 126.598, 89.365], ['A', ' CA ', 140.293, 125.877, 88.382], ['A', ' C ', 139.12, 126.669, 87.784], ['A', ' O ', 138.948, 126.627, 86.56], ['A', ' CB ', 139.848, 124.48, 88.875], ['A', ' CG1', 141.06, 123.537, 88.919], ['A', ' CG2', 138.76, 123.946, 87.988], ['A', ' CD1', 140.829, 122.234, 89.665], ['A', ' H ', 141.437, 126.15, 90.23], ['A', ' HA ', 140.918, 125.669, 87.543], ['A', ' HB ', 139.484, 124.534, 89.887], ['A', ' HG1', 141.339, 123.289, 87.9], ['A', ' HG1', 141.884, 124.054, 89.375], ['A', ' HG2', 138.45, 122.986, 88.337], ['A', ' HG2', 137.886, 124.593, 87.988], ['A', ' HG2', 139.135, 123.862, 86.975], ['A', ' HD1', 141.736, 121.64, 89.637], ['A', ' HD1', 140.573, 122.45, 90.699], ['A', ' HD1', 140.031, 121.667, 89.206]]
[['A', ' N ', 138.294, 127.373, 88.564], ['A', ' CA ', 137.174, 128.181, 88.128], ['A', ' C ', 137.584, 129.348, 87.226], ['A', ' O ', 136.739, 129.951, 86.569], ['A', ' CB ', 136.634, 128.712, 89.446], ['A', ' CG ', 137.13, 127.762, 90.455], ['A', ' CD ', 138.432, 127.35, 90.0], ['A', ' HA ', 136.435, 127.538, 87.627], ['A', ' HB ', 136.994, 129.724, 89.613], ['A', ' HB ', 135.539, 128.754, 89.424], ['A', ' HG ', 137.227, 128.249, 91.435], ['A', ' HG ', 136.446, 126.933, 90.563], ['A', ' HD ', 139.154, 128.085, 90.344], ['A', ' HD ', 138.609, 126.382, 90.405]]
[['A', ' N ', 138.87, 129.691, 87.218], ['A', ' CA ', 139.376, 130.783, 86.414], ['A', ' C ', 140.068, 130.236, 85.185], ['A', ' O ', 140.11, 130.89, 84.141], ['A', ' CB ', 140.378, 131.639, 87.222], ['A', ' OG1', 139.735, 132.142, 88.387], ['A', ' CG2', 140.872, 132.814, 86.406], ['A', ' H ', 139.556, 129.173, 87.755], ['A', ' HA ', 138.542, 131.404, 86.093], ['A', ' HB ', 141.229, 131.023, 87.525], ['A', ' HG1', 139.688, 131.434, 89.042], ['A', ' HG2', 141.551, 133.395, 87.01], ['A', ' HG2', 141.396, 132.473, 85.519], ['A', ' HG2', 140.03, 133.437, 86.113]]
[['A', ' N ', 140.627, 129.031, 85.293], ['A', ' CA ', 141.349, 128.453, 84.175], ['A', ' C ', 140.46, 128.05, 83.024], ['A', ' O ', 140.795, 128.292, 81.88], ['A', ' CB ', 142.127, 127.232, 84.611], ['A', ' CG ', 143.277, 127.54, 85.451], ['A', ' SD ', 144.355, 126.152, 85.708], ['A', ' CE ', 143.479, 125.214, 86.879], ['A', ' H ', 140.583, 128.54, 86.185], ['A', ' HA ', 142.049, 129.2, 83.806], ['A', ' HB ', 141.456, 126.58, 85.168], ['A', ' HB ', 142.467, 126.689, 83.759], ['A', ' HG ', 143.803, 128.309, 84.987], ['A', ' HG ', 142.952, 127.902, 86.399], ['A', ' HE ', 144.004, 124.322, 87.111], ['A', ' HE ', 143.337, 125.792, 87.781], ['A', ' HE ', 142.554, 124.948, 86.463]]
[['A', ' N ', 139.298, 127.484, 83.299], ['A', ' CA ', 138.44, 127.04, 82.194], ['A', ' C ', 138.231, 128.128, 81.141], ['A', ' O ', 138.649, 127.971, 79.99], ['A', ' H ', 139.057, 127.299, 84.281], ['A', ' HA ', 138.909, 126.192, 81.708], ['A', ' HA ', 137.493, 126.683, 82.578]]
[['A', ' N ', 137.642, 129.261, 81.52], ['A', ' CA ', 137.328, 130.407, 80.697], ['A', ' C ', 138.555, 131.097, 80.116], ['A', ' O ', 138.441, 131.946, 79.239], ['A', ' CB ', 136.625, 131.342, 81.674], ['A', ' CG ', 136.121, 130.457, 82.764], ['A', ' CD ', 137.148, 129.403, 82.901], ['A', ' HA ', 136.643, 130.086, 79.9], ['A', ' HB ', 137.332, 132.086, 82.043], ['A', ' HB ', 135.822, 131.886, 81.148], ['A', ' HG ', 135.99, 131.029, 83.699], ['A', ' HG ', 135.133, 130.05, 82.495], ['A', ' HD ', 137.924, 129.756, 83.561], ['A', ' HD ', 136.649, 128.516, 83.282]]
[['A', ' N ', 139.739, 130.766, 80.599], ['A', ' CA ', 140.951, 131.423, 80.166], ['A', ' C ', 141.306, 131.071, 78.744], ['A', ' O ', 142.155, 131.724, 78.13], ['A', ' CB ', 142.081, 131.039, 81.092], ['A', ' H ', 139.863, 129.995, 81.253], ['A', ' HA ', 140.782, 132.495, 80.219], ['A', ' HB ', 142.977, 131.571, 80.804], ['A', ' HB ', 141.831, 131.278, 82.107], ['A', ' HB ', 142.244, 129.979, 81.026]]
[['A', ' N ', 140.694, 130.02, 78.218], ['A', ' CA ', 140.997, 129.578, 76.876], ['A', ' C ', 140.088, 130.267, 75.841], ['A', ' O ', 140.306, 130.141, 74.63], ['A', ' CB ', 140.844, 128.056, 76.784], ['A', ' OG1', 139.48, 127.688, 76.959], ['A', ' CG2', 141.654, 127.413, 77.935], ['A', ' H ', 140.005, 129.488, 78.77], ['A', ' HA ', 142.031, 129.837, 76.65], ['A', ' HB ', 141.198, 127.705, 75.815], ['A', ' HG1', 139.361, 126.771, 76.694], ['A', ' HG2', 141.562, 126.333, 77.888], ['A', ' HG2', 142.688, 127.687, 77.842], ['A', ' HG2', 141.282, 127.759, 78.901]]
[['A', ' N ', 139.067, 130.973, 76.315], ['A', ' CA ', 138.076, 131.556, 75.428], ['A', ' C ', 138.674, 132.694, 74.611], ['A', ' O ', 139.464, 133.501, 75.1], ['A', ' CB ', 136.881, 132.029, 76.256], ['A', ' CG ', 136.115, 130.873, 76.925], ['A', ' CD ', 134.99, 131.316, 77.862], ['A', ' OE1', 134.795, 132.494, 78.001], ['A', ' OE2', 134.333, 130.455, 78.459], ['A', ' H ', 138.963, 131.119, 77.323], ['A', ' HA ', 137.734, 130.789, 74.736], ['A', ' HB ', 137.22, 132.713, 77.034], ['A', ' HB ', 136.184, 132.568, 75.615], ['A', ' HG ', 135.696, 130.27, 76.135], ['A', ' HG ', 136.818, 130.25, 77.471]]
[['A', ' N ', 138.263, 132.764, 73.352], ['A', ' CA ', 138.678, 133.785, 72.405], ['A', ' C ', 139.847, 133.338, 71.539], ['A', ' O ', 140.197, 134.006, 70.567], ['A', ' H ', 137.609, 132.06, 73.025], ['A', ' HA ', 137.833, 134.042, 71.766], ['A', ' HA ', 138.955, 134.686, 72.947]]
[['A', ' N ', 140.436, 132.196, 71.866], ['A', ' CA ', 141.581, 131.687, 71.134], ['A', ' C ', 141.386, 130.32, 70.537], ['A', ' O ', 140.519, 129.553, 70.95], ['A', ' CB ', 142.8, 131.715, 72.031], ['A', ' CG ', 143.207, 133.097, 72.321], ['A', ' CD1', 142.658, 133.809, 73.369], ['A', ' CD2', 144.149, 133.707, 71.524], ['A', ' CE1', 143.039, 135.098, 73.59], ['A', ' CE2', 144.528, 134.99, 71.757], ['A', ' CZ ', 143.974, 135.684, 72.778], ['A', ' H ', 140.118, 131.671, 72.689], ['A', ' HA ', 141.777, 132.369, 70.308], ['A', ' HB ', 142.568, 131.215, 72.976], ['A', ' HB ', 143.629, 131.183, 71.567], ['A', ' HD1', 141.906, 133.344, 74.017], ['A', ' HD2', 144.592, 133.155, 70.695], ['A', ' HE1', 142.6, 135.668, 74.417], ['A', ' HE2', 145.264, 135.477, 71.125], ['A', ' HZ ', 144.284, 136.717, 72.947]]
[['A', ' N ', 142.19, 130.012, 69.529], ['A', ' CA ', 142.121, 128.703, 68.909], ['A', ' C ', 142.359, 127.676, 69.99], ['A', ' O ', 143.259, 127.842, 70.818], ['A', ' CB ', 143.148, 128.567, 67.8], ['A', ' CG ', 142.968, 127.357, 66.981], ['A', ' ND1', 143.318, 126.099, 67.413], ['A', ' CD2', 142.489, 127.207, 65.731], ['A', ' CE1', 143.059, 125.227, 66.464], ['A', ' NE2', 142.558, 125.871, 65.429], ['A', ' H ', 142.864, 130.687, 69.198], ['A', ' HA ', 141.152, 128.519, 68.48], ['A', ' HB ', 143.092, 129.434, 67.144], ['A', ' HB ', 144.147, 128.541, 68.224], ['A', ' HD2', 142.122, 128.001, 65.079], ['A', ' HE1', 143.24, 124.155, 66.522], ['A', ' HE2', 142.273, 125.452, 64.551]]
[['A', ' N ', 141.592, 126.593, 69.96], ['A', ' CA ', 141.65, 125.558, 70.978], ['A', ' C ', 143.027, 124.973, 71.181], ['A', ' O ', 143.333, 124.527, 72.287], ['A', ' CB ', 140.673, 124.421, 70.701], ['A', ' CG ', 141.019, 123.555, 69.58], ['A', ' ND1', 141.83, 122.453, 69.727], ['A', ' CD2', 140.629, 123.565, 68.295], ['A', ' CE1', 141.939, 121.837, 68.574], ['A', ' NE2', 141.217, 122.488, 67.686], ['A', ' H ', 140.883, 126.516, 69.237], ['A', ' HA ', 141.358, 125.998, 71.928], ['A', ' HB ', 140.574, 123.806, 71.58], ['A', ' HB ', 139.7, 124.846, 70.499], ['A', ' HD2', 139.967, 124.282, 67.828], ['A', ' HE1', 142.52, 120.934, 68.387], ['A', ' HE2', 141.107, 122.234, 66.714]]
[['A', ' N ', 143.909, 125.031, 70.183], ['A', ' CA ', 145.248, 124.479, 70.344], ['A', ' C ', 146.019, 125.189, 71.449], ['A', ' O ', 147.017, 124.668, 71.942], ['A', ' CB ', 146.06, 124.575, 69.057], ['A', ' CG ', 146.488, 125.989, 68.653], ['A', ' CD ', 147.19, 125.997, 67.33], ['A', ' OE1', 147.626, 124.946, 66.918], ['A', ' OE2', 147.271, 127.027, 66.708], ['A', ' H ', 143.643, 125.407, 69.265], ['A', ' HA ', 145.15, 123.427, 70.614], ['A', ' HB ', 146.963, 123.974, 69.157], ['A', ' HB ', 145.48, 124.158, 68.236], ['A', ' HG ', 145.636, 126.65, 68.624], ['A', ' HG ', 147.176, 126.378, 69.402]]
[['A', ' N ', 145.586, 126.388, 71.831], ['A', ' CA ', 146.248, 127.135, 72.872], ['A', ' C ', 145.666, 126.844, 74.233], ['A', ' O ', 146.263, 127.179, 75.258], ['A', ' CB ', 146.148, 128.618, 72.616], ['A', ' CG ', 146.903, 129.066, 71.457], ['A', ' CD1', 146.245, 129.446, 70.325], ['A', ' CD2', 148.272, 129.084, 71.513], ['A', ' CE1', 146.959, 129.854, 69.236], ['A', ' CE2', 148.988, 129.485, 70.43], ['A', ' CZ ', 148.34, 129.87, 69.293], ['A', ' OH ', 149.067, 130.279, 68.201], ['A', ' H ', 144.753, 126.787, 71.39], ['A', ' HA ', 147.282, 126.844, 72.883], ['A', ' HB ', 145.1, 128.893, 72.474], ['A', ' HB ', 146.499, 129.13, 73.468], ['A', ' HD1', 145.159, 129.424, 70.289], ['A', ' HD2', 148.782, 128.776, 72.423], ['A', ' HE1', 146.442, 130.157, 68.327], ['A', ' HE2', 150.075, 129.503, 70.462], ['A', ' HH ', 150.006, 130.216, 68.395]]
[['A', ' N ', 144.526, 126.182, 74.266], ['A', ' CA ', 143.836, 125.89, 75.499], ['A', ' C ', 144.789, 125.276, 76.506], ['A', ' O ', 144.854, 125.726, 77.655], ['A', ' H ', 144.121, 125.829, 73.401], ['A', ' HA ', 143.444, 126.82, 75.89], ['A', ' HA ', 142.987, 125.238, 75.312]]
[['A', ' N ', 145.453, 124.169, 76.152], ['A', ' CA ', 146.412, 123.475, 76.964], ['A', ' C ', 147.607, 124.328, 77.388], ['A', ' O ', 148.254, 124.006, 78.376], ['A', ' CB ', 146.841, 122.328, 76.054], ['A', ' CG ', 145.674, 122.114, 75.138], ['A', ' CD ', 145.148, 123.475, 74.881], ['A', ' HA ', 145.901, 123.062, 77.837], ['A', ' HB ', 147.757, 122.611, 75.512], ['A', ' HB ', 147.079, 121.441, 76.657], ['A', ' HG ', 146.0, 121.607, 74.216], ['A', ' HG ', 144.932, 121.461, 75.617], ['A', ' HD ', 145.714, 123.895, 74.044], ['A', ' HD ', 144.074, 123.415, 74.674]]
[['A', ' N ', 147.939, 125.406, 76.667], ['A', ' CA ', 149.065, 126.219, 77.092], ['A', ' C ', 148.61, 127.097, 78.217], ['A', ' O ', 149.369, 127.406, 79.139], ['A', ' CB ', 149.604, 127.125, 75.983], ['A', ' CG ', 150.424, 126.465, 74.943], ['A', ' ND1', 151.679, 125.976, 75.206], ['A', ' CD2', 150.204, 126.233, 73.638], ['A', ' CE1', 152.19, 125.471, 74.105], ['A', ' NE2', 151.314, 125.612, 73.142], ['A', ' H ', 147.417, 125.725, 75.858], ['A', ' HA ', 149.875, 125.587, 77.45], ['A', ' HB ', 148.769, 127.621, 75.486], ['A', ' HB ', 150.205, 127.901, 76.443], ['A', ' HD2', 149.34, 126.482, 73.069], ['A', ' HE1', 153.169, 125.011, 74.007], ['A', ' HE2', 151.431, 125.316, 72.181]]
[['A', ' N ', 147.35, 127.484, 78.156], ['A', ' CA ', 146.82, 128.367, 79.157], ['A', ' C ', 146.685, 127.668, 80.478], ['A', ' O ', 147.157, 128.176, 81.497], ['A', ' CB ', 145.444, 128.876, 78.725], ['A', ' CG1', 144.816, 129.645, 79.785], ['A', ' CG2', 145.546, 129.734, 77.512], ['A', ' H ', 146.775, 127.185, 77.36], ['A', ' HA ', 147.501, 129.184, 79.288], ['A', ' HB ', 144.821, 128.029, 78.508], ['A', ' HG1', 143.87, 129.948, 79.397], ['A', ' HG1', 144.671, 129.05, 80.684], ['A', ' HG1', 145.423, 130.518, 80.023], ['A', ' HG2', 144.55, 130.063, 77.216], ['A', ' HG2', 146.134, 130.583, 77.736], ['A', ' HG2', 145.995, 129.18, 76.702]]
[['A', ' N ', 146.085, 126.487, 80.473], ['A', ' CA ', 145.917, 125.827, 81.751], ['A', ' C ', 147.268, 125.387, 82.292], ['A', ' O ', 147.489, 125.404, 83.497], ['A', ' CB ', 144.905, 124.659, 81.681], ['A', ' CG1', 145.411, 123.551, 80.75], ['A', ' CG2', 143.541, 125.206, 81.184], ['A', ' CD1', 144.636, 122.272, 80.783], ['A', ' H ', 145.723, 126.111, 79.589], ['A', ' HA ', 145.501, 126.549, 82.452], ['A', ' HB ', 144.781, 124.234, 82.681], ['A', ' HG1', 145.382, 123.943, 79.754], ['A', ' HG1', 146.423, 123.28, 80.993], ['A', ' HG2', 142.803, 124.42, 81.161], ['A', ' HG2', 143.205, 125.978, 81.846], ['A', ' HG2', 143.652, 125.625, 80.182], ['A', ' HD1', 145.074, 121.569, 80.075], ['A', ' HD1', 144.695, 121.856, 81.784], ['A', ' HD1', 143.608, 122.434, 80.523]]
[['A', ' N ', 148.197, 125.06, 81.405], ['A', ' CA ', 149.525, 124.658, 81.79], ['A', ' C ', 150.3, 125.806, 82.427], ['A', ' O ', 150.974, 125.613, 83.432], ['A', ' CB ', 150.209, 124.132, 80.568], ['A', ' CG ', 151.511, 123.548, 80.712], ['A', ' CD ', 152.036, 123.214, 79.361], ['A', ' NE ', 151.146, 122.3, 78.634], ['A', ' CZ ', 150.966, 122.287, 77.289], ['A', ' NH1', 151.599, 123.139, 76.515], ['A', ' NH2', 150.142, 121.403, 76.751], ['A', ' H ', 147.981, 125.04, 80.407], ['A', ' HA ', 149.434, 123.857, 82.514], ['A', ' HB ', 149.586, 123.337, 80.195], ['A', ' HB ', 150.258, 124.908, 79.808], ['A', ' HG ', 152.141, 124.275, 81.186], ['A', ' HG ', 151.465, 122.644, 81.312], ['A', ' HD ', 152.142, 124.134, 78.793], ['A', ' HD ', 153.012, 122.727, 79.45], ['A', ' HE ', 150.632, 121.623, 79.174], ['A', ' HH1', 152.239, 123.818, 76.918], ['A', ' HH1', 151.473, 123.108, 75.517], ['A', ' HH2', 149.639, 120.757, 77.34], ['A', ' HH2', 150.012, 121.379, 75.75]]
[['A', ' N ', 150.154, 127.026, 81.902], ['A', ' CA ', 150.843, 128.206, 82.434], ['A', ' C ', 150.504, 128.443, 83.9], ['A', ' O ', 151.366, 128.878, 84.674], ['A', ' CB ', 150.47, 129.431, 81.624], ['A', ' H ', 149.621, 127.136, 81.036], ['A', ' HA ', 151.914, 128.037, 82.354], ['A', ' HB ', 151.002, 130.301, 81.997], ['A', ' HB ', 150.736, 129.259, 80.584], ['A', ' HB ', 149.395, 129.601, 81.701]]
[['A', ' N ', 149.278, 128.114, 84.289], ['A', ' CA ', 148.84, 128.271, 85.669], ['A', ' C ', 149.501, 127.27, 86.603], ['A', ' O ', 149.57, 127.493, 87.816], ['A', ' CB ', 147.337, 128.135, 85.782], ['A', ' CG ', 146.569, 129.321, 85.381], ['A', ' CD1', 145.99, 129.383, 84.153], ['A', ' CD2', 146.414, 130.344, 86.267], ['A', ' CE1', 145.245, 130.473, 83.791], ['A', ' CE2', 145.684, 131.432, 85.921], ['A', ' CZ ', 145.093, 131.507, 84.693], ['A', ' OH ', 144.371, 132.622, 84.346], ['A', ' H ', 148.606, 127.813, 83.57], ['A', ' HA ', 149.12, 129.273, 85.995], ['A', ' HB ', 147.028, 127.32, 85.141], ['A', ' HB ', 147.062, 127.876, 86.804], ['A', ' HD1', 146.112, 128.565, 83.478], ['A', ' HD2', 146.877, 130.292, 87.253], ['A', ' HE1', 144.781, 130.516, 82.808], ['A', ' HE2', 145.572, 132.244, 86.626], ['A', ' HH ', 144.531, 133.348, 84.998]]
[['A', ' N ', 149.973, 126.168, 86.052], ['A', ' CA ', 150.602, 125.065, 86.754], ['A', ' C ', 149.772, 124.526, 87.918], ['A', ' O ', 150.145, 124.725, 89.072], ['A', ' CB ', 151.95, 125.495, 87.297], ['A', ' CG ', 152.951, 124.361, 87.533], ['A', ' OD1', 153.004, 123.414, 86.743], ['A', ' OD2', 153.751, 124.489, 88.43], ['A', ' H ', 149.97, 126.092, 85.035], ['A', ' HA ', 150.77, 124.268, 86.041], ['A', ' HB ', 152.383, 126.199, 86.607], ['A', ' HB ', 151.81, 126.008, 88.237]]
[['A', ' N ', 148.552, 124.054, 87.711], ['A', ' CA ', 147.742, 123.436, 88.725], ['A', ' C ', 148.271, 122.068, 89.079], ['A', ' O ', 148.939, 121.445, 88.267], ['A', ' CB ', 146.409, 123.36, 88.049], ['A', ' CG ', 146.753, 123.3, 86.576], ['A', ' CD ', 147.853, 124.259, 86.452], ['A', ' HA ', 147.702, 124.086, 89.615], ['A', ' HB ', 145.858, 122.539, 88.435], ['A', ' HB ', 145.853, 124.26, 88.316], ['A', ' HG ', 147.102, 122.296, 86.306], ['A', ' HG ', 145.9, 123.525, 85.928], ['A', ' HD ', 148.43, 124.085, 85.588], ['A', ' HD ', 147.416, 125.256, 86.43]]
[['A', ' N ', 147.959, 121.585, 90.273], ['A', ' CA ', 148.344, 120.24, 90.668], ['A', ' C ', 147.335, 119.179, 90.244], ['A', ' O ', 147.684, 118.034, 89.972], ['A', ' CB ', 148.573, 120.253, 92.13], ['A', ' SG ', 150.024, 121.162, 92.556], ['A', ' H ', 147.432, 122.145, 90.94], ['A', ' HA ', 149.294, 120.006, 90.19], ['A', ' HB ', 147.739, 120.701, 92.619], ['A', ' HB ', 148.637, 119.31, 92.486], ['A', ' HG ', 150.137, 120.684, 93.806]]
[['A', ' N ', 146.076, 119.567, 90.199], ['A', ' CA ', 144.946, 118.781, 89.697], ['A', ' C ', 144.767, 117.401, 90.299], ['A', ' O ', 143.859, 117.153, 91.097], ['A', ' CB ', 145.187, 118.616, 88.21], ['A', ' CG ', 145.326, 119.897, 87.458], ['A', ' CD1', 145.766, 119.575, 86.076], ['A', ' CD2', 144.036, 120.719, 87.502], ['A', ' H ', 145.899, 120.511, 90.494], ['A', ' HA ', 144.03, 119.331, 89.886], ['A', ' HB ', 146.099, 118.059, 88.035], ['A', ' HB ', 144.37, 118.038, 87.782], ['A', ' HG ', 146.122, 120.456, 87.893], ['A', ' HD1', 145.942, 120.472, 85.509], ['A', ' HD1', 146.691, 119.009, 86.121], ['A', ' HD1', 145.033, 118.999, 85.609], ['A', ' HD2', 144.213, 121.623, 86.967], ['A', ' HD2', 143.22, 120.184, 87.052], ['A', ' HD2', 143.771, 120.973, 88.512]]
[['A', ' N ', 145.674, 116.494, 89.952], ['A', ' CA ', 145.615, 115.122, 90.486], ['A', ' C ', 145.794, 115.093, 91.987], ['A', ' O ', 145.161, 114.296, 92.692], ['A', ' CB ', 146.721, 114.28, 89.917], ['A', ' OG ', 147.944, 114.716, 90.435], ['A', ' H ', 146.437, 116.784, 89.347], ['A', ' HA ', 144.662, 114.687, 90.245], ['A', ' HB ', 146.546, 113.244, 90.188], ['A', ' HB ', 146.734, 114.341, 88.858], ['A', ' HG ', 148.629, 114.201, 90.001]]
[['A', ' N ', 146.585, 116.052, 92.466], ['A', ' CA ', 146.938, 116.347, 93.8], ['A', ' C ', 146.474, 117.742, 93.935], ['A', ' O ', 147.183, 118.611, 94.441], ['A', ' CB ', 148.44, 116.089, 94.035], ['A', ' SG ', 149.745, 117.04, 93.045], ['A', ' H ', 147.061, 116.592, 91.72], ['A', ' HA ', 146.371, 115.724, 94.498], ['A', ' HB ', 148.58, 116.274, 94.995], ['A', ' HB ', 148.648, 115.023, 93.902]]
[['A', ' N ', 145.254, 117.997, 93.428], ['A', ' CA ', 144.808, 119.338, 93.503], ['A', ' C ', 145.069, 119.716, 94.878], ['A', ' O ', 144.567, 119.135, 95.845], ['A', ' CB ', 143.331, 119.501, 93.185], ['A', ' H ', 144.68, 117.281, 92.98], ['A', ' HA ', 145.413, 119.955, 92.851], ['A', ' HB ', 143.045, 120.54, 93.315], ['A', ' HB ', 143.128, 119.205, 92.171], ['A', ' HB ', 142.751, 118.88, 93.862]]
[['A', ' N ', 145.815, 120.75, 94.97], ['A', ' CA ', 146.169, 121.297, 96.208], ['A', ' C ', 144.94, 122.081, 96.527], ['A', ' O ', 144.927, 123.27, 96.193], ['A', ' CB ', 147.397, 122.179, 96.036], ['A', ' OG1', 147.117, 123.163, 95.003], ['A', ' CG2', 148.553, 121.352, 95.686], ['A', ' H ', 146.197, 121.161, 94.135], ['A', ' HA ', 146.358, 120.515, 96.943], ['A', ' HB ', 147.646, 122.655, 96.914], ['A', ' HG1', 146.34, 123.718, 95.298], ['A', ' HG2', 149.397, 121.984, 95.566], ['A', ' HG2', 148.73, 120.643, 96.473], ['A', ' HG2', 148.354, 120.829, 94.802]]
[['A', ' N ', 143.889, 121.364, 97.052], ['A', ' CA ', 142.487, 121.735, 97.354], ['A', ' C ', 142.158, 123.233, 97.22], ['A', ' O ', 142.44, 123.842, 96.187], ['A', ' OXT', 141.379, 123.775, 97.997], ['A', ' CB ', 142.072, 121.169, 98.769], ['A', ' CG ', 142.089, 119.613, 98.853], ['A', ' ND1', 141.222, 118.823, 98.127], ['A', ' CD2', 142.871, 118.758, 99.563], ['A', ' CE1', 141.478, 117.548, 98.386], ['A', ' NE2', 142.472, 117.485, 99.255], ['A', ' H ', 144.122, 120.38, 97.205], ['A', ' HA ', 141.858, 121.237, 96.623], ['A', ' HB ', 142.734, 121.579, 99.544], ['A', ' HB ', 141.056, 121.498, 99.029], ['A', ' HD2', 143.666, 119.031, 100.247], ['A', ' HE1', 140.956, 116.694, 97.954], ['A', ' HE2', 142.876, 116.647, 99.627]]
[['A', ' N ', 127.544, 122.825, 67.273], ['A', ' CA ', 128.994, 123.016, 67.42], ['A', ' C ', 129.617, 121.873, 68.259], ['A', ' O ', 129.011, 121.45, 69.25], ['A', ' CB ', 129.267, 124.383, 68.057], ['A', ' OG ', 128.845, 125.399, 67.21], ['A', ' H ', 127.098, 123.727, 67.158], ['A', ' H ', 127.352, 122.249, 66.465], ['A', ' H ', 127.181, 122.372, 68.105], ['A', ' HA ', 129.436, 123.02, 66.413], ['A', ' HB ', 128.761, 124.484, 69.023], ['A', ' HB ', 130.323, 124.508, 68.246], ['A', ' HG ', 129.091, 126.253, 67.664]] AA_SCO= 1.807 CA_SCO= 1.7503
[['A', ' N ', 130.795, 121.37, 67.827], ['A', ' CA ', 131.571, 120.307, 68.471], ['A', ' C ', 132.375, 120.817, 69.654], ['A', ' O ', 132.625, 122.024, 69.788], ['A', ' CB ', 132.495, 119.604, 67.466], ['A', ' CG ', 133.727, 120.383, 66.989], ['A', ' CD ', 133.436, 121.33, 65.849], ['A', ' OE1', 132.292, 121.71, 65.676], ['A', ' OE2', 134.352, 121.649, 65.132], ['A', ' H ', 131.204, 121.768, 66.976], ['A', ' HA ', 130.883, 119.548, 68.851], ['A', ' HB ', 132.854, 118.674, 67.906], ['A', ' HB ', 131.918, 119.338, 66.581], ['A', ' HG ', 134.15, 120.949, 67.817], ['A', ' HG ', 134.48, 119.667, 66.669]] AA_SCO= 1.8790909090909091 CA_SCO= 1.7658181818181817
[['A', ' N ', 132.733, 119.889, 70.531], ['A', ' CA ', 133.551, 120.243, 71.657], ['A', ' C ', 134.856, 119.518, 71.576], ['A', ' O ', 134.924, 118.36, 71.162], ['A', ' CB ', 132.883, 119.874, 72.966], ['A', ' CG ', 131.593, 120.562, 73.174], ['A', ' CD ', 131.104, 120.476, 74.566], ['A', ' NE ', 130.777, 119.116, 74.963], ['A', ' CZ ', 130.241, 118.767, 76.159], ['A', ' NH1', 129.967, 119.68, 77.076], ['A', ' NH2', 129.97, 117.5, 76.41], ['A', ' H ', 132.468, 118.925, 70.383], ['A', ' HA ', 133.743, 121.312, 71.635], ['A', ' HB ', 132.72, 118.8, 73.009], ['A', ' HB ', 133.542, 120.143, 73.796], ['A', ' HG ', 131.708, 121.592, 72.881], ['A', ' HG ', 130.844, 120.101, 72.533], ['A', ' HD ', 131.871, 120.858, 75.233], ['A', ' HD ', 130.206, 121.089, 74.66], ['A', ' HE ', 130.955, 118.376, 74.297], ['A', ' HH1', 130.155, 120.654, 76.907], ['A', ' HH1', 129.514, 119.399, 77.971], ['A', ' HH2', 130.164, 116.792, 75.719], ['A', ' HH2', 129.553, 117.24, 77.303]] AA_SCO= 1.9341666666666668 CA_SCO= 1.779
[['A', ' N ', 135.881, 120.19, 72.019], ['A', ' CA ', 137.185, 119.614, 72.084], ['A', ' C ', 137.364, 119.197, 73.511], ['A', ' O ', 137.375, 120.035, 74.413], ['A', ' CB ', 138.248, 120.66, 71.717], ['A', ' CG1', 137.916, 121.32, 70.348], ['A', ' CG2', 139.654, 120.052, 71.752], ['A', ' CD1', 137.797, 120.398, 69.16], ['A', ' H ', 135.723, 121.146, 72.33], ['A', ' HA ', 137.251, 118.736, 71.445], ['A', ' HB ', 138.204, 121.449, 72.441], ['A', ' HG1', 136.976, 121.855, 70.45], ['A', ' HG1', 138.69, 122.039, 70.13], ['A', ' HG2', 140.387, 120.824, 71.522], ['A', ' HG2', 139.857, 119.655, 72.745], ['A', ' HG2', 139.738, 119.251, 71.026], ['A', ' HD1', 137.565, 120.99, 68.275], ['A', ' HD1', 138.734, 119.872, 68.998], ['A', ' HD1', 136.997, 119.678, 69.322]] AA_SCO= 1.8053846153846156 CA_SCO= 1.5698461538461537
[['A', ' N ', 137.46, 117.908, 73.743], ['A', ' CA ', 137.566, 117.456, 75.108], ['A', ' C ', 138.841, 116.702, 75.312], ['A', ' O ', 139.079, 115.675, 74.676], ['A', ' CB ', 136.363, 116.589, 75.468], ['A', ' CG1', 136.505, 116.092, 76.898], ['A', ' CG2', 135.096, 117.431, 75.291], ['A', ' H ', 137.453, 117.251, 72.972], ['A', ' HA ', 137.574, 118.315, 75.773], ['A', ' HB ', 136.32, 115.719, 74.816], ['A', ' HG1', 135.644, 115.482, 77.165], ['A', ' HG1', 137.405, 115.491, 77.011], ['A', ' HG1', 136.562, 116.937, 77.572], ['A', ' HG2', 134.222, 116.839, 75.548], ['A', ' HG2', 135.164, 118.282, 75.941], ['A', ' HG2', 135.009, 117.767, 74.261]] AA_SCO= 1.8585714285714288 CA_SCO= 1.2844999999999998
[['A', ' N ', 139.65, 117.202, 76.219], ['A', ' CA ', 140.914, 116.571, 76.476], ['A', ' C ', 140.932, 116.02, 77.896], ['A', ' O ', 141.005, 116.783, 78.859], ['A', ' CB ', 142.036, 117.603, 76.288], ['A', ' CG1', 141.951, 118.21, 74.854], ['A', ' CG2', 143.374, 116.905, 76.485], ['A', ' CD1', 142.826, 119.429, 74.617], ['A', ' H ', 139.36, 118.057, 76.706], ['A', ' HA ', 141.059, 115.748, 75.781], ['A', ' HB ', 141.925, 118.407, 77.01], ['A', ' HG1', 142.222, 117.439, 74.134], ['A', ' HG1', 140.931, 118.516, 74.661], ['A', ' HG2', 144.195, 117.599, 76.371], ['A', ' HG2', 143.407, 116.494, 77.466], ['A', ' HG2', 143.482, 116.103, 75.756], ['A', ' HD1', 142.685, 119.783, 73.592], ['A', ' HD1', 142.539, 120.219, 75.311], ['A', ' HD1', 143.871, 119.184, 74.763]] AA_SCO= 1.9393333333333336 CA_SCO= 1.3127999999999997
[['A', ' N ', 140.85, 114.693, 78.0], ['A', ' CA ', 140.862, 113.947, 79.265], ['A', ' C ', 142.196, 114.029, 80.048], ['A', ' O ', 142.173, 114.069, 81.275], ['A', ' CB ', 140.426, 112.512, 79.035], ['A', ' OG ', 140.479, 111.778, 80.218], ['A', ' H ', 140.768, 114.171, 77.138], ['A', ' HA ', 140.098, 114.392, 79.905], ['A', ' HB ', 139.396, 112.525, 78.679], ['A', ' HB ', 141.003, 112.027, 78.274], ['A', ' HG ', 140.159, 110.905, 80.001]] AA_SCO= 1.885625 CA_SCO= 1.3483749999999999
[['A', ' N ', 143.373, 113.834, 79.412], ['A', ' CA ', 144.68, 113.981, 80.009], ['A', ' C ', 144.985, 115.456, 80.201], ['A', ' O ', 144.4, 116.3, 79.542], ['A', ' CB ', 145.575, 113.3, 78.998], ['A', ' CG ', 144.863, 113.435, 77.719], ['A', ' CD ', 143.447, 113.346, 78.018], ['A', ' HA ', 144.698, 113.457, 80.976], ['A', ' HB ', 146.543, 113.808, 78.971], ['A', ' HB ', 145.752, 112.253, 79.286], ['A', ' HG ', 145.132, 114.371, 77.219], ['A', ' HG ', 145.133, 112.623, 77.075], ['A', ' HD ', 143.022, 113.986, 77.283], ['A', ' HD ', 143.137, 112.308, 77.926]] AA_SCO= 1.8947058823529412 CA_SCO= 1.384470588235294
[['A', ' N ', 145.943, 115.772, 81.051], ['A', ' CA ', 146.312, 117.158, 81.303], ['A', ' C ', 147.663, 117.529, 80.738], ['A', ' O ', 148.175, 118.611, 81.025], ['A', ' CB ', 146.396, 117.406, 82.801], ['A', ' OG1', 147.417, 116.598, 83.36], ['A', ' CG2', 145.152, 116.996, 83.393], ['A', ' H ', 146.423, 115.06, 81.582], ['A', ' HA ', 145.557, 117.81, 80.862], ['A', ' HB ', 146.583, 118.454, 83.014], ['A', ' HG1', 147.573, 116.88, 84.281], ['A', ' HG2', 145.202, 117.138, 84.456], ['A', ' HG2', 144.364, 117.601, 82.962], ['A', ' HG2', 144.959, 115.952, 83.193]] AA_SCO= 1.9283333333333335 CA_SCO= 1.416722222222222
[['A', ' N ', 148.246, 116.635, 79.955], ['A', ' CA ', 149.615, 116.788, 79.482], ['A', ' C ', 150.556, 116.818, 80.658], ['A', ' O ', 150.334, 116.137, 81.66], ['A', ' CB ', 149.801, 118.052, 78.662], ['A', ' OG ', 151.104, 118.118, 78.149], ['A', ' H ', 147.721, 115.808, 79.72], ['A', ' HA ', 149.869, 115.932, 78.854], ['A', ' HB ', 149.089, 118.043, 77.838], ['A', ' HB ', 149.614, 118.941, 79.239], ['A', ' HG ', 151.024, 118.578, 77.29]] AA_SCO= 1.9552631578947368 CA_SCO= 1.4458421052631578
[['A', ' N ', 151.6, 117.621, 80.572], ['A', ' CA ', 152.624, 117.619, 81.606], ['A', ' C ', 152.262, 118.553, 82.748], ['A', ' O ', 152.908, 119.578, 82.973], ['A', ' CB ', 153.928, 117.992, 80.956], ['A', ' CG ', 154.36, 116.971, 79.923], ['A', ' CD ', 155.688, 117.247, 79.413], ['A', ' NE ', 155.722, 118.528, 78.822], ['A', ' CZ ', 155.387, 118.859, 77.566], ['A', ' NH1', 155.016, 117.971, 76.697], ['A', ' NH2', 155.428, 120.107, 77.222], ['A', ' H ', 151.702, 118.18, 79.732], ['A', ' HA ', 152.717, 116.611, 82.004], ['A', ' HB ', 153.836, 118.963, 80.473], ['A', ' HB ', 154.712, 118.062, 81.677], ['A', ' HG ', 154.358, 115.99, 80.389], ['A', ' HG ', 153.658, 116.968, 79.09], ['A', ' HD ', 156.41, 117.228, 80.235], ['A', ' HD ', 155.961, 116.518, 78.668], ['A', ' HE ', 156.006, 119.281, 79.435], ['A', ' HH1', 154.982, 117.009, 76.958], ['A', ' HH1', 154.743, 118.278, 75.768], ['A', ' HH2', 155.698, 120.814, 77.9], ['A', ' HH2', 155.157, 120.418, 76.272]] AA_SCO= 2.1384210526315792 CA_SCO= 1.4946315789473683
[['A', ' N ', 151.197, 118.158, 83.447], ['A', ' CA ', 150.547, 118.839, 84.57], ['A', ' C ', 150.035, 117.86, 85.59], ['A', ' O ', 148.861, 117.865, 85.952], ['A', ' CB ', 149.406, 119.708, 84.054], ['A', ' CG ', 149.87, 120.838, 83.225], ['A', ' CD ', 150.521, 121.806, 84.124], ['A', ' OE1', 149.79, 122.511, 84.748], ['A', ' NE2', 151.827, 121.811, 84.267], ['A', ' H ', 150.784, 117.282, 83.105], ['A', ' HA ', 151.282, 119.447, 85.084], ['A', ' HB ', 148.751, 119.106, 83.452], ['A', ' HB ', 148.832, 120.106, 84.89], ['A', ' HG ', 150.544, 120.537, 82.446], ['A', ' HG ', 148.997, 121.315, 82.782], ['A', ' HE2', 152.274, 122.442, 84.965], ['A', ' HE2', 152.378, 121.123, 83.75]] AA_SCO= 2.208421052631579 CA_SCO= 1.4921052631578944
[['A', ' N ', 150.915, 116.979, 86.015], ['A', ' CA ', 150.662, 115.918, 86.99], ['A', ' C ', 149.69, 114.881, 86.431], ['A', ' O ', 150.085, 113.757, 86.111], ['A', ' CB ', 150.112, 116.465, 88.311], ['A', ' CG ', 151.026, 117.444, 88.993], ['A', ' CD ', 152.363, 116.899, 89.224], ['A', ' OE1', 152.484, 115.725, 89.473], ['A', ' OE2', 153.295, 117.653, 89.103], ['A', ' H ', 151.854, 117.052, 85.648], ['A', ' HA ', 151.602, 115.41, 87.198], ['A', ' HB ', 149.145, 116.933, 88.181], ['A', ' HB ', 149.967, 115.636, 88.999], ['A', ' HG ', 151.103, 118.34, 88.38], ['A', ' HG ', 150.58, 117.73, 89.948]] AA_SCO= 2.150526315789474 CA_SCO= 1.4942631578947367
[['A', ' N ', 148.427, 115.285, 86.275], ['A', ' CA ', 147.379, 114.443, 85.72], ['A', ' C ', 145.977, 114.727, 86.251], ['A', ' O ', 145.758, 115.631, 87.048], ['A', ' H ', 148.224, 116.242, 86.548], ['A', ' HA ', 147.382, 114.537, 84.637], ['A', ' HA ', 147.63, 113.405, 85.921]] AA_SCO= 2.104736842105263 CA_SCO= 1.492315789473684
[['A', ' N ', 145.039, 113.91, 85.794], ['A', ' CA ', 143.634, 113.913, 86.194], ['A', ' C ', 142.751, 115.152, 86.093], ['A', ' O ', 142.112, 115.524, 87.082], ['A', ' CB ', 143.538, 113.45, 87.62], ['A', ' CG ', 144.132, 112.125, 87.879], ['A', ' ND1', 144.247, 111.617, 89.143], ['A', ' CD2', 144.642, 111.181, 87.052], ['A', ' CE1', 144.793, 110.433, 89.088], ['A', ' NE2', 145.044, 110.149, 87.834], ['A', ' H ', 145.328, 113.212, 85.125], ['A', ' HA ', 143.131, 113.162, 85.585], ['A', ' HB ', 143.983, 114.178, 88.256], ['A', ' HB ', 142.5, 113.389, 87.878], ['A', ' HD2', 144.722, 111.214, 85.97], ['A', ' HE1', 145.003, 109.802, 89.937], ['A', ' HE2', 145.479, 109.276, 87.506]] AA_SCO= 2.078947368421052 CA_SCO= 1.4473684210526316
[['A', ' N ', 142.695, 115.797, 84.955], ['A', ' CA ', 141.767, 116.909, 84.801], ['A', ' C ', 141.348, 116.987, 83.38], ['A', ' O ', 142.086, 116.62, 82.48], ['A', ' CB ', 142.336, 118.217, 85.249], ['A', ' H ', 143.255, 115.486, 84.172], ['A', ' HA ', 140.883, 116.695, 85.386], ['A', ' HB ', 141.588, 118.999, 85.125], ['A', ' HB ', 142.609, 118.136, 86.286], ['A', ' HB ', 143.177, 118.46, 84.668]] AA_SCO= 2.0352631578947364 CA_SCO= 1.3527894736842105
[['A', ' N ', 140.167, 117.495, 83.173], ['A', ' CA ', 139.634, 117.569, 81.845], ['A', ' C ', 139.301, 118.965, 81.388], ['A', ' O ', 138.692, 119.769, 82.102], ['A', ' CB ', 138.402, 116.68, 81.776], ['A', ' CG ', 137.705, 116.641, 80.445], ['A', ' CD ', 136.531, 115.722, 80.445], ['A', ' OE1', 136.629, 114.658, 80.996], ['A', ' OE2', 135.512, 116.096, 79.919], ['A', ' H ', 139.627, 117.83, 83.974], ['A', ' HA ', 140.379, 117.167, 81.161], ['A', ' HB ', 138.69, 115.659, 82.023], ['A', ' HB ', 137.704, 117.0, 82.525], ['A', ' HG ', 137.364, 117.633, 80.191], ['A', ' HG ', 138.413, 116.326, 79.68]] AA_SCO= 2.0721052631578947 CA_SCO= 1.3494736842105264
[['A', ' N ', 139.777, 119.268, 80.192], ['A', ' CA ', 139.517, 120.553, 79.569], ['A', ' C ', 138.471, 120.419, 78.485], ['A', ' O ', 138.634, 119.655, 77.53], ['A', ' CB ', 140.831, 121.148, 79.015], ['A', ' CG ', 140.731, 122.484, 78.229], ['A', ' CD1', 140.214, 123.609, 79.126], ['A', ' CD2', 142.129, 122.871, 77.676], ['A', ' H ', 140.314, 118.536, 79.705], ['A', ' HA ', 139.102, 121.219, 80.316], ['A', ' HB ', 141.52, 121.293, 79.834], ['A', ' HB ', 141.27, 120.413, 78.342], ['A', ' HG ', 140.044, 122.354, 77.413], ['A', ' HD1', 140.145, 124.528, 78.548], ['A', ' HD1', 139.227, 123.369, 79.508], ['A', ' HD1', 140.891, 123.759, 79.957], ['A', ' HD2', 142.05, 123.795, 77.116], ['A', ' HD2', 142.826, 123.015, 78.487], ['A', ' HD2', 142.501, 122.086, 77.022]] AA_SCO= 2.028421052631579 CA_SCO= 1.326263157894737
[['A', ' N ', 137.371, 121.143, 78.645], ['A', ' CA ', 136.274, 121.09, 77.698], ['A', ' C ', 136.099, 122.419, 76.999], ['A', ' O ', 135.774, 123.439, 77.62], ['A', ' CB ', 134.969, 120.743, 78.435], ['A', ' CG1', 133.779, 120.716, 77.467], ['A', ' CG2', 135.14, 119.415, 79.108], ['A', ' H ', 137.294, 121.764, 79.457], ['A', ' HA ', 136.487, 120.328, 76.947], ['A', ' HB ', 134.769, 121.508, 79.189], ['A', ' HG1', 132.872, 120.473, 78.019], ['A', ' HG1', 133.657, 121.693, 76.997], ['A', ' HG1', 133.938, 119.973, 76.702], ['A', ' HG2', 134.238, 119.152, 79.648], ['A', ' HG2', 135.34, 118.658, 78.369], ['A', ' HG2', 135.969, 119.46, 79.803]] AA_SCO= 2.058421052631579 CA_SCO= 1.3346315789473682
[['A', ' N ', 136.269, 122.419, 75.689], ['A', ' CA ', 136.142, 123.663, 74.964], ['A', ' C ', 135.119, 123.6, 73.854], ['A', ' O ', 135.12, 122.698, 73.018], ['A', ' CB ', 137.494, 124.016, 74.4], ['A', ' CG ', 138.545, 124.248, 75.448], ['A', ' SD ', 140.177, 124.512, 74.77], ['A', ' CE ', 140.687, 122.861, 74.289], ['A', ' H ', 136.556, 121.554, 75.218], ['A', ' HA ', 135.822, 124.447, 75.649], ['A', ' HB ', 137.82, 123.228, 73.757], ['A', ' HB ', 137.397, 124.889, 73.811], ['A', ' HG ', 138.266, 125.107, 76.053], ['A', ' HG ', 138.585, 123.39, 76.092], ['A', ' HE ', 141.689, 122.901, 73.852], ['A', ' HE ', 140.697, 122.206, 75.152], ['A', ' HE ', 140.005, 122.461, 73.559]] AA_SCO= 2.027894736842106 CA_SCO= 1.3367894736842103
[['A', ' N ', 134.278, 124.604, 73.798], ['A', ' CA ', 133.272, 124.684, 72.762], ['A', ' C ', 133.793, 125.602, 71.686], ['A', ' O ', 134.034, 126.793, 71.94], ['A', ' CB ', 131.959, 125.218, 73.321], ['A', ' CG ', 131.364, 124.362, 74.423], ['A', ' CD ', 130.011, 124.808, 74.884], ['A', ' OE1', 129.484, 125.744, 74.336], ['A', ' OE2', 129.503, 124.211, 75.803], ['A', ' H ', 134.322, 125.327, 74.517], ['A', ' HA ', 133.107, 123.698, 72.327], ['A', ' HB ', 132.123, 126.213, 73.701], ['A', ' HB ', 131.227, 125.292, 72.516], ['A', ' HG ', 131.291, 123.365, 74.079], ['A', ' HG ', 132.05, 124.373, 75.272]] AA_SCO= 1.9989473684210528 CA_SCO= 1.3236315789473683
[['A', ' N ', 133.925, 125.065, 70.48], ['A', ' CA ', 134.47, 125.833, 69.371], ['A', ' C ', 133.393, 126.071, 68.33], ['A', ' O ', 132.605, 125.179, 68.039], ['A', ' CB ', 135.687, 125.109, 68.757], ['A', ' CG1', 136.814, 125.063, 69.766], ['A', ' CG2', 135.32, 123.674, 68.345], ['A', ' H ', 133.632, 124.088, 70.339], ['A', ' HA ', 134.798, 126.799, 69.743], ['A', ' HB ', 136.032, 125.67, 67.882], ['A', ' HG1', 137.67, 124.568, 69.317], ['A', ' HG1', 137.086, 126.067, 70.032], ['A', ' HG1', 136.499, 124.515, 70.657], ['A', ' HG2', 136.191, 123.189, 67.913], ['A', ' HG2', 134.989, 123.104, 69.211], ['A', ' HG2', 134.521, 123.681, 67.601]] AA_SCO= 1.942105263157895 CA_SCO= 1.2942105263157895
[['A', ' N ', 133.327, 127.292, 67.81], ['A', ' CA ', 132.289, 127.626, 66.824], ['A', ' C ', 132.829, 127.912, 65.431], ['A', ' O ', 133.462, 128.948, 65.21], ['A', ' CB ', 131.448, 128.84, 67.258], ['A', ' CG ', 130.488, 128.62, 68.481], ['A', ' OD1', 129.742, 127.656, 68.504], ['A', ' OD2', 130.476, 129.474, 69.352], ['A', ' H ', 134.064, 127.95, 68.088], ['A', ' HA ', 131.616, 126.773, 66.741], ['A', ' HB ', 132.12, 129.662, 67.495], ['A', ' HB ', 130.842, 129.163, 66.409]] AA_SCO= 2.067894736842105 CA_SCO= 1.4472105263157893
[['A', ' N ', 132.578, 126.991, 64.486], ['A', ' CA ', 133.016, 127.036, 63.069], ['A', ' C ', 134.529, 126.967, 62.877], ['A', ' O ', 135.053, 126.077, 62.207], ['A', ' CB ', 132.469, 128.276, 62.366], ['A', ' CG ', 130.966, 128.22, 62.196], ['A', ' OD1', 130.396, 127.16, 62.358], ['A', ' OD2', 130.393, 129.238, 61.901], ['A', ' H ', 132.029, 126.187, 64.762], ['A', ' HA ', 132.589, 126.167, 62.568], ['A', ' HB ', 132.733, 129.179, 62.906], ['A', ' HB ', 132.928, 128.354, 61.379]] AA_SCO= 2.106315789473684 CA_SCO= 1.6534736842105262
[['A', ' N ', 135.204, 127.924, 63.471], ['A', ' CA ', 136.633, 128.061, 63.509], ['A', ' C ', 137.096, 127.209, 64.658], ['A', ' O ', 136.29, 126.565, 65.322], ['A', ' CB ', 137.036, 129.519, 63.736], ['A', ' CG ', 136.683, 130.439, 62.603], ['A', ' CD ', 137.477, 130.138, 61.387], ['A', ' OE1', 138.62, 129.775, 61.53], ['A', ' OE2', 136.952, 130.26, 60.311], ['A', ' H ', 134.658, 128.608, 63.98], ['A', ' HA ', 137.069, 127.689, 62.58], ['A', ' HB ', 136.534, 129.892, 64.631], ['A', ' HB ', 138.107, 129.59, 63.909], ['A', ' HG ', 135.623, 130.327, 62.373], ['A', ' HG ', 136.859, 131.47, 62.908]] AA_SCO= 2.117368421052632 CA_SCO= 1.6644736842105259
[['A', ' N ', 138.392, 127.16, 64.895], ['A', ' CA ', 138.888, 126.355, 65.998], ['A', ' C ', 138.883, 127.165, 67.286], ['A', ' O ', 139.371, 126.711, 68.316], ['A', ' H ', 139.037, 127.68, 64.311], ['A', ' HA ', 138.258, 125.472, 66.117], ['A', ' HA ', 139.887, 126.002, 65.778]] AA_SCO= 2.1231578947368424 CA_SCO= 1.6669999999999998
[['A', ' N ', 138.351, 128.376, 67.208], ['A', ' CA ', 138.3, 129.32, 68.299], ['A', ' C ', 137.274, 128.919, 69.312], ['A', ' O ', 136.106, 128.661, 68.992], ['A', ' CB ', 138.011, 130.716, 67.761], ['A', ' CG1', 139.186, 131.117, 66.845], ['A', ' CG2', 137.853, 131.702, 68.936], ['A', ' CD1', 138.941, 132.333, 66.001], ['A', ' H ', 137.96, 128.655, 66.322], ['A', ' HA ', 139.247, 129.346, 68.804], ['A', ' HB ', 137.102, 130.705, 67.16], ['A', ' HG1', 140.059, 131.304, 67.469], ['A', ' HG1', 139.413, 130.293, 66.176], ['A', ' HG2', 137.665, 132.702, 68.57], ['A', ' HG2', 137.022, 131.414, 69.577], ['A', ' HG2', 138.766, 131.7, 69.515], ['A', ' HD1', 139.824, 132.529, 65.393], ['A', ' HD1', 138.086, 132.158, 65.346], ['A', ' HD1', 138.744, 133.197, 66.624]] AA_SCO= 2.1347368421052626 CA_SCO= 1.6631052631578946
[['A', ' N ', 137.732, 128.899, 70.551], ['A', ' CA ', 136.928, 128.545, 71.69], ['A', ' C ', 136.091, 129.726, 72.069], ['A', ' O ', 136.604, 130.821, 72.284], ['A', ' CB ', 137.842, 128.181, 72.862], ['A', ' CG1', 137.032, 127.86, 74.116], ['A', ' CG2', 138.708, 127.053, 72.451], ['A', ' H ', 138.719, 129.136, 70.697], ['A', ' HA ', 136.281, 127.71, 71.439], ['A', ' HB ', 138.479, 129.035, 73.096], ['A', ' HG1', 137.708, 127.616, 74.933], ['A', ' HG1', 136.427, 128.71, 74.408], ['A', ' HG1', 136.378, 127.011, 73.921], ['A', ' HG2', 139.377, 126.82, 73.262], ['A', ' HG2', 138.105, 126.199, 72.208], ['A', ' HG2', 139.288, 127.337, 71.58]] AA_SCO= 2.1221052631578945 CA_SCO= 1.6621578947368416
[['A', ' N ', 134.802, 129.524, 72.176], ['A', ' CA ', 133.941, 130.626, 72.544], ['A', ' C ', 133.454, 130.439, 73.956], ['A', ' O ', 133.094, 131.401, 74.63], ['A', ' CB ', 132.784, 130.749, 71.559], ['A', ' OG1', 132.024, 129.537, 71.575], ['A', ' CG2', 133.356, 130.986, 70.16], ['A', ' H ', 134.421, 128.592, 71.992], ['A', ' HA ', 134.51, 131.552, 72.508], ['A', ' HB ', 132.142, 131.58, 71.842], ['A', ' HG1', 131.281, 129.603, 70.917], ['A', ' HG2', 132.536, 131.073, 69.452], ['A', ' HG2', 133.94, 131.903, 70.157], ['A', ' HG2', 133.992, 130.151, 69.871]] AA_SCO= 2.167894736842105 CA_SCO= 1.6557894736842103
[['A', ' N ', 133.496, 129.2, 74.414], ['A', ' CA ', 133.125, 128.873, 75.78], ['A', ' C ', 133.994, 127.742, 76.294], ['A', ' O ', 134.317, 126.829, 75.537], ['A', ' CB ', 131.649, 128.495, 75.87], ['A', ' CG ', 131.133, 128.183, 77.271], ['A', ' CD ', 129.645, 127.901, 77.225], ['A', ' CE ', 129.082, 127.536, 78.584], ['A', ' NZ ', 127.632, 127.205, 78.499], ['A', ' H ', 133.735, 128.458, 73.751], ['A', ' HA ', 133.286, 129.743, 76.405], ['A', ' HB ', 131.049, 129.308, 75.466], ['A', ' HB ', 131.456, 127.627, 75.264], ['A', ' HG ', 131.624, 127.291, 77.66], ['A', ' HG ', 131.337, 129.021, 77.939], ['A', ' HD ', 129.122, 128.78, 76.849], ['A', ' HD ', 129.457, 127.076, 76.544], ['A', ' HE ', 129.618, 126.673, 78.981], ['A', ' HE ', 129.213, 128.377, 79.264], ['A', ' HZ ', 127.268, 126.956, 79.429], ['A', ' HZ ', 127.117, 127.984, 78.148], ['A', ' HZ ', 127.484, 126.41, 77.896]] AA_SCO= 2.100526315789474 CA_SCO= 1.65578947368421
[['A', ' N ', 134.3, 127.725, 77.581], ['A', ' CA ', 134.978, 126.537, 78.085], ['A', ' C ', 134.98, 126.39, 79.598], ['A', ' O ', 134.708, 127.32, 80.368], ['A', ' H ', 134.11, 128.551, 78.161], ['A', ' HA ', 134.507, 125.655, 77.652], ['A', ' HA ', 136.008, 126.538, 77.728]] AA_SCO= 2.115263157894737 CA_SCO= 1.6588947368421052
[['A', ' N ', 135.281, 125.166, 80.008], ['A', ' CA ', 135.342, 124.762, 81.398], ['A', ' C ', 136.482, 123.814, 81.665], ['A', ' O ', 136.899, 123.039, 80.805], ['A', ' CB ', 134.051, 124.099, 81.864], ['A', ' CG ', 132.775, 124.976, 81.922], ['A', ' CD ', 132.871, 126.0, 83.037], ['A', ' NE ', 131.651, 126.77, 83.236], ['A', ' CZ ', 131.307, 127.879, 82.55], ['A', ' NH1', 132.071, 128.352, 81.57], ['A', ' NH2', 130.185, 128.504, 82.873], ['A', ' H ', 135.483, 124.473, 79.277], ['A', ' HA ', 135.503, 125.651, 82.0], ['A', ' HB ', 133.827, 123.273, 81.191], ['A', ' HB ', 134.205, 123.668, 82.849], ['A', ' HG ', 132.642, 125.497, 80.98], ['A', ' HG ', 131.906, 124.347, 82.104], ['A', ' HD ', 133.101, 125.511, 83.963], ['A', ' HD ', 133.666, 126.701, 82.817], ['A', ' HE ', 131.02, 126.477, 84.02], ['A', ' HH1', 132.959, 127.89, 81.294], ['A', ' HH1', 131.799, 129.188, 81.076], ['A', ' HH2', 129.608, 128.141, 83.626], ['A', ' HH2', 129.906, 129.338, 82.384]] AA_SCO= 2.173684210526316 CA_SCO= 1.6602105263157894
[['A', ' N ', 136.98, 123.863, 82.874], ['A', ' CA ', 138.054, 122.993, 83.266], ['A', ' C ', 137.759, 122.492, 84.644], ['A', ' O ', 137.262, 123.24, 85.488], ['A', ' CB ', 139.358, 123.756, 83.2], ['A', ' CG ', 140.523, 123.009, 83.539], ['A', ' CD1', 140.977, 122.118, 82.66], ['A', ' CD2', 141.167, 123.225, 84.677], ['A', ' CE1', 142.068, 121.418, 82.892], ['A', ' CE2', 142.287, 122.528, 84.922], ['A', ' CZ ', 142.734, 121.627, 84.02], ['A', ' OH ', 143.854, 120.942, 84.232], ['A', ' H ', 136.606, 124.511, 83.554], ['A', ' HA ', 138.092, 122.133, 82.599], ['A', ' HB ', 139.498, 124.114, 82.19], ['A', ' HB ', 139.308, 124.621, 83.86], ['A', ' HD1', 140.446, 121.976, 81.761], ['A', ' HD2', 140.798, 123.962, 85.387], ['A', ' HE1', 142.421, 120.693, 82.161], ['A', ' HE2', 142.819, 122.701, 85.827], ['A', ' HH ', 144.236, 121.216, 85.063]] AA_SCO= 2.236842105263158 CA_SCO= 1.6782105263157892
[['A', ' N ', 137.974, 121.211, 84.854], ['A', ' CA ', 137.724, 120.629, 86.153], ['A', ' C ', 138.592, 119.429, 86.416], ['A', ' O ', 139.048, 118.774, 85.479], ['A', ' CB ', 136.257, 120.271, 86.213], ['A', ' CG ', 135.854, 119.308, 85.159], ['A', ' CD1', 135.748, 117.964, 85.408], ['A', ' CD2', 135.593, 119.759, 83.874], ['A', ' CE1', 135.36, 117.107, 84.413], ['A', ' CE2', 135.234, 118.898, 82.901], ['A', ' CZ ', 135.106, 117.573, 83.17], ['A', ' H ', 138.307, 120.622, 84.08], ['A', ' HA ', 137.935, 121.37, 86.912], ['A', ' HB ', 136.036, 119.83, 87.178], ['A', ' HB ', 135.649, 121.164, 86.114], ['A', ' HD1', 135.961, 117.582, 86.397], ['A', ' HD2', 135.668, 120.818, 83.639], ['A', ' HE1', 135.257, 116.048, 84.608], ['A', ' HE2', 135.034, 119.265, 81.907], ['A', ' HZ ', 134.802, 116.884, 82.377]] AA_SCO= 2.246842105263158 CA_SCO= 1.7242105263157894
[['A', ' N ', 138.793, 119.097, 87.689], ['A', ' CA ', 139.557, 117.906, 87.994], ['A', ' C ', 138.678, 116.687, 87.925], ['A', ' O ', 137.479, 116.758, 88.216], ['A', ' CB ', 140.187, 118.016, 89.356], ['A', ' OG ', 139.214, 118.036, 90.355], ['A', ' H ', 138.418, 119.659, 88.442], ['A', ' HA ', 140.352, 117.802, 87.268], ['A', ' HB ', 140.866, 117.176, 89.513], ['A', ' HB ', 140.785, 118.926, 89.408], ['A', ' HG ', 139.703, 118.114, 91.182]] AA_SCO= 2.305263157894737 CA_SCO= 1.8202631578947368
[['A', ' N ', 139.286, 115.544, 87.617], ['A', ' CA ', 138.582, 114.267, 87.609], ['A', ' C ', 139.297, 113.27, 88.499], ['A', ' O ', 139.099, 112.065, 88.376], ['A', ' CB ', 138.421, 113.711, 86.181], ['A', ' CG1', 139.785, 113.488, 85.528], ['A', ' CG2', 137.592, 114.699, 85.375], ['A', ' CD1', 139.776, 112.716, 84.222], ['A', ' H ', 140.285, 115.559, 87.393], ['A', ' HA ', 137.584, 114.419, 88.021], ['A', ' HB ', 137.903, 112.751, 86.222], ['A', ' HG1', 140.21, 114.443, 85.325], ['A', ' HG1', 140.425, 112.949, 86.221], ['A', ' HG2', 137.421, 114.336, 84.364], ['A', ' HG2', 136.637, 114.818, 85.879], ['A', ' HG2', 138.098, 115.664, 85.321], ['A', ' HD1', 140.8, 112.628, 83.848], ['A', ' HD1', 139.365, 111.719, 84.388], ['A', ' HD1', 139.18, 113.228, 83.474]] AA_SCO= 2.339473684210526 CA_SCO= 1.8300526315789474
[['A', ' N ', 140.17, 113.787, 89.34], ['A', ' CA ', 140.976, 113.008, 90.264], ['A', ' C ', 140.065, 112.33, 91.247], ['A', ' O ', 139.057, 112.922, 91.592], ['A', ' CB ', 141.944, 113.95, 91.015], ['A', ' OG1', 142.844, 113.179, 91.825], ['A', ' CG2', 141.167, 114.928, 91.925], ['A', ' H ', 140.258, 114.792, 89.341], ['A', ' HA ', 141.532, 112.265, 89.7], ['A', ' HB ', 142.497, 114.523, 90.289], ['A', ' HG1', 143.608, 113.719, 92.141], ['A', ' HG2', 141.883, 115.588, 92.419], ['A', ' HG2', 140.481, 115.522, 91.331], ['A', ' HG2', 140.609, 114.391, 92.686]] AA_SCO= 2.3378947368421055 CA_SCO= 1.6652105263157895
[['A', ' N ', 140.335, 111.126, 91.733], ['A', ' CA ', 139.519, 110.508, 92.728], ['A', ' C ', 139.642, 111.335, 93.965], ['A', ' O ', 140.708, 111.881, 94.238], ['A', ' CB ', 140.145, 109.137, 92.895], ['A', ' CG ', 141.563, 109.313, 92.416], ['A', ' CD ', 141.467, 110.33, 91.294], ['A', ' HA ', 138.485, 110.457, 92.366], ['A', ' HB ', 140.077, 108.833, 93.947], ['A', ' HB ', 139.581, 108.403, 92.304], ['A', ' HG ', 142.205, 109.661, 93.24], ['A', ' HG ', 141.982, 108.349, 92.08], ['A', ' HD ', 142.395, 110.899, 91.262], ['A', ' HD ', 141.24, 109.836, 90.33]] AA_SCO= 2.3063157894736843 CA_SCO= 1.6154210526315789
[['A', ' N ', 138.601, 111.392, 94.749], ['A', ' CA ', 138.692, 112.159, 95.958], ['A', ' C ', 139.429, 111.382, 97.002], ['A', ' O ', 139.009, 110.306, 97.402], ['A', ' CB ', 137.296, 112.514, 96.429], ['A', ' CG1', 137.311, 113.218, 97.709], ['A', ' CG2', 136.679, 113.372, 95.428], ['A', ' H ', 137.743, 110.915, 94.492], ['A', ' HA ', 139.236, 113.082, 95.744], ['A', ' HB ', 136.715, 111.614, 96.55], ['A', ' HG1', 136.277, 113.459, 97.983], ['A', ' HG1', 137.746, 112.594, 98.481], ['A', ' HG1', 137.882, 114.134, 97.598], ['A', ' HG2', 135.699, 113.585, 95.791], ['A', ' HG2', 137.24, 114.302, 95.308], ['A', ' HG2', 136.621, 112.869, 94.469]] AA_SCO= 2.261052631578947 CA_SCO= 1.4387894736842106
[['A', ' N ', 140.492, 111.993, 97.482], ['A', ' CA ', 141.419, 111.426, 98.444], ['A', ' C ', 140.84, 111.353, 99.838], ['A', ' O ', 141.168, 110.464, 100.612], ['A', ' CB ', 142.614, 112.326, 98.463], ['A', ' CG ', 143.381, 112.375, 97.154], ['A', ' CD ', 144.253, 111.226, 96.911], ['A', ' NE ', 145.191, 111.113, 97.962], ['A', ' CZ ', 146.263, 111.909, 98.122], ['A', ' NH1', 146.519, 112.912, 97.296], ['A', ' NH2', 147.047, 111.714, 99.127], ['A', ' H ', 140.709, 112.892, 97.076], ['A', ' HA ', 141.691, 110.423, 98.123], ['A', ' HB ', 142.299, 113.342, 98.687], ['A', ' HB ', 143.29, 112.018, 99.259], ['A', ' HG ', 142.668, 112.385, 96.327], ['A', ' HG ', 143.947, 113.295, 97.12], ['A', ' HD ', 143.667, 110.307, 96.869], ['A', ' HD ', 144.788, 111.352, 95.971], ['A', ' HE ', 145.05, 110.374, 98.638], ['A', ' HH1', 145.918, 113.097, 96.516], ['A', ' HH1', 147.323, 113.557, 97.485], ['A', ' HH2', 146.875, 110.971, 99.78], ['A', ' HH2', 147.845, 112.336, 99.225]] AA_SCO= 2.2957894736842106 CA_SCO= 1.454526315789474
[['A', ' N ', 139.997, 112.323, 100.168], ['A', ' CA ', 139.355, 112.361, 101.471], ['A', ' C ', 140.174, 112.973, 102.604], ['A', ' O ', 139.786, 112.853, 103.767], ['A', ' H ', 139.791, 113.039, 99.489], ['A', ' HA ', 138.424, 112.893, 101.375], ['A', ' HA ', 139.082, 111.343, 101.749]] AA_SCO= 2.346315789473684 CA_SCO= 1.4545263157894737
[['A', ' N ', 141.257, 113.676, 102.297], ['A', ' CA ', 142.114, 114.204, 103.351], ['A', ' C ', 141.5, 115.158, 104.329], ['A', ' O ', 141.934, 115.209, 105.479], ['A', ' CB ', 143.398, 114.775, 102.758], ['A', ' CG ', 144.409, 113.702, 102.299], ['A', ' CD1', 145.467, 114.293, 101.459], ['A', ' CD2', 145.123, 113.143, 103.554], ['A', ' H ', 141.516, 113.807, 101.333], ['A', ' HA ', 142.408, 113.351, 103.927], ['A', ' HB ', 143.142, 115.399, 101.904], ['A', ' HB ', 143.886, 115.402, 103.509], ['A', ' HG ', 143.893, 112.911, 101.751], ['A', ' HD1', 146.183, 113.525, 101.174], ['A', ' HD1', 145.028, 114.727, 100.565], ['A', ' HD1', 145.969, 115.044, 102.036], ['A', ' HD2', 145.858, 112.394, 103.259], ['A', ' HD2', 145.63, 113.96, 104.059], ['A', ' HD2', 144.442, 112.697, 104.243]] AA_SCO= 2.3742105263157893 CA_SCO= 1.4509473684210528
[['A', ' N ', 140.508, 115.939, 103.962], ['A', ' CA ', 140.02, 116.815, 104.995], ['A', ' C ', 139.363, 115.965, 106.096], ['A', ' O ', 139.418, 116.317, 107.276], ['A', ' CB ', 139.07, 117.864, 104.417], ['A', ' CG ', 139.776, 118.879, 103.475], ['A', ' CD ', 138.835, 119.859, 102.783], ['A', ' OE1', 137.671, 119.581, 102.7], ['A', ' OE2', 139.278, 120.902, 102.368], ['A', ' H ', 140.07, 115.939, 103.032], ['A', ' HA ', 140.869, 117.334, 105.424], ['A', ' HB ', 138.252, 117.383, 103.902], ['A', ' HB ', 138.633, 118.437, 105.235], ['A', ' HG ', 140.517, 119.433, 104.045], ['A', ' HG ', 140.312, 118.316, 102.709]] AA_SCO= 2.3173684210526315 CA_SCO= 1.4759473684210527
[['A', ' N ', 138.745, 114.827, 105.737], ['A', ' CA ', 138.047, 114.029, 106.734], ['A', ' C ', 138.995, 113.058, 107.419], ['A', ' O ', 138.825, 112.723, 108.603], ['A', ' CB ', 136.877, 113.303, 106.086], ['A', ' CG ', 135.806, 114.238, 105.496], ['A', ' CD ', 135.158, 115.135, 106.559], ['A', ' CE ', 134.007, 115.946, 105.986], ['A', ' NZ ', 133.403, 116.857, 107.011], ['A', ' H ', 138.776, 114.486, 104.774], ['A', ' HA ', 137.668, 114.69, 107.505], ['A', ' HB ', 137.245, 112.67, 105.27], ['A', ' HB ', 136.397, 112.649, 106.813], ['A', ' HG ', 136.261, 114.864, 104.725], ['A', ' HG ', 135.039, 113.626, 105.032], ['A', ' HD ', 134.795, 114.523, 107.384], ['A', ' HD ', 135.885, 115.849, 106.945], ['A', ' HE ', 134.372, 116.543, 105.15], ['A', ' HE ', 133.237, 115.263, 105.625], ['A', ' HZ ', 132.642, 117.38, 106.601], ['A', ' HZ ', 133.052, 116.311, 107.787], ['A', ' HZ ', 134.108, 117.501, 107.345]] AA_SCO= 2.156315789473684 CA_SCO= 1.4786842105263158
[['A', ' N ', 140.028, 112.634, 106.69], ['A', ' CA ', 141.024, 111.737, 107.253], ['A', ' C ', 141.673, 112.42, 108.416], ['A', ' O ', 141.927, 111.801, 109.448], ['A', ' CB ', 142.09, 111.411, 106.236], ['A', ' CG ', 141.631, 110.558, 105.161], ['A', ' SD ', 142.735, 110.462, 103.767], ['A', ' CE ', 144.137, 109.655, 104.403], ['A', ' H ', 140.088, 112.923, 105.711], ['A', ' HA ', 140.538, 110.827, 107.599], ['A', ' HB ', 142.494, 112.319, 105.837], ['A', ' HB ', 142.901, 110.894, 106.741], ['A', ' HG ', 141.557, 109.582, 105.59], ['A', ' HG ', 140.652, 110.852, 104.823], ['A', ' HE ', 144.875, 109.547, 103.615], ['A', ' HE ', 144.569, 110.218, 105.225], ['A', ' HE ', 143.835, 108.688, 104.741]] AA_SCO= 2.2300000000000004 CA_SCO= 1.479421052631579
[['A', ' N ', 141.936, 113.706, 108.228], ['A', ' CA ', 142.532, 114.546, 109.229], ['A', ' C ', 141.562, 114.919, 110.32], ['A', ' O ', 141.915, 114.869, 111.489], ['A', ' CB ', 143.087, 115.812, 108.578], ['A', ' CG1', 143.542, 116.775, 109.625], ['A', ' CG2', 144.253, 115.431, 107.695], ['A', ' H ', 141.718, 114.117, 107.315], ['A', ' HA ', 143.359, 113.997, 109.68], ['A', ' HB ', 142.31, 116.29, 107.974], ['A', ' HG1', 143.957, 117.661, 109.148], ['A', ' HG1', 142.715, 117.078, 110.264], ['A', ' HG1', 144.29, 116.283, 110.216], ['A', ' HG2', 144.653, 116.324, 107.223], ['A', ' HG2', 145.01, 114.966, 108.304], ['A', ' HG2', 143.929, 114.733, 106.925]] AA_SCO= 2.271578947368421 CA_SCO= 1.48
[['A', ' N ', 140.34, 115.3, 109.962], ['A', ' CA ', 139.42, 115.763, 110.973], ['A', ' C ', 139.154, 114.764, 112.072], ['A', ' O ', 139.241, 115.114, 113.234], ['A', ' CB ', 138.061, 116.155, 110.363], ['A', ' OG1', 138.239, 117.217, 109.426], ['A', ' CG2', 137.157, 116.66, 111.464], ['A', ' H ', 140.063, 115.354, 108.982], ['A', ' HA ', 139.85, 116.647, 111.424], ['A', ' HB ', 137.609, 115.3, 109.864], ['A', ' HG1', 138.698, 116.889, 108.626], ['A', ' HG2', 136.203, 116.968, 111.044], ['A', ' HG2', 136.975, 115.897, 112.215], ['A', ' HG2', 137.636, 117.507, 111.928]] AA_SCO= 2.2694736842105265 CA_SCO= 1.4811578947368422
[['A', ' N ', 138.89, 113.505, 111.774], ['A', ' CA ', 138.561, 112.603, 112.895], ['A', ' C ', 139.768, 112.004, 113.642], ['A', ' O ', 139.807, 110.791, 113.88], ['A', ' H ', 138.858, 113.203, 110.792], ['A', ' HA ', 137.938, 113.142, 113.608], ['A', ' HA ', 137.947, 111.79, 112.51]] AA_SCO= 2.227368421052631 CA_SCO= 1.4775263157894738
[['A', ' N ', 140.738, 112.85, 113.983], ['A', ' CA ', 142.023, 112.485, 114.59], ['A', ' C ', 142.59, 113.601, 115.463], ['A', ' O ', 142.047, 114.696, 115.514], ['A', ' CB ', 143.041, 112.048, 113.531], ['A', ' CG ', 142.604, 110.801, 112.767], ['A', ' CD ', 143.612, 110.262, 111.804], ['A', ' CE ', 143.097, 109.024, 111.117], ['A', ' NZ ', 141.743, 109.245, 110.587], ['A', ' H ', 140.525, 113.83, 113.791], ['A', ' HA ', 141.853, 111.63, 115.243], ['A', ' HB ', 143.177, 112.856, 112.804], ['A', ' HB ', 144.007, 111.853, 113.993], ['A', ' HG ', 142.287, 110.023, 113.461], ['A', ' HG ', 141.764, 111.101, 112.161], ['A', ' HD ', 143.849, 111.015, 111.05], ['A', ' HD ', 144.517, 109.992, 112.342], ['A', ' HE ', 143.762, 108.803, 110.283], ['A', ' HE ', 143.086, 108.176, 111.798], ['A', ' HZ ', 141.411, 108.436, 110.097], ['A', ' HZ ', 141.114, 109.447, 111.351], ['A', ' HZ ', 141.773, 110.07, 109.959]] AA_SCO= 2.1794736842105262 CA_SCO= 1.478
[['A', ' N ', 143.62, 113.272, 116.222], ['A', ' CA ', 144.322, 114.19, 117.117], ['A', ' C ', 145.153, 115.221, 116.345], ['A', ' O ', 145.392, 115.01, 115.164], ['A', ' CB ', 145.231, 113.396, 118.03], ['A', ' H ', 143.991, 112.335, 116.122], ['A', ' HA ', 143.586, 114.695, 117.712], ['A', ' HB ', 145.743, 114.057, 118.722], ['A', ' HB ', 144.646, 112.676, 118.593], ['A', ' HB ', 145.978, 112.869, 117.43]] AA_SCO= 2.1747368421052626 CA_SCO= 1.296421052631579
[['A', ' N ', 145.51, 116.384, 116.948], ['A', ' CA ', 146.492, 117.323, 116.46], ['A', ' C ', 147.692, 116.448, 116.39], ['A', ' O ', 147.716, 115.446, 117.095], ['A', ' CB ', 146.582, 118.379, 117.544], ['A', ' CG ', 145.266, 118.293, 118.22], ['A', ' CD ', 144.877, 116.838, 118.172], ['A', ' HA ', 146.21, 117.713, 115.474], ['A', ' HB ', 147.426, 118.16, 118.214], ['A', ' HB ', 146.772, 119.364, 117.095], ['A', ' HG ', 145.332, 118.679, 119.252], ['A', ' HG ', 144.552, 118.923, 117.687], ['A', ' HD ', 145.27, 116.304, 119.047], ['A', ' HD ', 143.798, 116.799, 118.096]] AA_SCO= 2.1473684210526316 CA_SCO= 1.2967368421052632
[['A', ' N ', 148.656, 116.789, 115.564], ['A', ' CA ', 149.768, 115.894, 115.266], ['A', ' C ', 148.969, 115.154, 114.251], ['A', ' O ', 147.872, 115.622, 113.993], ['A', ' CB ', 150.236, 114.971, 116.409], ['A', ' CG ', 151.582, 114.274, 116.165], ['A', ' CD ', 152.714, 115.23, 116.206], ['A', ' OE1', 152.657, 116.134, 116.994], ['A', ' OE2', 153.616, 115.099, 115.42], ['A', ' H ', 148.561, 117.657, 115.058], ['A', ' HA ', 150.606, 116.408, 114.795], ['A', ' HB ', 150.284, 115.522, 117.352], ['A', ' HB ', 149.541, 114.14, 116.527], ['A', ' HG ', 151.729, 113.53, 116.951], ['A', ' HG ', 151.59, 113.751, 115.224]] AA_SCO= 2.182105263157895 CA_SCO= 1.2917368421052633
[['A', ' N ', 149.468, 114.145, 113.574], ['A', ' CA ', 148.7, 113.468, 112.52], ['A', ' C ', 148.459, 114.361, 111.306], ['A', ' O ', 148.991, 114.081, 110.236], ['A', ' CB ', 147.324, 112.954, 113.005], ['A', ' OG1', 147.499, 112.024, 114.071], ['A', ' CG2', 146.642, 112.257, 111.862], ['A', ' H ', 150.384, 113.79, 113.795], ['A', ' HA ', 149.277, 112.609, 112.183], ['A', ' HB ', 146.68, 113.753, 113.332], ['A', ' HG1', 147.88, 112.478, 114.831], ['A', ' HG2', 145.718, 111.904, 112.222], ['A', ' HG2', 146.461, 112.933, 111.03], ['A', ' HG2', 147.255, 111.422, 111.523]] AA_SCO= 2.3131578947368423 CA_SCO= 1.2919473684210527
[['A', ' N ', 147.725, 115.462, 111.463], ['A', ' CA ', 147.435, 116.379, 110.379], ['A', ' C ', 148.687, 116.809, 109.642], ['A', ' O ', 148.735, 116.65, 108.431], ['A', ' CB ', 146.704, 117.628, 110.871], ['A', ' H ', 147.331, 115.623, 112.381], ['A', ' HA ', 146.786, 115.857, 109.68], ['A', ' HB ', 146.457, 118.257, 110.014], ['A', ' HB ', 145.801, 117.334, 111.374], ['A', ' HB ', 147.275, 118.21, 111.555]] AA_SCO= 2.3452631578947374 CA_SCO= 1.2552105263157893
[['A', ' N ', 149.801, 117.199, 110.296], ['A', ' CA ', 151.004, 117.654, 109.649], ['A', ' C ', 151.609, 116.608, 108.75], ['A', ' O ', 152.473, 116.945, 107.951], ['A', ' CB ', 151.941, 117.932, 110.814], ['A', ' CG ', 151.051, 118.157, 111.953], ['A', ' CD ', 149.945, 117.201, 111.751], ['A', ' HA ', 150.801, 118.574, 109.088], ['A', ' HB ', 152.616, 117.076, 110.96], ['A', ' HB ', 152.582, 118.804, 110.582], ['A', ' HG ', 151.6, 117.999, 112.893], ['A', ' HG ', 150.703, 119.197, 111.945], ['A', ' HD ', 150.317, 116.239, 112.072], ['A', ' HD ', 149.095, 117.53, 112.31]] AA_SCO= 2.2384210526315793 CA_SCO= 1.2446842105263154
[['A', ' N ', 151.225, 115.343, 108.935], ['A', ' CA ', 151.736, 114.252, 108.148], ['A', ' C ', 150.736, 113.919, 107.07], ['A', ' O ', 151.076, 113.806, 105.904], ['A', ' CB ', 151.961, 113.02, 109.038], ['A', ' CG1', 152.413, 111.833, 108.226], ['A', ' CG2', 152.961, 113.354, 110.062], ['A', ' H ', 150.49, 115.111, 109.597], ['A', ' HA ', 152.679, 114.549, 107.687], ['A', ' HB ', 151.023, 112.746, 109.521], ['A', ' HG1', 152.56, 110.979, 108.894], ['A', ' HG1', 151.661, 111.582, 107.491], ['A', ' HG1', 153.352, 112.066, 107.722], ['A', ' HG2', 153.119, 112.49, 110.709], ['A', ' HG2', 153.894, 113.624, 109.57], ['A', ' HG2', 152.604, 114.193, 110.655]] AA_SCO= 2.2931578947368423 CA_SCO= 1.4514210526315787
[['A', ' N ', 149.473, 113.789, 107.426], ['A', ' CA ', 148.506, 113.36, 106.435], ['A', ' C ', 148.331, 114.369, 105.317], ['A', ' O ', 148.166, 113.994, 104.154], ['A', ' CB ', 147.173, 113.072, 107.105], ['A', ' CG ', 147.171, 111.852, 108.005], ['A', ' SD ', 147.495, 110.335, 107.1], ['A', ' CE ', 147.788, 109.167, 108.414], ['A', ' H ', 149.204, 113.952, 108.396], ['A', ' HA ', 148.873, 112.447, 105.989], ['A', ' HB ', 146.926, 113.921, 107.73], ['A', ' HB ', 146.387, 112.967, 106.359], ['A', ' HG ', 147.939, 111.971, 108.773], ['A', ' HG ', 146.2, 111.764, 108.499], ['A', ' HE ', 148.013, 108.195, 107.988], ['A', ' HE ', 148.636, 109.495, 109.021], ['A', ' HE ', 146.901, 109.088, 109.043]] AA_SCO= 2.3642105263157895 CA_SCO= 1.5004210526315784
[['A', ' N ', 148.484, 115.644, 105.633], ['A', ' CA ', 148.327, 116.675, 104.625], ['A', ' C ', 149.524, 116.706, 103.693], ['A', ' O ', 149.471, 117.326, 102.638], ['A', ' CB ', 148.15, 118.061, 105.242], ['A', ' CG1', 146.92, 118.049, 106.152], ['A', ' CG2', 149.45, 118.489, 105.943], ['A', ' H ', 148.644, 115.894, 106.613], ['A', ' HA ', 147.432, 116.446, 104.048], ['A', ' HB ', 147.936, 118.781, 104.458], ['A', ' HG1', 146.771, 119.038, 106.567], ['A', ' HG1', 146.045, 117.769, 105.564], ['A', ' HG1', 147.039, 117.347, 106.952], ['A', ' HG2', 149.312, 119.466, 106.36], ['A', ' HG2', 149.711, 117.811, 106.714], ['A', ' HG2', 150.27, 118.529, 105.235]] AA_SCO= 2.426315789473685 CA_SCO= 1.6774210526315787
[['A', ' N ', 150.618, 116.052, 104.051], ['A', ' CA ', 151.795, 116.099, 103.225], ['A', ' C ', 151.607, 115.326, 101.966], ['A', ' O ', 152.391, 115.5, 101.04], ['A', ' CB ', 153.016, 115.599, 103.938], ['A', ' CG ', 153.42, 116.473, 104.978], ['A', ' CD ', 154.554, 115.948, 105.704], ['A', ' OE1', 154.772, 114.73, 105.748], ['A', ' NE2', 155.313, 116.837, 106.277], ['A', ' H ', 150.63, 115.472, 104.889], ['A', ' HA ', 151.974, 117.137, 102.951], ['A', ' HB ', 152.825, 114.61, 104.352], ['A', ' HB ', 153.842, 115.511, 103.242], ['A', ' HG ', 153.705, 117.418, 104.539], ['A', ' HG ', 152.586, 116.607, 105.64], ['A', ' HE2', 156.127, 116.541, 106.793], ['A', ' HE2', 155.098, 117.802, 106.23]] AA_SCO= 2.421052631578948 CA_SCO= 1.57678947368421
[['A', ' N ', 150.613, 114.441, 101.916], ['A', ' CA ', 150.373, 113.761, 100.672], ['A', ' C ', 149.254, 114.364, 99.918], ['A', ' O ', 148.837, 113.765, 98.924], ['A', ' CB ', 150.178, 112.245, 100.735], ['A', ' CG ', 151.386, 111.476, 101.032], ['A', ' CD ', 152.36, 111.422, 99.906], ['A', ' NE ', 152.119, 110.469, 98.8], ['A', ' CZ ', 152.725, 109.261, 98.689], ['A', ' NH1', 153.566, 108.884, 99.594], ['A', ' NH2', 152.512, 108.509, 97.646], ['A', ' H ', 149.978, 114.288, 102.712], ['A', ' HA ', 151.237, 113.936, 100.052], ['A', ' HB ', 149.438, 112.003, 101.499], ['A', ' HB ', 149.808, 111.874, 99.788], ['A', ' HG ', 151.874, 111.868, 101.912], ['A', ' HG ', 151.07, 110.492, 101.148], ['A', ' HD ', 152.41, 112.356, 99.443], ['A', ' HD ', 153.306, 111.195, 100.348], ['A', ' HE ', 151.497, 110.748, 98.067], ['A', ' HH1', 153.758, 109.455, 100.384], ['A', ' HH1', 154.114, 108.021, 99.487], ['A', ' HH2', 151.894, 108.788, 96.921], ['A', ' HH2', 153.006, 107.625, 97.505]] AA_SCO= 2.4763157894736847 CA_SCO= 1.6085789473684209
[['A', ' N ', 148.802, 115.563, 100.293], ['A', ' CA ', 147.809, 116.123, 99.409], ['A', ' C ', 148.484, 116.182, 98.042], ['A', ' O ', 147.921, 115.625, 97.106], ['A', ' CB ', 147.368, 117.56, 99.801], ['A', ' CG1', 146.59, 117.572, 101.104], ['A', ' CG2', 146.539, 118.192, 98.634], ['A', ' CD1', 146.418, 118.953, 101.74], ['A', ' H ', 149.147, 116.067, 101.114], ['A', ' HA ', 146.945, 115.469, 99.347], ['A', ' HB ', 148.229, 118.142, 99.971], ['A', ' HG1', 145.603, 117.162, 100.925], ['A', ' HG1', 147.103, 116.949, 101.805], ['A', ' HG2', 146.258, 119.201, 98.891], ['A', ' HG2', 147.126, 118.225, 97.712], ['A', ' HG2', 145.64, 117.603, 98.454], ['A', ' HD1', 145.859, 118.856, 102.673], ['A', ' HD1', 147.403, 119.37, 101.954], ['A', ' HD1', 145.885, 119.624, 101.079]] AA_SCO= 2.4373684210526316 CA_SCO= 1.6123157894736841
[['A', ' N ', 149.742, 116.727, 97.954], ['A', ' CA ', 150.515, 116.816, 96.729], ['A', ' C ', 151.991, 116.717, 97.043], ['A', ' O ', 152.531, 117.48, 97.85], ['A', ' CB ', 150.196, 118.136, 95.997], ['A', ' SG ', 150.914, 118.297, 94.365], ['A', ' H ', 150.129, 117.128, 98.795], ['A', ' HA ', 150.276, 115.965, 96.096], ['A', ' HB ', 149.118, 118.261, 95.901], ['A', ' HB ', 150.539, 118.972, 96.595]] AA_SCO= 2.434736842105263 CA_SCO= 1.578578947368421
[['A', ' N ', 152.678, 115.859, 96.313], ['A', ' CA ', 154.096, 115.609, 96.515], ['A', ' C ', 154.925, 116.617, 95.788], ['A', ' O ', 156.151, 116.609, 95.838], ['A', ' H ', 152.189, 115.318, 95.597], ['A', ' HA ', 154.332, 115.656, 97.576], ['A', ' HA ', 154.337, 114.619, 96.17]] AA_SCO= 2.554210526315789 CA_SCO= 1.5784736842105263
[['A', ' N ', 154.235, 117.513, 95.132], ['A', ' CA ', 154.849, 118.55, 94.388], ['A', ' C ', 154.584, 119.876, 95.123], ['A', ' O ', 155.046, 120.928, 94.686], ['A', ' CB ', 154.35, 118.451, 92.944], ['A', ' CG1', 154.857, 119.538, 92.113], ['A', ' CG2', 154.784, 117.088, 92.4], ['A', ' H ', 153.227, 117.45, 95.144], ['A', ' HA ', 155.925, 118.385, 94.372], ['A', ' HB ', 153.282, 118.519, 92.917], ['A', ' HG1', 154.477, 119.395, 91.1], ['A', ' HG1', 154.519, 120.485, 92.487], ['A', ' HG1', 155.949, 119.517, 92.101], ['A', ' HG2', 154.428, 116.975, 91.375], ['A', ' HG2', 155.87, 117.014, 92.417], ['A', ' HG2', 154.364, 116.287, 93.003]] AA_SCO= 2.412105263157894 CA_SCO= 1.5797894736842106
[['A', ' N ', 153.802, 119.82, 96.228], ['A', ' CA ', 153.578, 120.973, 97.088], ['A', ' C ', 153.557, 120.609, 98.593], ['A', ' O ', 152.805, 121.23, 99.358], ['A', ' CB ', 152.245, 121.626, 96.767], ['A', ' SG ', 152.135, 122.2, 95.138], ['A', ' H ', 153.424, 118.928, 96.551], ['A', ' HA ', 154.379, 121.695, 96.92], ['A', ' HB ', 151.462, 120.918, 96.923], ['A', ' HB ', 152.061, 122.462, 97.444], ['A', ' HG ', 153.198, 121.493, 94.702]] AA_SCO= 2.3821052631578943 CA_SCO= 1.511368421052632
[['A', ' N ', 154.433, 119.703, 99.063], ['A', ' CA ', 154.573, 119.299, 100.414], ['A', ' C ', 155.243, 120.489, 100.893], ['A', ' O ', 155.749, 121.199, 100.044], ['A', ' CB ', 155.503, 118.141, 100.351], ['A', ' CG ', 156.355, 118.473, 99.171], ['A', ' CD ', 155.446, 119.105, 98.23], ['A', ' HA ', 153.597, 119.109, 100.889], ['A', ' HB ', 156.078, 118.061, 101.279], ['A', ' HB ', 154.943, 117.198, 100.224], ['A', ' HG ', 157.209, 119.102, 99.464], ['A', ' HG ', 156.772, 117.565, 98.724], ['A', ' HD ', 155.978, 119.817, 97.627], ['A', ' HD ', 155.046, 118.296, 97.709]] AA_SCO= 2.4036842105263156 CA_SCO= 1.511421052631579
[['A', ' N ', 155.297, 120.7, 102.177], ['A', ' CA ', 155.962, 121.837, 102.784], ['A', ' C ', 154.871, 122.88, 102.997], ['A', ' O ', 154.391, 122.918, 104.116], ['A', ' CB ', 157.237, 122.285, 102.047], ['A', ' CG1', 158.22, 121.142, 102.089], ['A', ' CG2', 157.771, 123.477, 102.777], ['A', ' CD1', 159.263, 121.246, 101.107], ['A', ' H ', 154.854, 120.022, 102.777], ['A', ' HA ', 156.313, 121.541, 103.77], ['A', ' HB ', 157.121, 122.562, 101.058], ['A', ' HG1', 158.688, 121.114, 103.054], ['A', ' HG1', 157.713, 120.205, 101.917], ['A', ' HG2', 158.692, 123.811, 102.324], ['A', ' HG2', 157.059, 124.275, 102.74], ['A', ' HG2', 157.948, 123.203, 103.816], ['A', ' HD1', 159.893, 120.383, 101.183], ['A', ' HD1', 158.801, 121.246, 100.136], ['A', ' HD1', 159.84, 122.147, 101.243]] AA_SCO= 2.3984210526315786 CA_SCO= 1.5063684210526316
[['A', ' N ', 154.334, 123.685, 102.044], ['A', ' CA ', 153.252, 124.562, 102.367], ['A', ' C ', 152.102, 123.821, 102.998], ['A', ' O ', 151.492, 124.324, 103.935], ['A', ' CB ', 152.812, 125.056, 101.019], ['A', ' CG ', 154.013, 124.995, 100.187], ['A', ' CD ', 154.742, 123.798, 100.647], ['A', ' HA ', 153.605, 125.356, 103.017], ['A', ' HB ', 151.971, 124.441, 100.638], ['A', ' HB ', 152.428, 126.066, 101.154], ['A', ' HG ', 153.705, 124.851, 99.151], ['A', ' HG ', 154.572, 125.904, 100.211], ['A', ' HD ', 154.382, 122.992, 100.05], ['A', ' HD ', 155.769, 124.008, 100.514]] AA_SCO= 2.4647368421052627 CA_SCO= 1.5042631578947367
[['A', ' N ', 151.873, 122.569, 102.606], ['A', ' CA ', 150.75, 121.893, 103.21], ['A', ' C ', 150.97, 121.623, 104.685], ['A', ' O ', 150.019, 121.647, 105.469], ['A', ' CB ', 150.472, 120.56, 102.534], ['A', ' CG ', 150.05, 120.673, 101.134], ['A', ' ND1', 149.356, 121.74, 100.649], ['A', ' CD2', 150.226, 119.84, 100.094], ['A', ' CE1', 149.131, 121.569, 99.384], ['A', ' NE2', 149.632, 120.419, 99.008], ['A', ' H ', 152.351, 122.141, 101.799], ['A', ' HA ', 149.862, 122.518, 103.113], ['A', ' HB ', 151.363, 119.936, 102.573], ['A', ' HB ', 149.687, 120.038, 103.076], ['A', ' HD1', 149.09, 122.618, 101.11], ['A', ' HD2', 150.72, 118.871, 99.999], ['A', ' HE1', 148.615, 122.326, 98.849]] AA_SCO= 2.382631578947368 CA_SCO= 1.666578947368421
[['A', ' N ', 152.208, 121.337, 105.079], ['A', ' CA ', 152.448, 120.987, 106.466], ['A', ' C ', 152.574, 122.262, 107.259], ['A', ' O ', 152.147, 122.342, 108.403], ['A', ' CB ', 153.692, 120.085, 106.638], ['A', ' OG1', 153.601, 119.403, 107.878], ['A', ' CG2', 154.997, 120.87, 106.659], ['A', ' H ', 152.985, 121.409, 104.435], ['A', ' HA ', 151.592, 120.436, 106.851], ['A', ' HB ', 153.72, 119.373, 105.832], ['A', ' HG1', 153.058, 118.58, 107.794], ['A', ' HG2', 155.823, 120.17, 106.792], ['A', ' HG2', 155.131, 121.393, 105.751], ['A', ' HG2', 155.003, 121.565, 107.482]] AA_SCO= 2.392105263157895 CA_SCO= 1.6579473684210526
[['A', ' N ', 153.137, 123.283, 106.64], ['A', ' CA ', 153.314, 124.544, 107.31], ['A', ' C ', 151.972, 125.207, 107.521], ['A', ' O ', 151.799, 125.941, 108.479], ['A', ' CB ', 154.234, 125.419, 106.477], ['A', ' CG ', 155.678, 124.975, 106.396], ['A', ' CD1', 156.328, 125.739, 105.373], ['A', ' CD2', 156.389, 125.245, 107.672], ['A', ' H ', 153.476, 123.165, 105.686], ['A', ' HA ', 153.751, 124.357, 108.285], ['A', ' HB ', 153.85, 125.424, 105.464], ['A', ' HB ', 154.205, 126.436, 106.867], ['A', ' HG ', 155.727, 123.916, 106.151], ['A', ' HD1', 157.37, 125.437, 105.3], ['A', ' HD1', 155.831, 125.561, 104.43], ['A', ' HD1', 156.28, 126.795, 105.626], ['A', ' HD2', 157.432, 124.935, 107.577], ['A', ' HD2', 156.345, 126.31, 107.876], ['A', ' HD2', 155.935, 124.709, 108.476]] AA_SCO= 2.3889473684210527 CA_SCO= 1.637263157894737
[['A', ' N ', 151.036, 124.993, 106.595], ['A', ' CA ', 149.688, 125.52, 106.701], ['A', ' C ', 148.797, 124.686, 107.649], ['A', ' O ', 147.917, 125.273, 108.288], ['A', ' CB ', 149.048, 125.61, 105.331], ['A', ' H ', 151.279, 124.462, 105.765], ['A', ' HA ', 149.759, 126.524, 107.118], ['A', ' HB ', 148.055, 126.044, 105.415], ['A', ' HB ', 149.642, 126.22, 104.668], ['A', ' HB ', 148.978, 124.614, 104.913]] AA_SCO= 2.277368421052632 CA_SCO= 1.6340000000000001
[['A', ' N ', 148.964, 123.333, 107.767], ['A', ' CA ', 148.102, 122.644, 108.751], ['A', ' C ', 148.644, 122.957, 110.15], ['A', ' O ', 147.882, 123.151, 111.104], ['A', ' CB ', 148.055, 121.153, 108.542], ['A', ' OG ', 149.243, 120.537, 108.91], ['A', ' H ', 149.6, 122.802, 107.168], ['A', ' HA ', 147.091, 123.038, 108.67], ['A', ' HB ', 147.229, 120.726, 109.106], ['A', ' HB ', 147.862, 120.965, 107.492], ['A', ' HG ', 149.188, 119.648, 108.541]] AA_SCO= 2.251052631578948 CA_SCO= 1.6647368421052635
[['A', ' N ', 149.958, 123.127, 110.241], ['A', ' CA ', 150.649, 123.593, 111.425], ['A', ' C ', 150.328, 125.037, 111.181], ['A', ' O ', 149.74, 125.293, 110.159], ['A', ' CB ', 152.146, 123.23, 111.416], ['A', ' CG1', 152.875, 123.823, 112.611], ['A', ' CG2', 152.26, 121.711, 111.454], ['A', ' H ', 150.533, 122.902, 109.426], ['A', ' HA ', 150.172, 123.244, 112.338], ['A', ' HB ', 152.607, 123.62, 110.512], ['A', ' HG1', 153.92, 123.535, 112.573], ['A', ' HG1', 152.817, 124.887, 112.605], ['A', ' HG1', 152.436, 123.467, 113.527], ['A', ' HG2', 153.295, 121.407, 111.431], ['A', ' HG2', 151.799, 121.349, 112.352], ['A', ' HG2', 151.748, 121.282, 110.593]] AA_SCO= 2.16 CA_SCO= 1.675789473684211
[['A', ' N ', 150.441, 125.936, 112.11], ['A', ' CA ', 149.979, 127.322, 111.845], ['A', ' C ', 148.441, 127.366, 111.976], ['A', ' O ', 147.921, 128.022, 112.873], ['A', ' CB ', 150.392, 127.882, 110.46], ['A', ' CG ', 150.15, 129.377, 110.271], ['A', ' CD ', 151.075, 130.254, 111.017], ['A', ' OE1', 152.149, 129.825, 111.318], ['A', ' OE2', 150.711, 131.371, 111.282], ['A', ' H ', 150.932, 125.69, 112.982], ['A', ' HA ', 150.413, 127.992, 112.575], ['A', ' HB ', 151.442, 127.671, 110.269], ['A', ' HB ', 149.809, 127.465, 109.653], ['A', ' HG ', 150.199, 129.617, 109.209], ['A', ' HG ', 149.153, 129.601, 110.624]] AA_SCO= 2.0410526315789475 CA_SCO= 1.6770000000000003
[['A', ' N ', 147.674, 126.608, 111.175], ['A', ' CA ', 146.228, 126.569, 111.429], ['A', ' C ', 145.999, 126.026, 112.832], ['A', ' O ', 145.138, 126.505, 113.575], ['A', ' CB ', 145.511, 125.729, 110.406], ['A', ' H ', 148.091, 126.078, 110.389], ['A', ' HA ', 145.843, 127.587, 111.386], ['A', ' HB ', 144.441, 125.734, 110.614], ['A', ' HB ', 145.697, 126.149, 109.426], ['A', ' HB ', 145.882, 124.711, 110.438]] AA_SCO= 1.9489473684210528 CA_SCO= 1.6781578947368423
[['A', ' N ', 146.813, 125.048, 113.213], ['A', ' CA ', 146.793, 124.49, 114.545], ['A', ' C ', 147.524, 125.437, 115.509], ['A', ' O ', 147.092, 125.597, 116.639], ['A', ' CB ', 147.303, 123.049, 114.612], ['A', ' CG1', 146.304, 122.143, 113.848], ['A', ' CG2', 147.403, 122.634, 116.075], ['A', ' CD1', 146.775, 120.726, 113.583], ['A', ' H ', 147.43, 124.633, 112.507], ['A', ' HA ', 145.757, 124.443, 114.864], ['A', ' HB ', 148.277, 122.965, 114.125], ['A', ' HG1', 145.377, 122.093, 114.416], ['A', ' HG1', 146.09, 122.61, 112.886], ['A', ' HG2', 147.735, 121.621, 116.166], ['A', ' HG2', 148.11, 123.275, 116.596], ['A', ' HG2', 146.42, 122.728, 116.541], ['A', ' HD1', 146.002, 120.188, 113.033], ['A', ' HD1', 147.691, 120.758, 112.983], ['A', ' HD1', 146.97, 120.209, 114.513]] AA_SCO= 2.043684210526316 CA_SCO= 1.6781578947368427
[['A', ' N ', 148.631, 126.097, 115.083], ['A', ' CA ', 149.368, 126.993, 116.011], ['A', ' C ', 148.394, 128.102, 116.433], ['A', ' O ', 148.555, 128.762, 117.458], ['A', ' CB ', 150.539, 127.816, 115.404], ['A', ' CG ', 151.748, 127.066, 114.75], ['A', ' OD1', 151.694, 125.871, 114.622], ['A', ' OD2', 152.685, 127.731, 114.305], ['A', ' H ', 148.966, 125.946, 114.143], ['A', ' HA ', 149.688, 126.436, 116.878], ['A', ' HB ', 150.128, 128.535, 114.699], ['A', ' HB ', 150.959, 128.415, 116.218]] AA_SCO= 1.9842105263157896 CA_SCO= 1.6417894736842111
[['A', ' N ', 147.426, 128.398, 115.568], ['A', ' CA ', 146.383, 129.352, 115.865], ['A', ' C ', 145.228, 128.709, 116.671], ['A', ' O ', 144.767, 129.291, 117.646], ['A', ' CB ', 145.877, 129.978, 114.56], ['A', ' CG ', 144.929, 131.166, 114.761], ['A', ' OD1', 145.126, 131.877, 115.713], ['A', ' OD2', 144.034, 131.388, 113.948], ['A', ' H ', 147.436, 127.963, 114.65], ['A', ' HA ', 146.814, 130.144, 116.478], ['A', ' HB ', 146.737, 130.312, 113.969], ['A', ' HB ', 145.381, 129.213, 113.965]] AA_SCO= 1.9452631578947366 CA_SCO= 1.6306842105263164
[['A', ' N ', 144.751, 127.495, 116.302], ['A', ' CA ', 143.604, 126.93, 117.032], ['A', ' C ', 143.954, 126.637, 118.486], ['A', ' O ', 143.1, 126.72, 119.372], ['A', ' CB ', 143.137, 125.638, 116.408], ['A', ' OG ', 144.031, 124.605, 116.666], ['A', ' H ', 145.11, 127.006, 115.481], ['A', ' HA ', 142.799, 127.654, 116.999], ['A', ' HB ', 142.154, 125.379, 116.785], ['A', ' HB ', 143.051, 125.777, 115.331], ['A', ' HG ', 143.694, 123.838, 116.203]] AA_SCO= 1.9794736842105263 CA_SCO= 1.630684210526316
[['A', ' N ', 145.208, 126.324, 118.726], ['A', ' CA ', 145.76, 126.125, 120.04], ['A', ' C ', 146.592, 127.352, 120.191], ['A', ' O ', 147.294, 127.677, 119.263], ['A', ' CB ', 146.666, 124.901, 120.049], ['A', ' CG ', 146.045, 123.577, 119.698], ['A', ' CD1', 147.14, 122.538, 119.611], ['A', ' CD2', 145.051, 123.21, 120.75], ['A', ' H ', 145.834, 126.203, 117.925], ['A', ' HA ', 144.988, 126.105, 120.804], ['A', ' HB ', 147.434, 125.081, 119.305], ['A', ' HB ', 147.142, 124.815, 121.028], ['A', ' HG ', 145.544, 123.638, 118.731], ['A', ' HD1', 146.71, 121.565, 119.368], ['A', ' HD1', 147.841, 122.82, 118.847], ['A', ' HD1', 147.657, 122.489, 120.548], ['A', ' HD2', 144.611, 122.259, 120.509], ['A', ' HD2', 145.539, 123.145, 121.726], ['A', ' HD2', 144.281, 123.96, 120.784]] AA_SCO= 2.0047368421052636 CA_SCO= 1.2684736842105262
[['A', ' N ', 146.662, 127.992, 121.325], ['A', ' CA ', 147.487, 129.195, 121.304], ['A', ' C ', 148.961, 128.887, 121.503], ['A', ' O ', 149.466, 128.863, 122.627], ['A', ' CB ', 146.973, 130.172, 122.355], ['A', ' CG ', 145.606, 130.725, 121.955], ['A', ' OD1', 145.471, 131.221, 120.857], ['A', ' OD2', 144.654, 130.617, 122.708], ['A', ' H ', 146.118, 127.72, 122.13], ['A', ' HA ', 147.378, 129.669, 120.325], ['A', ' HB ', 146.893, 129.671, 123.32], ['A', ' HB ', 147.677, 130.997, 122.465]] AA_SCO= 1.9900000000000002 CA_SCO= 1.2667368421052632
[['A', ' N ', 149.651, 128.636, 120.392], ['A', ' CA ', 151.045, 128.229, 120.431], ['A', ' C ', 151.982, 129.308, 119.924], ['A', ' O ', 151.896, 129.726, 118.771], ['A', ' CB ', 151.235, 126.967, 119.584], ['A', ' CG1', 150.356, 125.862, 120.151], ['A', ' CG2', 152.668, 126.544, 119.556], ['A', ' CD1', 150.264, 124.598, 119.33], ['A', ' H ', 149.15, 128.672, 119.482], ['A', ' HA ', 151.312, 128.004, 121.463], ['A', ' HB ', 150.911, 127.176, 118.581], ['A', ' HG1', 150.724, 125.623, 121.11], ['A', ' HG1', 149.355, 126.245, 120.262], ['A', ' HG2', 152.782, 125.667, 118.942], ['A', ' HG2', 153.296, 127.33, 119.14], ['A', ' HG2', 152.971, 126.326, 120.572], ['A', ' HD1', 149.624, 123.908, 119.847], ['A', ' HD1', 149.852, 124.804, 118.355], ['A', ' HD1', 151.233, 124.14, 119.212]] AA_SCO= 2.128421052631579 CA_SCO= 1.2650526315789474
[['A', ' N ', 152.904, 129.74, 120.774], ['A', ' CA ', 153.852, 130.76, 120.366], ['A', ' C ', 155.182, 130.154, 119.978], ['A', ' O ', 155.906, 129.607, 120.81], ['A', ' CB ', 154.087, 131.785, 121.466], ['A', ' CG ', 155.067, 132.888, 121.056], ['A', ' CD ', 155.294, 133.915, 122.112], ['A', ' OE1', 154.677, 133.835, 123.144], ['A', ' OE2', 156.093, 134.792, 121.884], ['A', ' H ', 152.929, 129.365, 121.714], ['A', ' HA ', 153.45, 131.28, 119.496], ['A', ' HB ', 153.14, 132.25, 121.742], ['A', ' HB ', 154.485, 131.291, 122.351], ['A', ' HG ', 156.032, 132.442, 120.808], ['A', ' HG ', 154.687, 133.375, 120.162]] AA_SCO= 2.1484210526315795 CA_SCO= 1.1014736842105262
[['A', ' N ', 155.511, 130.275, 118.712], ['A', ' CA ', 156.723, 129.701, 118.18], ['A', ' C ', 157.826, 130.772, 118.169], ['A', ' O ', 157.599, 131.833, 117.597], ['A', ' CB ', 156.447, 129.191, 116.769], ['A', ' CG1', 157.694, 128.617, 116.191], ['A', ' CG2', 155.318, 128.156, 116.827], ['A', ' H ', 154.865, 130.751, 118.097], ['A', ' HA ', 156.982, 128.853, 118.799], ['A', ' HB ', 156.147, 130.024, 116.136], ['A', ' HG1', 157.505, 128.273, 115.179], ['A', ' HG1', 158.464, 129.373, 116.171], ['A', ' HG1', 158.034, 127.772, 116.797], ['A', ' HG2', 155.096, 127.783, 115.828], ['A', ' HG2', 155.618, 127.332, 117.459], ['A', ' HG2', 154.414, 128.603, 117.236]] AA_SCO= 1.9457894736842105 CA_SCO= 1.075842105263158
[['A', ' N ', 158.987, 130.547, 118.808], ['A', ' CA ', 160.111, 131.469, 118.935], ['A', ' C ', 160.864, 131.634, 117.633], ['A', ' O ', 160.797, 130.754, 116.775], ['A', ' CB ', 160.984, 130.786, 119.988], ['A', ' CG ', 160.69, 129.326, 119.837], ['A', ' CD ', 159.225, 129.247, 119.472], ['A', ' HA ', 159.739, 132.441, 119.296], ['A', ' HB ', 162.05, 131.008, 119.795], ['A', ' HB ', 160.748, 131.172, 120.989], ['A', ' HG ', 161.339, 128.891, 119.058], ['A', ' HG ', 160.926, 128.784, 120.768], ['A', ' HD ', 159.113, 128.404, 118.777], ['A', ' HD ', 158.598, 129.139, 120.378]] AA_SCO= 1.9131578947368422 CA_SCO= 1.0908947368421054
[['A', ' N ', 161.651, 132.696, 117.493], ['A', ' CA ', 162.424, 132.789, 116.268], ['A', ' C ', 163.611, 131.858, 116.279], ['A', ' O ', 164.567, 131.987, 117.038], ['A', ' CB ', 162.865, 134.21, 115.984], ['A', ' CG ', 161.733, 135.122, 115.598], ['A', ' CD ', 162.241, 136.51, 115.266], ['A', ' CE ', 161.109, 137.428, 114.83], ['A', ' NZ ', 161.599, 138.798, 114.503], ['A', ' H ', 161.708, 133.412, 118.206], ['A', ' HA ', 161.793, 132.481, 115.441], ['A', ' HB ', 163.352, 134.623, 116.866], ['A', ' HB ', 163.595, 134.21, 115.18], ['A', ' HG ', 161.23, 134.709, 114.72], ['A', ' HG ', 161.013, 135.18, 116.413], ['A', ' HD ', 162.726, 136.939, 116.144], ['A', ' HD ', 162.974, 136.45, 114.463], ['A', ' HE ', 160.628, 137.005, 113.948], ['A', ' HE ', 160.375, 137.497, 115.633], ['A', ' HZ ', 160.823, 139.379, 114.217], ['A', ' HZ ', 162.038, 139.204, 115.319], ['A', ' HZ ', 162.272, 138.746, 113.752]] AA_SCO= 1.7726315789473683 CA_SCO= 1.0903684210526314
[['A', ' N ', 163.463, 130.914, 115.389], ['A', ' CA ', 164.251, 129.762, 115.035], ['A', ' C ', 163.184, 128.855, 114.489], ['A', ' O ', 163.036, 128.665, 113.286], ['A', ' CB ', 165.0, 129.154, 116.207], ['A', ' H ', 162.608, 131.005, 114.866], ['A', ' HA ', 164.952, 130.011, 114.241], ['A', ' HB ', 165.523, 128.256, 115.874], ['A', ' HB ', 165.73, 129.867, 116.579], ['A', ' HB ', 164.317, 128.892, 117.015]] AA_SCO= 1.84 CA_SCO= 1.109473684210526
[['A', ' N ', 162.264, 128.497, 115.366], ['A', ' CA ', 161.081, 127.747, 114.979], ['A', ' C ', 160.247, 128.559, 114.009], ['A', ' O ', 159.674, 128.026, 113.079], ['A', ' H ', 162.413, 128.707, 116.345], ['A', ' HA ', 161.368, 126.809, 114.511], ['A', ' HA ', 160.497, 127.498, 115.864]] AA_SCO= 1.844736842105263 CA_SCO= 1.119315789473684
[['A', ' N ', 160.246, 129.879, 114.175], ['A', ' CA ', 159.501, 130.791, 113.315], ['A', ' C ', 160.371, 131.328, 112.173], ['A', ' O ', 159.956, 132.227, 111.455], ['A', ' CB ', 158.964, 131.972, 114.139], ['A', ' CG ', 157.949, 132.926, 113.449], ['A', ' CD ', 157.61, 134.096, 114.293], ['A', ' NE ', 156.813, 133.757, 115.462], ['A', ' CZ ', 156.565, 134.598, 116.495], ['A', ' NH1', 157.064, 135.817, 116.501], ['A', ' NH2', 155.811, 134.207, 117.502], ['A', ' H ', 160.693, 130.233, 115.018], ['A', ' HA ', 158.656, 130.252, 112.891], ['A', ' HB ', 158.5, 131.594, 115.047], ['A', ' HB ', 159.79, 132.589, 114.445], ['A', ' HG ', 158.312, 133.353, 112.536], ['A', ' HG ', 157.032, 132.377, 113.247], ['A', ' HD ', 158.541, 134.549, 114.633], ['A', ' HD ', 157.052, 134.815, 113.696], ['A', ' HE ', 156.408, 132.83, 115.504], ['A', ' HH1', 157.637, 136.131, 115.739], ['A', ' HH1', 156.872, 136.436, 117.277], ['A', ' HH2', 155.418, 133.28, 117.5], ['A', ' HH2', 155.622, 134.842, 118.265]] AA_SCO= 1.893684210526316 CA_SCO= 1.145052631578947
[['A', ' N ', 161.607, 130.857, 112.035], ['A', ' CA ', 162.445, 131.333, 110.938], ['A', ' C ', 162.54, 130.252, 109.919], ['A', ' O ', 162.319, 130.474, 108.747], ['A', ' CB ', 163.849, 131.689, 111.4], ['A', ' CG ', 163.974, 132.793, 112.421], ['A', ' CD1', 165.425, 132.915, 112.811], ['A', ' CD2', 163.464, 134.099, 111.864], ['A', ' H ', 161.933, 130.093, 112.619], ['A', ' HA ', 161.978, 132.188, 110.456], ['A', ' HB ', 164.304, 130.795, 111.819], ['A', ' HB ', 164.422, 131.98, 110.527], ['A', ' HG ', 163.403, 132.544, 113.288], ['A', ' HD1', 165.534, 133.696, 113.562], ['A', ' HD1', 165.776, 131.975, 113.222], ['A', ' HD1', 166.016, 133.171, 111.931], ['A', ' HD2', 163.575, 134.877, 112.615], ['A', ' HD2', 164.036, 134.373, 110.976], ['A', ' HD2', 162.411, 134.017, 111.602]] AA_SCO= 1.7342105263157892 CA_SCO= 1.1441052631578947
[['A', ' N ', 162.612, 129.022, 110.381], ['A', ' CA ', 162.804, 127.839, 109.562], ['A', ' C ', 161.461, 127.293, 109.05], ['A', ' O ', 161.256, 126.089, 108.899], ['A', ' CB ', 163.451, 126.794, 110.469], ['A', ' CG ', 164.796, 127.165, 111.126], ['A', ' CD1', 165.221, 126.042, 112.073], ['A', ' CD2', 165.802, 127.407, 110.1], ['A', ' H ', 162.688, 128.894, 111.385], ['A', ' HA ', 163.426, 128.088, 108.704], ['A', ' HB ', 162.748, 126.557, 111.279], ['A', ' HB ', 163.608, 125.924, 109.9], ['A', ' HG ', 164.692, 128.065, 111.71], ['A', ' HD1', 166.16, 126.308, 112.551], ['A', ' HD1', 164.455, 125.903, 112.843], ['A', ' HD1', 165.345, 125.113, 111.521], ['A', ' HD2', 166.718, 127.643, 110.568], ['A', ' HD2', 165.932, 126.539, 109.518], ['A', ' HD2', 165.508, 128.232, 109.468]] AA_SCO= 1.7657894736842104 CA_SCO= 1.1490000000000002
[['A', ' N ', 160.532, 128.208, 108.824], ['A', ' CA ', 159.193, 127.96, 108.331], ['A', ' C ', 159.24, 128.645, 107.007], ['A', ' O ', 158.484, 128.344, 106.092], ['A', ' CB ', 158.149, 128.569, 109.234], ['A', ' CG ', 158.219, 128.072, 110.629], ['A', ' CD ', 157.688, 126.686, 110.885], ['A', ' NE ', 156.231, 126.637, 110.746], ['A', ' CZ ', 155.341, 126.976, 111.721], ['A', ' NH1', 155.719, 127.376, 112.894], ['A', ' NH2', 154.056, 126.926, 111.531], ['A', ' H ', 160.867, 129.168, 108.855], ['A', ' HA ', 159.022, 126.895, 108.187], ['A', ' HB ', 158.271, 129.652, 109.251], ['A', ' HB ', 157.165, 128.348, 108.858], ['A', ' HG ', 159.264, 128.049, 110.85], ['A', ' HG ', 157.72, 128.769, 111.289], ['A', ' HD ', 158.124, 125.981, 110.175], ['A', ' HD ', 157.958, 126.371, 111.895], ['A', ' HE ', 155.855, 126.343, 109.859], ['A', ' HH1', 156.703, 127.456, 113.114], ['A', ' HH1', 154.966, 127.609, 113.579], ['A', ' HH2', 153.654, 126.634, 110.642], ['A', ' HH2', 153.452, 127.216, 112.33]] AA_SCO= 1.7463157894736838 CA_SCO= 1.1481578947368423
[['A', ' N ', 160.144, 129.617, 106.958], ['A', ' CA ', 160.499, 130.322, 105.757], ['A', ' C ', 161.885, 129.716, 105.664], ['A', ' O ', 162.157, 128.862, 106.501], ['A', ' CB ', 160.353, 131.842, 105.808], ['A', ' CG ', 161.059, 132.582, 106.858], ['A', ' CD ', 160.862, 134.06, 106.678], ['A', ' OE1', 160.611, 134.463, 105.569], ['A', ' OE2', 160.959, 134.791, 107.625], ['A', ' H ', 160.713, 129.818, 107.783], ['A', ' HA ', 159.909, 129.97, 104.912], ['A', ' HB ', 160.672, 132.253, 104.85], ['A', ' HB ', 159.301, 132.084, 105.915], ['A', ' HG ', 160.656, 132.288, 107.832], ['A', ' HG ', 162.108, 132.335, 106.842]] AA_SCO= 1.833157894736842 CA_SCO= 1.1398947368421053
[['A', ' N ', 162.718, 130.007, 104.661], ['A', ' CA ', 163.974, 129.227, 104.42], ['A', ' C ', 163.511, 127.903, 103.808], ['A', ' O ', 163.81, 127.586, 102.664], ['A', ' CB ', 164.855, 128.949, 105.641], ['A', ' CG ', 166.12, 128.107, 105.354], ['A', ' CD1', 167.031, 128.813, 104.382], ['A', ' CD2', 166.825, 127.847, 106.642], ['A', ' H ', 162.464, 130.745, 104.028], ['A', ' HA ', 164.559, 129.764, 103.684], ['A', ' HB ', 165.149, 129.88, 106.048], ['A', ' HB ', 164.335, 128.394, 106.392], ['A', ' HG ', 165.832, 127.155, 104.916], ['A', ' HD1', 167.911, 128.2, 104.206], ['A', ' HD1', 166.537, 128.965, 103.444], ['A', ' HD1', 167.327, 129.768, 104.789], ['A', ' HD2', 167.701, 127.235, 106.45], ['A', ' HD2', 167.129, 128.787, 107.103], ['A', ' HD2', 166.15, 127.317, 107.294]] AA_SCO= 1.8631578947368421 CA_SCO= 1.1393684210526316
[['A', ' N ', 162.735, 127.186, 104.601], ['A', ' CA ', 161.873, 126.104, 104.243], ['A', ' C ', 160.92, 126.926, 103.368], ['A', ' O ', 160.792, 128.119, 103.601], ['A', ' CB ', 161.136, 125.573, 105.494], ['A', ' OG1', 162.069, 125.162, 106.502], ['A', ' CG2', 160.327, 124.414, 105.139], ['A', ' H ', 162.676, 127.494, 105.562], ['A', ' HA ', 162.383, 125.333, 103.667], ['A', ' HB ', 160.507, 126.37, 105.896], ['A', ' HG1', 161.647, 125.249, 107.412], ['A', ' HG2', 159.811, 124.057, 106.027], ['A', ' HG2', 159.613, 124.708, 104.405], ['A', ' HG2', 160.97, 123.627, 104.742]] AA_SCO= 1.795263157894737 CA_SCO= 1.0716315789473683
[['A', ' N ', 160.378, 126.394, 102.3], ['A', ' CA ', 159.51, 127.157, 101.365], ['A', ' C ', 160.29, 128.045, 100.456], ['A', ' O ', 160.09, 128.036, 99.251], ['A', ' CB ', 158.497, 128.117, 101.978], ['A', ' CG ', 157.426, 127.576, 102.688], ['A', ' CD1', 156.742, 128.676, 103.333], ['A', ' CD2', 156.473, 126.891, 101.75], ['A', ' H ', 160.587, 125.416, 102.13], ['A', ' HA ', 158.966, 126.454, 100.768], ['A', ' HB ', 158.958, 128.877, 102.575], ['A', ' HB ', 158.049, 128.648, 101.137], ['A', ' HG ', 157.798, 126.895, 103.433], ['A', ' HD1', 155.918, 128.292, 103.905], ['A', ' HD1', 157.448, 129.17, 103.992], ['A', ' HD1', 156.381, 129.373, 102.586], ['A', ' HD2', 155.644, 126.511, 102.315], ['A', ' HD2', 156.111, 127.612, 101.016], ['A', ' HD2', 156.937, 126.07, 101.238]] AA_SCO= 1.849473684210526 CA_SCO= 1.2085263157894737
[['A', ' N ', 161.133, 128.894, 100.994], ['A', ' CA ', 161.9, 129.701, 100.075], ['A', ' C ', 162.709, 128.7, 99.223], ['A', ' O ', 162.709, 128.723, 97.979], ['A', ' CB ', 162.729, 130.682, 100.856], ['A', ' H ', 161.228, 128.91, 102.009], ['A', ' HA ', 161.222, 130.245, 99.416], ['A', ' HB ', 163.307, 131.266, 100.191], ['A', ' HB ', 162.071, 131.328, 101.433], ['A', ' HB ', 163.378, 130.137, 101.521]] AA_SCO= 1.8431578947368419 CA_SCO= 1.2193157894736841
[['A', ' N ', 163.269, 127.712, 99.91], ['A', ' CA ', 163.868, 126.573, 99.289], ['A', ' C ', 162.696, 125.629, 99.241], ['A', ' O ', 162.163, 125.24, 100.271], ['A', ' CB ', 165.046, 126.047, 100.063], ['A', ' H ', 163.281, 127.743, 100.927], ['A', ' HA ', 164.167, 126.815, 98.275], ['A', ' HB ', 165.424, 125.148, 99.582], ['A', ' HB ', 165.821, 126.814, 100.086], ['A', ' HB ', 164.733, 125.812, 101.075]] AA_SCO= 1.7752631578947367 CA_SCO= 1.2178947368421054
[['A', ' N ', 162.223, 125.388, 98.055], ['A', ' CA ', 161.008, 124.663, 97.735], ['A', ' C ', 160.324, 125.438, 96.65], ['A', ' O ', 160.038, 124.883, 95.593], ['A', ' CB ', 160.062, 124.451, 98.874], ['A', ' CG ', 158.869, 123.857, 98.419], ['A', ' ND1', 158.835, 122.607, 97.897], ['A', ' CD2', 157.617, 124.321, 98.379], ['A', ' CE1', 157.62, 122.32, 97.544], ['A', ' NE2', 156.845, 123.344, 97.826], ['A', ' H ', 162.757, 125.782, 97.303], ['A', ' HA ', 161.251, 123.685, 97.362], ['A', ' HB ', 160.481, 123.784, 99.619], ['A', ' HB ', 159.845, 125.36, 99.293], ['A', ' HD1', 159.603, 121.979, 97.786], ['A', ' HD2', 157.175, 125.267, 98.683], ['A', ' HE1', 157.407, 121.368, 97.087]] AA_SCO= 1.786315789473684 CA_SCO= 1.6087368421052632
[['A', ' N ', 160.138, 126.743, 96.839], ['A', ' CA ', 159.6, 127.519, 95.755], ['A', ' C ', 160.582, 127.411, 94.634], ['A', ' O ', 160.227, 127.003, 93.535], ['A', ' CB ', 159.461, 128.997, 96.101], ['A', ' CG ', 158.377, 129.348, 96.995], ['A', ' ND1', 158.098, 130.64, 97.297], ['A', ' CD2', 157.491, 128.608, 97.673], ['A', ' CE1', 157.069, 130.692, 98.091], ['A', ' NE2', 156.675, 129.481, 98.343], ['A', ' H ', 160.301, 127.19, 97.738], ['A', ' HA ', 158.648, 127.121, 95.431], ['A', ' HB ', 160.38, 129.324, 96.58], ['A', ' HB ', 159.348, 129.585, 95.187], ['A', ' HD2', 157.437, 127.527, 97.673], ['A', ' HE1', 156.612, 131.595, 98.479], ['A', ' HE2', 155.872, 129.279, 98.947]] AA_SCO= 1.8173684210526317 CA_SCO= 1.610578947368421
[['A', ' N ', 161.867, 127.524, 94.935], ['A', ' CA ', 162.836, 127.401, 93.857], ['A', ' C ', 162.709, 126.015, 93.215], ['A', ' O ', 162.772, 125.884, 91.993], ['A', ' CB ', 164.279, 127.62, 94.376], ['A', ' CG1', 165.322, 127.291, 93.275], ['A', ' CG2', 164.444, 129.074, 94.828], ['A', ' H ', 162.135, 127.838, 95.877], ['A', ' HA ', 162.618, 128.156, 93.105], ['A', ' HB ', 164.465, 126.948, 95.215], ['A', ' HG1', 166.331, 127.446, 93.667], ['A', ' HG1', 165.238, 126.249, 92.949], ['A', ' HG1', 165.168, 127.945, 92.421], ['A', ' HG2', 165.454, 129.218, 95.202], ['A', ' HG2', 164.269, 129.747, 93.984], ['A', ' HG2', 163.734, 129.305, 95.623]] AA_SCO= 1.8157894736842106 CA_SCO= 1.6123157894736841
[['A', ' N ', 162.528, 124.998, 94.047], ['A', ' CA ', 162.435, 123.61, 93.616], ['A', ' C ', 161.131, 123.286, 92.896], ['A', ' O ', 161.064, 122.284, 92.187], ['A', ' CB ', 162.495, 122.673, 94.797], ['A', ' CG ', 163.773, 122.734, 95.53], ['A', ' OD1', 164.733, 123.313, 95.046], ['A', ' ND2', 163.8, 122.15, 96.701], ['A', ' H ', 162.484, 125.217, 95.025], ['A', ' HA ', 163.257, 123.411, 92.932], ['A', ' HB ', 161.675, 122.864, 95.443], ['A', ' HB ', 162.366, 121.653, 94.437], ['A', ' HD2', 164.641, 122.149, 97.266], ['A', ' HD2', 162.989, 121.687, 97.044]] AA_SCO= 1.769473684210526 CA_SCO= 1.8479473684210528
[['A', ' N ', 160.08, 124.071, 93.145], ['A', ' CA ', 158.775, 123.856, 92.553], ['A', ' C ', 158.655, 124.612, 91.258], ['A', ' O ', 157.889, 124.215, 90.374], ['A', ' CB ', 157.707, 124.316, 93.49], ['A', ' OG ', 157.712, 123.557, 94.647], ['A', ' H ', 160.179, 124.874, 93.761], ['A', ' HA ', 158.651, 122.792, 92.348], ['A', ' HB ', 157.886, 125.358, 93.738], ['A', ' HB ', 156.737, 124.248, 93.004], ['A', ' HG ', 158.495, 123.873, 95.145]] AA_SCO= 1.9736842105263157 CA_SCO= 1.8732105263157894
[['A', ' N ', 159.395, 125.71, 91.136], ['A', ' CA ', 159.397, 126.432, 89.889], ['A', ' C ', 160.306, 125.601, 88.983], ['A', ' O ', 160.004, 125.371, 87.812], ['A', ' CB ', 159.836, 127.848, 90.093], ['A', ' CG ', 158.864, 128.62, 90.915], ['A', ' ND1', 157.528, 128.681, 90.607], ['A', ' CD2', 159.029, 129.377, 92.017], ['A', ' CE1', 156.915, 129.439, 91.492], ['A', ' NE2', 157.802, 129.867, 92.351], ['A', ' H ', 159.928, 126.046, 91.936], ['A', ' HA ', 158.401, 126.449, 89.453], ['A', ' HB ', 160.77, 127.813, 90.619], ['A', ' HB ', 159.975, 128.347, 89.138], ['A', ' HD2', 159.964, 129.57, 92.544], ['A', ' HE1', 155.849, 129.679, 91.514], ['A', ' HE2', 157.586, 130.492, 93.143]] AA_SCO= 2.0436842105263153 CA_SCO= 1.791315789473684
[['A', ' N ', 161.358, 125.03, 89.567], ['A', ' CA ', 162.128, 124.018, 88.883], ['A', ' C ', 161.061, 122.935, 88.824], ['A', ' O ', 160.06, 123.102, 89.477], ['A', ' CB ', 163.387, 123.619, 89.626], ['A', ' H ', 161.649, 125.321, 90.5], ['A', ' HA ', 162.377, 124.343, 87.873], ['A', ' HB ', 163.887, 122.812, 89.11], ['A', ' HB ', 164.057, 124.479, 89.692], ['A', ' HB ', 163.124, 123.297, 90.619]] AA_SCO= 2.178421052631579 CA_SCO= 1.6744736842105261
[['A', ' N ', 161.137, 121.939, 87.985], ['A', ' CA ', 160.001, 120.998, 87.828], ['A', ' C ', 158.958, 121.713, 86.953], ['A', ' O ', 158.727, 121.302, 85.826], ['A', ' CB ', 159.331, 120.465, 89.129], ['A', ' CG1', 160.365, 119.72, 90.032], ['A', ' CG2', 158.169, 119.532, 88.729], ['A', ' CD1', 161.05, 118.493, 89.422], ['A', ' H ', 161.984, 121.829, 87.45], ['A', ' HA ', 160.34, 120.122, 87.302], ['A', ' HB ', 158.877, 121.243, 89.719], ['A', ' HG1', 161.121, 120.436, 90.323], ['A', ' HG1', 159.843, 119.397, 90.933], ['A', ' HG2', 157.687, 119.149, 89.628], ['A', ' HG2', 157.432, 120.076, 88.144], ['A', ' HG2', 158.536, 118.708, 88.137], ['A', ' HD1', 161.721, 118.065, 90.155], ['A', ' HD1', 160.325, 117.767, 89.167], ['A', ' HD1', 161.613, 118.766, 88.541]] AA_SCO= 2.196315789473684 CA_SCO= 1.6453157894736843
[['A', ' N ', 158.399, 122.841, 87.356], ['A', ' CA ', 157.518, 123.528, 86.409], ['A', ' C ', 158.297, 123.837, 85.127], ['A', ' O ', 157.83, 123.582, 84.017], ['A', ' CB ', 156.943, 124.795, 86.982], ['A', ' CG ', 156.172, 125.576, 86.037], ['A', ' ND1', 154.978, 125.175, 85.538], ['A', ' CD2', 156.413, 126.778, 85.533], ['A', ' CE1', 154.484, 126.12, 84.774], ['A', ' NE2', 155.326, 127.135, 84.768], ['A', ' H ', 158.556, 123.2, 88.316], ['A', ' HA ', 156.683, 122.881, 86.149], ['A', ' HB ', 156.302, 124.548, 87.832], ['A', ' HB ', 157.715, 125.423, 87.348], ['A', ' HD1', 154.469, 124.309, 85.777], ['A', ' HD2', 157.245, 127.471, 85.666], ['A', ' HE1', 153.513, 125.985, 84.29]] AA_SCO= 2.0784210526315787 CA_SCO= 1.6445263157894738
[['A', ' N ', 159.543, 124.281, 85.274], ['A', ' CA ', 160.409, 124.628, 84.153], ['A', ' C ', 161.169, 123.396, 83.634], ['A', ' O ', 162.201, 123.512, 82.982], ['A', ' CB ', 161.418, 125.721, 84.54], ['A', ' CG ', 160.809, 127.061, 84.866], ['A', ' ND1', 160.224, 127.863, 83.916], ['A', ' CD2', 160.733, 127.742, 86.026], ['A', ' CE1', 159.791, 128.972, 84.484], ['A', ' NE2', 160.079, 128.915, 85.769], ['A', ' H ', 159.853, 124.49, 86.225], ['A', ' HA ', 159.801, 125.011, 83.335], ['A', ' HB ', 161.984, 125.393, 85.414], ['A', ' HB ', 162.128, 125.866, 83.729], ['A', ' HD1', 160.161, 127.668, 82.938], ['A', ' HD2', 161.071, 127.522, 87.028], ['A', ' HE1', 159.28, 129.742, 83.89]] AA_SCO= 2.1042105263157893 CA_SCO= 1.6444210526315792
[['A', ' N ', 160.656, 122.217, 83.961], ['A', ' CA ', 161.094, 120.91, 83.488], ['A', ' C ', 159.967, 120.36, 82.63], ['A', ' O ', 160.18, 119.907, 81.511], ['A', ' CB ', 161.355, 119.976, 84.651], ['A', ' CG ', 161.687, 118.614, 84.329], ['A', ' CD1', 162.857, 118.257, 83.721], ['A', ' CD2', 160.776, 117.629, 84.676], ['A', ' CE1', 163.098, 116.936, 83.447], ['A', ' CE2', 161.026, 116.326, 84.41], ['A', ' CZ ', 162.185, 115.978, 83.792], ['A', ' H ', 159.839, 122.219, 84.558], ['A', ' HA ', 161.992, 121.021, 82.879], ['A', ' HB ', 162.116, 120.381, 85.299], ['A', ' HB ', 160.472, 119.911, 85.193], ['A', ' HD1', 163.585, 119.023, 83.445], ['A', ' HD2', 159.843, 117.911, 85.168], ['A', ' HE1', 164.013, 116.641, 82.951], ['A', ' HE2', 160.301, 115.561, 84.684], ['A', ' HZ ', 162.385, 114.941, 83.572]] AA_SCO= 2.2468421052631578 CA_SCO= 1.6490526315789475
[['A', ' N ', 158.759, 120.426, 83.19], ['A', ' CA ', 157.514, 119.989, 82.586], ['A', ' C ', 157.068, 120.877, 81.445], ['A', ' O ', 156.522, 120.401, 80.458], ['A', ' CB ', 156.42, 120.035, 83.645], ['A', ' CG ', 156.48, 119.028, 84.763], ['A', ' CD1', 155.473, 119.429, 85.804], ['A', ' CD2', 156.131, 117.667, 84.226], ['A', ' H ', 158.702, 120.781, 84.131], ['A', ' HA ', 157.648, 118.984, 82.207], ['A', ' HB ', 156.443, 121.026, 84.103], ['A', ' HB ', 155.458, 119.921, 83.147], ['A', ' HG ', 157.472, 119.015, 85.212], ['A', ' HD1', 155.482, 118.713, 86.626], ['A', ' HD1', 155.716, 120.423, 86.188], ['A', ' HD1', 154.48, 119.449, 85.353], ['A', ' HD2', 156.127, 116.945, 85.007], ['A', ' HD2', 155.138, 117.702, 83.803], ['A', ' HD2', 156.834, 117.348, 83.467]] AA_SCO= 2.183684210526316 CA_SCO= 1.6488947368421056
[['A', ' N ', 157.31, 122.17, 81.535], ['A', ' CA ', 156.856, 123.065, 80.488], ['A', ' C ', 157.981, 123.304, 79.502], ['A', ' O ', 157.755, 123.655, 78.337], ['A', ' CB ', 156.332, 124.396, 81.046], ['A', ' CG1', 154.941, 124.288, 81.614], ['A', ' CG2', 156.222, 125.385, 79.925], ['A', ' CD1', 154.653, 123.202, 82.633], ['A', ' H ', 157.735, 122.561, 82.38], ['A', ' HA ', 156.038, 122.588, 79.947], ['A', ' HB ', 156.988, 124.77, 81.828], ['A', ' HG1', 154.73, 125.24, 82.087], ['A', ' HG1', 154.285, 124.176, 80.793], ['A', ' HG2', 155.814, 126.299, 80.306], ['A', ' HG2', 157.182, 125.585, 79.507], ['A', ' HG2', 155.551, 124.996, 79.149], ['A', ' HD1', 153.627, 123.298, 82.95], ['A', ' HD1', 154.785, 122.223, 82.206], ['A', ' HD1', 155.305, 123.316, 83.493]] AA_SCO= 2.1536842105263156 CA_SCO= 1.6497368421052634
[['A', ' N ', 159.201, 123.081, 79.941], ['A', ' CA ', 160.336, 123.316, 79.093], ['A', ' C ', 160.203, 122.703, 77.694], ['A', ' O ', 160.493, 123.415, 76.75], ['A', ' CB ', 161.591, 122.816, 79.763], ['A', ' H ', 159.354, 122.787, 80.899], ['A', ' HA ', 160.432, 124.393, 78.965], ['A', ' HB ', 162.446, 123.038, 79.15], ['A', ' HB ', 161.691, 123.315, 80.699], ['A', ' HB ', 161.558, 121.76, 79.935]] AA_SCO= 2.0352631578947364 CA_SCO= 1.5956842105263165
[['A', ' N ', 159.685, 121.482, 77.439], ['A', ' CA ', 159.596, 120.929, 76.101], ['A', ' C ', 158.758, 121.8, 75.15], ['A', ' O ', 158.832, 121.624, 73.935], ['A', ' CB ', 158.947, 119.57, 76.331], ['A', ' CG ', 159.274, 119.24, 77.756], ['A', ' CD ', 159.232, 120.556, 78.467], ['A', ' HA ', 160.615, 120.811, 75.703], ['A', ' HB ', 157.879, 119.637, 76.125], ['A', ' HB ', 159.362, 118.837, 75.621], ['A', ' HG ', 158.548, 118.521, 78.16], ['A', ' HG ', 160.25, 118.759, 77.822], ['A', ' HD ', 158.206, 120.749, 78.736], ['A', ' HD ', 159.882, 120.531, 79.3]] AA_SCO= 1.8973684210526311 CA_SCO= 1.593789473684211
[['A', ' N ', 157.928, 122.706, 75.685], ['A', ' CA ', 157.125, 123.554, 74.825], ['A', ' C ', 157.873, 124.826, 74.445], ['A', ' O ', 157.614, 125.402, 73.386], ['A', ' CB ', 155.833, 123.963, 75.513], ['A', ' CG ', 154.955, 122.794, 75.822], ['A', ' OD1', 154.805, 121.908, 75.002], ['A', ' OD2', 154.435, 122.772, 76.912], ['A', ' H ', 157.868, 122.852, 76.69], ['A', ' HA ', 156.887, 123.005, 73.915], ['A', ' HB ', 156.076, 124.479, 76.447], ['A', ' HB ', 155.302, 124.668, 74.889]] AA_SCO= 1.9131578947368415 CA_SCO= 1.5761578947368426
[['A', ' N ', 158.771, 125.297, 75.316], ['A', ' CA ', 159.469, 126.556, 75.006], ['A', ' C ', 160.961, 126.436, 74.723], ['A', ' O ', 161.559, 127.339, 74.137], ['A', ' CB ', 159.243, 127.593, 76.095], ['A', ' CG ', 157.824, 127.985, 76.203], ['A', ' CD1', 157.106, 127.651, 77.293], ['A', ' CD2', 157.194, 128.678, 75.175], ['A', ' CE1', 155.785, 127.99, 77.399], ['A', ' CE2', 155.871, 129.024, 75.271], ['A', ' CZ ', 155.166, 128.677, 76.392], ['A', ' H ', 158.95, 124.762, 76.179], ['A', ' HA ', 159.021, 126.957, 74.099], ['A', ' HB ', 159.566, 127.192, 77.055], ['A', ' HB ', 159.835, 128.48, 75.891], ['A', ' HD1', 157.596, 127.112, 78.09], ['A', ' HD2', 157.755, 128.953, 74.273], ['A', ' HE1', 155.225, 127.71, 78.29], ['A', ' HE2', 155.387, 129.567, 74.456], ['A', ' HZ ', 154.119, 128.942, 76.482]] AA_SCO= 1.921578947368421 CA_SCO= 1.5760526315789478
[['A', ' N ', 161.559, 125.349, 75.145], ['A', ' CA ', 162.97, 125.11, 74.984], ['A', ' C ', 163.175, 124.252, 73.736], ['A', ' O ', 162.604, 123.171, 73.654], ['A', ' CB ', 163.518, 124.378, 76.218], ['A', ' CG1', 164.967, 124.05, 76.046], ['A', ' CG2', 163.351, 125.233, 77.444], ['A', ' H ', 161.013, 124.642, 75.619], ['A', ' HA ', 163.475, 126.061, 74.922], ['A', ' HB ', 162.971, 123.465, 76.339], ['A', ' HG1', 165.325, 123.523, 76.915], ['A', ' HG1', 165.103, 123.417, 75.183], ['A', ' HG1', 165.529, 124.969, 75.921], ['A', ' HG2', 163.726, 124.704, 78.313], ['A', ' HG2', 163.905, 126.134, 77.329], ['A', ' HG2', 162.301, 125.465, 77.587]] AA_SCO= 1.9157894736842105 CA_SCO= 1.576368421052632
[['A', ' N ', 163.967, 124.682, 72.75], ['A', ' CA ', 164.247, 123.938, 71.543], ['A', ' C ', 164.812, 122.618, 71.979], ['A', ' O ', 165.543, 122.579, 72.963], ['A', ' CB ', 165.295, 124.795, 70.84], ['A', ' CG ', 165.05, 126.189, 71.363], ['A', ' CD ', 164.595, 126.005, 72.796], ['A', ' HA ', 163.327, 123.812, 70.948], ['A', ' HB ', 166.298, 124.414, 71.067], ['A', ' HB ', 165.167, 124.724, 69.75], ['A', ' HG ', 165.966, 126.794, 71.284], ['A', ' HG ', 164.287, 126.692, 70.747], ['A', ' HD ', 165.431, 126.011, 73.491], ['A', ' HD ', 163.859, 126.801, 72.996]] AA_SCO= 1.9121052631578948 CA_SCO= 1.5647368421052636
[['A', ' N ', 164.592, 121.55, 71.229], ['A', ' CA ', 165.081, 120.253, 71.683], ['A', ' C ', 166.59, 120.221, 71.87], ['A', ' O ', 167.092, 119.518, 72.746], ['A', ' CB ', 164.635, 119.142, 70.72], ['A', ' CG ', 165.14, 119.239, 69.26], ['A', ' CD ', 164.273, 120.104, 68.371], ['A', ' OE1', 163.616, 120.988, 68.884], ['A', ' OE2', 164.266, 119.881, 67.187], ['A', ' H ', 164.021, 121.606, 70.379], ['A', ' HA ', 164.615, 120.043, 72.641], ['A', ' HB ', 164.967, 118.18, 71.111], ['A', ' HB ', 163.546, 119.116, 70.687], ['A', ' HG ', 166.157, 119.611, 69.229], ['A', ' HG ', 165.156, 118.232, 68.847]] AA_SCO= 1.881052631578947 CA_SCO= 1.5677894736842106
[['A', ' N ', 167.306, 121.077, 71.158], ['A', ' CA ', 168.751, 121.149, 71.23], ['A', ' C ', 169.237, 121.634, 72.584], ['A', ' O ', 170.398, 121.436, 72.941], ['A', ' CB ', 169.256, 122.081, 70.163], ['A', ' CG ', 169.119, 121.508, 68.813], ['A', ' OD1', 169.04, 120.289, 68.626], ['A', ' ND2', 169.074, 122.368, 67.837], ['A', ' H ', 166.831, 121.646, 70.471], ['A', ' HA ', 169.157, 120.149, 71.071], ['A', ' HB ', 168.698, 123.018, 70.209], ['A', ' HB ', 170.304, 122.314, 70.347], ['A', ' HD2', 168.977, 122.047, 66.894], ['A', ' HD2', 169.139, 123.348, 68.026]] AA_SCO= 1.8257894736842104 CA_SCO= 1.5677894736842106
[['A', ' N ', 168.373, 122.332, 73.309], ['A', ' CA ', 168.7, 122.895, 74.598], ['A', ' C ', 168.137, 122.08, 75.743], ['A', ' O ', 168.331, 122.456, 76.901], ['A', ' CB ', 168.148, 124.317, 74.729], ['A', ' CG ', 168.981, 125.479, 74.18], ['A', ' CD1', 169.031, 125.42, 72.65], ['A', ' CD2', 168.351, 126.798, 74.673], ['A', ' H ', 167.414, 122.443, 72.976], ['A', ' HA ', 169.784, 122.923, 74.699], ['A', ' HB ', 167.195, 124.338, 74.203], ['A', ' HB ', 167.966, 124.518, 75.781], ['A', ' HG ', 170.004, 125.406, 74.553], ['A', ' HD1', 169.622, 126.256, 72.279], ['A', ' HD1', 169.491, 124.503, 72.324], ['A', ' HD1', 168.029, 125.486, 72.253], ['A', ' HD2', 168.936, 127.641, 74.307], ['A', ' HD2', 167.339, 126.886, 74.311], ['A', ' HD2', 168.345, 126.812, 75.762]] AA_SCO= 1.8305263157894738 CA_SCO= 1.5247368421052634
[['A', ' N ', 167.408, 120.998, 75.466], ['A', ' CA ', 166.802, 120.279, 76.573], ['A', ' C ', 167.795, 119.628, 77.496], ['A', ' O ', 167.559, 119.555, 78.694], ['A', ' CB ', 165.792, 119.262, 76.084], ['A', ' CG ', 164.485, 119.865, 75.599], ['A', ' SD ', 163.602, 120.79, 76.881], ['A', ' CE ', 163.181, 119.551, 78.072], ['A', ' H ', 167.29, 120.665, 74.503], ['A', ' HA ', 166.256, 121.007, 77.165], ['A', ' HB ', 166.221, 118.73, 75.233], ['A', ' HB ', 165.598, 118.523, 76.856], ['A', ' HG ', 164.714, 120.571, 74.804], ['A', ' HG ', 163.825, 119.096, 75.202], ['A', ' HE ', 162.623, 119.997, 78.886], ['A', ' HE ', 162.577, 118.785, 77.598], ['A', ' HE ', 164.082, 119.107, 78.469]] AA_SCO= 1.8626315789473684 CA_SCO= 1.5200000000000002
[['A', ' N ', 168.927, 119.145, 77.0], ['A', ' CA ', 169.843, 118.526, 77.946], ['A', ' C ', 170.324, 119.566, 78.939], ['A', ' O ', 170.435, 119.291, 80.133], ['A', ' CB ', 171.025, 117.912, 77.236], ['A', ' H ', 169.132, 119.192, 76.011], ['A', ' HA ', 169.304, 117.752, 78.493], ['A', ' HB ', 171.687, 117.452, 77.971], ['A', ' HB ', 170.678, 117.155, 76.534], ['A', ' HB ', 171.568, 118.69, 76.697]] AA_SCO= 1.8515789473684214 CA_SCO= 1.5203684210526316
[['A', ' N ', 170.555, 120.782, 78.453], ['A', ' CA ', 171.043, 121.836, 79.31], ['A', ' C ', 169.945, 122.362, 80.201], ['A', ' O ', 170.197, 122.71, 81.357], ['A', ' CB ', 171.583, 122.983, 78.473], ['A', ' CG ', 172.87, 122.658, 77.738], ['A', ' OD1', 173.557, 121.731, 78.094], ['A', ' OD2', 173.157, 123.36, 76.807], ['A', ' H ', 170.452, 120.946, 77.46], ['A', ' HA ', 171.842, 121.438, 79.933], ['A', ' HB ', 170.827, 123.272, 77.735], ['A', ' HB ', 171.757, 123.847, 79.114]] AA_SCO= 1.8247368421052632 CA_SCO= 1.6022105263157895
[['A', ' N ', 168.725, 122.46, 79.673], ['A', ' CA ', 167.629, 122.964, 80.47], ['A', ' C ', 167.338, 122.01, 81.603], ['A', ' O ', 167.1, 122.443, 82.733], ['A', ' CB ', 166.393, 123.158, 79.619], ['A', ' H ', 168.57, 122.21, 78.696], ['A', ' HA ', 167.926, 123.922, 80.893], ['A', ' HB ', 165.581, 123.552, 80.23], ['A', ' HB ', 166.625, 123.857, 78.82], ['A', ' HB ', 166.096, 122.202, 79.195]] AA_SCO= 1.8226315789473686 CA_SCO= 1.721684210526316
[['A', ' N ', 167.424, 120.709, 81.323], ['A', ' CA ', 167.175, 119.72, 82.339], ['A', ' C ', 168.284, 119.746, 83.346], ['A', ' O ', 168.032, 119.711, 84.55], ['A', ' CB ', 167.042, 118.31, 81.789], ['A', ' CG1', 165.787, 118.218, 80.935], ['A', ' CG2', 166.969, 117.351, 82.976], ['A', ' CD1', 165.704, 116.957, 80.102], ['A', ' H ', 167.617, 120.4, 80.365], ['A', ' HA ', 166.239, 119.959, 82.824], ['A', ' HB ', 167.898, 118.068, 81.149], ['A', ' HG1', 164.924, 118.274, 81.572], ['A', ' HG1', 165.761, 119.07, 80.266], ['A', ' HG2', 166.854, 116.348, 82.631], ['A', ' HG2', 167.868, 117.394, 83.586], ['A', ' HG2', 166.119, 117.631, 83.587], ['A', ' HD1', 164.788, 116.977, 79.514], ['A', ' HD1', 166.564, 116.915, 79.427], ['A', ' HD1', 165.696, 116.076, 80.73]] AA_SCO= 1.6205263157894736 CA_SCO= 1.7507894736842105
[['A', ' N ', 169.523, 119.794, 82.883], ['A', ' CA ', 170.603, 119.793, 83.824], ['A', ' C ', 170.565, 121.055, 84.667], ['A', ' O ', 170.909, 121.009, 85.851], ['A', ' CB ', 171.913, 119.668, 83.095], ['A', ' CG ', 172.112, 118.304, 82.533], ['A', ' OD1', 171.509, 117.326, 82.978], ['A', ' ND2', 172.956, 118.206, 81.547], ['A', ' H ', 169.725, 119.781, 81.878], ['A', ' HA ', 170.484, 118.942, 84.493], ['A', ' HB ', 171.939, 120.393, 82.279], ['A', ' HB ', 172.734, 119.9, 83.77], ['A', ' HD2', 173.127, 117.318, 81.125], ['A', ' HD2', 173.417, 119.019, 81.197]] AA_SCO= 1.742631578947368 CA_SCO= 1.7533157894736844
[['A', ' N ', 170.106, 122.171, 84.092], ['A', ' CA ', 170.034, 123.405, 84.844], ['A', ' C ', 168.997, 123.305, 85.938], ['A', ' O ', 169.302, 123.664, 87.074], ['A', ' CB ', 169.695, 124.562, 83.932], ['A', ' OG ', 170.728, 124.8, 83.015], ['A', ' H ', 169.878, 122.178, 83.098], ['A', ' HA ', 171.005, 123.588, 85.302], ['A', ' HB ', 168.773, 124.348, 83.398], ['A', ' HB ', 169.525, 125.454, 84.534], ['A', ' HG ', 170.675, 124.069, 82.364]] AA_SCO= 1.7236842105263157 CA_SCO= 1.753578947368421
[['A', ' N ', 167.814, 122.736, 85.647], ['A', ' CA ', 166.809, 122.624, 86.7], ['A', ' C ', 167.243, 121.628, 87.749], ['A', ' O ', 166.867, 121.766, 88.908], ['A', ' CB ', 165.388, 122.283, 86.195], ['A', ' CG1', 164.87, 123.399, 85.348], ['A', ' CG2', 165.389, 121.027, 85.41], ['A', ' H ', 167.617, 122.463, 84.677], ['A', ' HA ', 166.716, 123.594, 87.17], ['A', ' HB ', 164.732, 122.179, 87.04], ['A', ' HG1', 163.861, 123.171, 85.009], ['A', ' HG1', 164.854, 124.311, 85.942], ['A', ' HG1', 165.517, 123.535, 84.483], ['A', ' HG2', 164.393, 120.815, 85.059], ['A', ' HG2', 166.025, 121.18, 84.586], ['A', ' HG2', 165.743, 120.186, 85.989]] AA_SCO= 1.7984210526315791 CA_SCO= 1.7536315789473682
[['A', ' N ', 167.998, 120.6, 87.363], ['A', ' CA ', 168.486, 119.661, 88.346], ['A', ' C ', 169.497, 120.34, 89.249], ['A', ' O ', 169.394, 120.282, 90.471], ['A', ' CB ', 169.162, 118.502, 87.655], ['A', ' OG ', 168.251, 117.741, 86.928], ['A', ' H ', 168.208, 120.457, 86.368], ['A', ' HA ', 167.648, 119.309, 88.943], ['A', ' HB ', 169.915, 118.891, 86.981], ['A', ' HB ', 169.677, 117.883, 88.374], ['A', ' HG ', 168.788, 117.173, 86.355]] AA_SCO= 1.8142105263157895 CA_SCO= 1.754631578947368
[['A', ' N ', 170.4, 121.126, 88.693], ['A', ' CA ', 171.411, 121.74, 89.537], ['A', ' C ', 170.803, 122.71, 90.521], ['A', ' O ', 171.198, 122.747, 91.696], ['A', ' CB ', 172.446, 122.469, 88.683], ['A', ' CG ', 173.584, 123.15, 89.468], ['A', ' CD ', 174.454, 122.184, 90.235], ['A', ' OE1', 174.433, 121.012, 89.936], ['A', ' OE2', 175.152, 122.628, 91.117], ['A', ' H ', 170.464, 121.206, 87.673], ['A', ' HA ', 171.911, 120.95, 90.099], ['A', ' HB ', 172.89, 121.766, 87.977], ['A', ' HB ', 171.94, 123.238, 88.094], ['A', ' HG ', 174.207, 123.694, 88.761], ['A', ' HG ', 173.159, 123.879, 90.159]] AA_SCO= 2.007894736842105 CA_SCO= 1.7543684210526316
[['A', ' N ', 169.789, 123.451, 90.083], ['A', ' CA ', 169.241, 124.463, 90.957], ['A', ' C ', 168.09, 123.943, 91.777], ['A', ' O ', 167.374, 124.725, 92.393], ['A', ' CB ', 168.784, 125.716, 90.182], ['A', ' CG1', 167.612, 125.399, 89.296], ['A', ' CG2', 169.975, 126.248, 89.311], ['A', ' CD1', 166.969, 126.572, 88.663], ['A', ' H ', 169.481, 123.368, 89.107], ['A', ' HA ', 170.018, 124.746, 91.652], ['A', ' HB ', 168.47, 126.46, 90.894], ['A', ' HG1', 167.93, 124.757, 88.55], ['A', ' HG1', 166.843, 124.894, 89.877], ['A', ' HG2', 169.703, 127.145, 88.774], ['A', ' HG2', 170.817, 126.475, 89.929], ['A', ' HG2', 170.271, 125.485, 88.595], ['A', ' HD1', 166.135, 126.222, 88.055], ['A', ' HD1', 166.615, 127.232, 89.439], ['A', ' HD1', 167.661, 127.099, 88.033]] AA_SCO= 2.068421052631579 CA_SCO= 1.8174736842105261
[['A', ' N ', 167.882, 122.636, 91.746], ['A', ' CA ', 166.885, 122.005, 92.568], ['A', ' C ', 167.636, 121.175, 93.59], ['A', ' O ', 167.228, 121.107, 94.742], ['A', ' CB ', 165.934, 121.187, 91.731], ['A', ' CG ', 164.783, 120.574, 92.477], ['A', ' CD ', 163.786, 119.944, 91.583], ['A', ' NE ', 164.304, 118.763, 90.88], ['A', ' CZ ', 164.644, 118.707, 89.572], ['A', ' NH1', 164.558, 119.759, 88.804], ['A', ' NH2', 165.074, 117.581, 89.056], ['A', ' H ', 168.47, 122.044, 91.165], ['A', ' HA ', 166.316, 122.769, 93.091], ['A', ' HB ', 165.496, 121.84, 90.988], ['A', ' HB ', 166.486, 120.432, 91.2], ['A', ' HG ', 165.138, 119.843, 93.175], ['A', ' HG ', 164.292, 121.346, 93.014], ['A', ' HD ', 162.937, 119.627, 92.191], ['A', ' HD ', 163.44, 120.672, 90.863], ['A', ' HE ', 164.357, 117.891, 91.41], ['A', ' HH1', 164.253, 120.642, 89.182], ['A', ' HH1', 164.836, 119.688, 87.829], ['A', ' HH2', 165.175, 116.739, 89.639], ['A', ' HH2', 165.32, 117.546, 88.078]] AA_SCO= 2.2536842105263153 CA_SCO= 1.819894736842105
[['A', ' N ', 168.771, 120.577, 93.184], ['A', ' CA ', 169.619, 119.816, 94.09], ['A', ' C ', 170.11, 120.797, 95.142], ['A', ' O ', 169.955, 120.599, 96.352], ['A', ' CB ', 170.767, 119.19, 93.307], ['A', ' CG ', 171.711, 118.337, 94.103], ['A', ' CD ', 172.712, 117.578, 93.201], ['A', ' CE ', 173.757, 118.504, 92.556], ['A', ' NZ ', 174.834, 117.73, 91.836], ['A', ' H ', 169.037, 120.615, 92.207], ['A', ' HA ', 169.038, 119.042, 94.577], ['A', ' HB ', 170.375, 118.606, 92.494], ['A', ' HB ', 171.345, 119.996, 92.855], ['A', ' HG ', 172.271, 118.98, 94.756], ['A', ' HG ', 171.148, 117.628, 94.711], ['A', ' HD ', 173.232, 116.828, 93.798], ['A', ' HD ', 172.174, 117.065, 92.406], ['A', ' HE ', 173.271, 119.162, 91.835], ['A', ' HE ', 174.22, 119.112, 93.334], ['A', ' HZ ', 175.501, 118.369, 91.431], ['A', ' HZ ', 175.309, 117.12, 92.478], ['A', ' HZ ', 174.443, 117.145, 91.071]] AA_SCO= 2.2584210526315793 CA_SCO= 1.9053157894736839
[['A', ' N ', 170.607, 121.934, 94.693], ['A', ' CA ', 170.941, 122.958, 95.642], ['A', ' C ', 169.626, 123.618, 95.924], ['A', ' O ', 168.972, 124.116, 95.024], ['A', ' CB ', 172.026, 123.867, 95.151], ['A', ' CG ', 173.315, 123.167, 95.171], ['A', ' OD1', 173.629, 122.583, 96.227], ['A', ' ND2', 174.049, 123.19, 94.094], ['A', ' H ', 170.748, 122.087, 93.69], ['A', ' HA ', 171.283, 122.506, 96.566], ['A', ' HB ', 171.803, 124.167, 94.135], ['A', ' HB ', 172.09, 124.758, 95.773], ['A', ' HD2', 174.931, 122.72, 94.065], ['A', ' HD2', 173.739, 123.691, 93.278]] AA_SCO= 2.241052631578947 CA_SCO= 1.9053157894736839
[['A', ' N ', 169.235, 123.542, 97.189], ['A', ' CA ', 167.93, 123.922, 97.747], ['A', ' C ', 167.128, 122.654, 98.067], ['A', ' O ', 166.155, 122.7, 98.831], ['A', ' CB ', 167.11, 124.809, 96.807], ['A', ' H ', 169.928, 123.155, 97.809], ['A', ' HA ', 168.107, 124.471, 98.666], ['A', ' HB ', 166.172, 125.068, 97.282], ['A', ' HB ', 167.66, 125.721, 96.578], ['A', ' HB ', 166.878, 124.283, 95.885]] AA_SCO= 2.2673684210526317 CA_SCO= 1.8963684210526315
[['A', ' N ', 167.574, 121.494, 97.563], ['A', ' CA ', 167.005, 120.233, 98.018], ['A', ' C ', 167.55, 120.048, 99.38], ['A', ' O ', 166.833, 119.692, 100.306], ['A', ' CB ', 167.458, 119.019, 97.203], ['A', ' CG ', 166.808, 117.708, 97.6], ['A', ' CD ', 165.366, 117.707, 97.326], ['A', ' OE1', 165.017, 117.957, 96.172], ['A', ' NE2', 164.519, 117.414, 98.316], ['A', ' H ', 168.373, 121.467, 96.929], ['A', ' HA ', 165.919, 120.299, 98.057], ['A', ' HB ', 167.252, 119.18, 96.163], ['A', ' HB ', 168.528, 118.88, 97.31], ['A', ' HG ', 167.263, 116.9, 97.036], ['A', ' HG ', 166.951, 117.536, 98.667], ['A', ' HE2', 163.534, 117.391, 98.131], ['A', ' HE2', 164.865, 117.185, 99.27]] AA_SCO= 2.2468421052631578 CA_SCO= 1.9051578947368417
[['A', ' N ', 168.828, 120.411, 99.507], ['A', ' CA ', 169.556, 120.253, 100.747], ['A', ' C ', 169.009, 121.185, 101.776], ['A', ' O ', 168.941, 120.849, 102.944], ['A', ' CB ', 171.026, 120.588, 100.571], ['A', ' CG ', 171.753, 119.658, 99.714], ['A', ' CD1', 172.121, 120.062, 98.469], ['A', ' CD2', 172.06, 118.4, 100.153], ['A', ' CE1', 172.795, 119.226, 97.645], ['A', ' CE2', 172.744, 117.545, 99.323], ['A', ' CZ ', 173.113, 117.961, 98.066], ['A', ' OH ', 173.793, 117.105, 97.226], ['A', ' H ', 169.305, 120.687, 98.645], ['A', ' HA ', 169.442, 119.23, 101.101], ['A', ' HB ', 171.127, 121.59, 100.155], ['A', ' HB ', 171.51, 120.591, 101.548], ['A', ' HD1', 171.878, 121.057, 98.131], ['A', ' HD2', 171.765, 118.077, 101.153], ['A', ' HE1', 173.083, 119.571, 96.662], ['A', ' HE2', 172.991, 116.538, 99.662], ['A', ' HH ', 173.818, 116.231, 97.616]] AA_SCO= 2.274736842105263 CA_SCO= 1.889157894736842
[['A', ' N ', 168.572, 122.354, 101.371], ['A', ' CA ', 168.064, 123.239, 102.386], ['A', ' C ', 166.856, 122.652, 102.985], ['A', ' O ', 166.749, 122.639, 104.207], ['A', ' CB ', 167.709, 124.609, 101.849], ['A', ' CG1', 166.973, 125.437, 102.914], ['A', ' CG2', 168.925, 125.316, 101.474], ['A', ' H ', 168.629, 122.603, 100.4], ['A', ' HA ', 168.793, 123.344, 103.175], ['A', ' HB ', 167.076, 124.489, 100.997], ['A', ' HG1', 166.731, 126.417, 102.504], ['A', ' HG1', 166.04, 124.956, 103.218], ['A', ' HG1', 167.61, 125.561, 103.788], ['A', ' HG2', 168.635, 126.265, 101.102], ['A', ' HG2', 169.547, 125.448, 102.342], ['A', ' HG2', 169.471, 124.769, 100.716]] AA_SCO= 2.2863157894736843 CA_SCO= 1.883894736842105
[['A', ' N ', 165.941, 122.146, 102.174], ['A', ' CA ', 164.789, 121.622, 102.841], ['A', ' C ', 165.168, 120.347, 103.566], ['A', ' O ', 164.87, 120.188, 104.743], ['A', ' CB ', 163.635, 121.322, 101.932], ['A', ' CG1', 162.545, 120.695, 102.781], ['A', ' CG2', 163.177, 122.567, 101.286], ['A', ' H ', 166.041, 122.179, 101.151], ['A', ' HA ', 164.432, 122.365, 103.532], ['A', ' HB ', 163.938, 120.595, 101.174], ['A', ' HG1', 161.734, 120.463, 102.166], ['A', ' HG1', 162.88, 119.788, 103.267], ['A', ' HG1', 162.233, 121.404, 103.546], ['A', ' HG2', 162.33, 122.356, 100.641], ['A', ' HG2', 162.878, 123.28, 102.053], ['A', ' HG2', 163.984, 122.994, 100.693]] AA_SCO= 2.340526315789474 CA_SCO= 1.9257894736842103
[['A', ' N ', 165.899, 119.446, 102.913], ['A', ' CA ', 166.191, 118.184, 103.561], ['A', ' C ', 166.902, 118.371, 104.879], ['A', ' O ', 166.66, 117.583, 105.785], ['A', ' CB ', 167.079, 117.254, 102.706], ['A', ' CG ', 166.415, 116.589, 101.441], ['A', ' OD1', 165.23, 116.7, 101.252], ['A', ' OD2', 167.091, 115.889, 100.728], ['A', ' H ', 166.178, 119.6, 101.949], ['A', ' HA ', 165.242, 117.688, 103.762], ['A', ' HB ', 167.931, 117.838, 102.359], ['A', ' HB ', 167.477, 116.474, 103.34]] AA_SCO= 2.371052631578948 CA_SCO= 1.9260000000000002
[['A', ' N ', 167.79, 119.364, 104.988], ['A', ' CA ', 168.506, 119.644, 106.22], ['A', ' C ', 167.672, 120.377, 107.268], ['A', ' O ', 167.907, 120.191, 108.454], ['A', ' CB ', 169.733, 120.503, 105.932], ['A', ' CG ', 170.852, 119.856, 105.134], ['A', ' SD ', 171.593, 118.549, 105.952], ['A', ' CE ', 172.501, 117.732, 104.631], ['A', ' H ', 167.991, 119.943, 104.176], ['A', ' HA ', 168.814, 118.694, 106.647], ['A', ' HB ', 169.4, 121.355, 105.355], ['A', ' HB ', 170.147, 120.887, 106.868], ['A', ' HG ', 170.471, 119.486, 104.191], ['A', ' HG ', 171.618, 120.59, 104.934], ['A', ' HE ', 173.037, 116.867, 105.039], ['A', ' HE ', 171.805, 117.398, 103.862], ['A', ' HE ', 173.219, 118.428, 104.193]] AA_SCO= 2.377894736842105 CA_SCO= 1.9238947368421053
[['A', ' N ', 166.731, 121.231, 106.864], ['A', ' CA ', 165.947, 121.98, 107.848], ['A', ' C ', 164.713, 121.243, 108.311], ['A', ' O ', 164.301, 121.36, 109.456], ['A', ' CB ', 165.56, 123.375, 107.319], ['A', ' CG1', 164.523, 123.345, 106.266], ['A', ' CG2', 165.024, 124.183, 108.417], ['A', ' H ', 166.582, 121.388, 105.861], ['A', ' HA ', 166.583, 122.138, 108.719], ['A', ' HB ', 166.452, 123.816, 106.881], ['A', ' HG1', 164.346, 124.356, 105.912], ['A', ' HG1', 164.865, 122.767, 105.505], ['A', ' HG1', 163.591, 122.942, 106.629], ['A', ' HG2', 164.782, 125.172, 108.035], ['A', ' HG2', 164.129, 123.724, 108.804], ['A', ' HG2', 165.75, 124.253, 109.21]] AA_SCO= 2.3221052631578947 CA_SCO= 1.9151052631578949
[['A', ' N ', 164.079, 120.551, 107.401], ['A', ' CA ', 162.852, 119.856, 107.645], ['A', ' C ', 163.028, 118.507, 107.011], ['A', ' O ', 162.704, 118.303, 105.842], ['A', ' CB ', 161.677, 120.633, 107.096], ['A', ' H ', 164.478, 120.495, 106.468], ['A', ' HA ', 162.738, 119.727, 108.711], ['A', ' HB ', 160.764, 120.108, 107.301], ['A', ' HB ', 161.64, 121.602, 107.578], ['A', ' HB ', 161.801, 120.765, 106.024]] AA_SCO= 2.3236842105263156 CA_SCO= 1.903105263157895
[['A', ' N ', 163.604, 117.619, 107.802], ['A', ' CA ', 164.126, 116.346, 107.355], ['A', ' C ', 163.303, 115.643, 106.317], ['A', ' O ', 162.151, 115.287, 106.548], ['A', ' H ', 163.781, 117.909, 108.753], ['A', ' HA ', 165.133, 116.469, 106.996], ['A', ' HA ', 164.213, 115.695, 108.223]] AA_SCO= 2.511578947368421 CA_SCO= 1.9034210526315793
[['A', ' N ', 163.975, 115.362, 105.196], ['A', ' CA ', 163.401, 114.663, 104.034], ['A', ' C ', 162.382, 115.54, 103.334], ['A', ' O ', 161.183, 115.377, 103.54], ['A', ' CB ', 162.727, 113.34, 104.431], ['A', ' CG ', 163.637, 112.444, 105.179], ['A', ' CD ', 163.194, 111.046, 105.336], ['A', ' OE1', 162.126, 110.708, 104.911], ['A', ' OE2', 163.973, 110.293, 105.886], ['A', ' H ', 164.919, 115.76, 105.163], ['A', ' HA ', 164.206, 114.454, 103.326], ['A', ' HB ', 161.823, 113.506, 105.009], ['A', ' HB ', 162.429, 112.812, 103.527], ['A', ' HG ', 164.548, 112.465, 104.688], ['A', ' HG ', 163.794, 112.858, 106.169]] AA_SCO= 2.496315789473684 CA_SCO= 1.8947894736842108
[['A', ' N ', 162.845, 116.423, 102.466], ['A', ' CA ', 162.018, 117.437, 101.861], ['A', ' C ', 160.826, 117.006, 101.027], ['A', ' O ', 159.912, 117.804, 100.848], ['A', ' H ', 163.839, 116.46, 102.241], ['A', ' HA ', 161.635, 118.047, 102.672], ['A', ' HA ', 162.661, 118.084, 101.265]] AA_SCO= 2.480526315789473 CA_SCO= 1.7345789473684214
[['A', ' N ', 160.761, 115.784, 100.514], ['A', ' CA ', 159.559, 115.499, 99.749], ['A', ' C ', 158.361, 115.484, 100.711], ['A', ' O ', 157.318, 116.01, 100.383], ['A', ' CB ', 159.63, 114.205, 98.953], ['A', ' CG1', 160.701, 114.311, 97.893], ['A', ' CG2', 158.272, 114.053, 98.219], ['A', ' CD1', 161.045, 112.998, 97.258], ['A', ' H ', 161.505, 115.114, 100.63], ['A', ' HA ', 159.4, 116.307, 99.035], ['A', ' HB ', 159.834, 113.366, 99.599], ['A', ' HG1', 160.362, 114.991, 97.11], ['A', ' HG1', 161.611, 114.722, 98.332], ['A', ' HG2', 158.235, 113.166, 97.605], ['A', ' HG2', 157.49, 114.003, 98.918], ['A', ' HG2', 158.11, 114.925, 97.58], ['A', ' HD1', 161.814, 113.153, 96.508], ['A', ' HD1', 161.41, 112.32, 98.014], ['A', ' HD1', 160.184, 112.573, 96.789]] AA_SCO= 2.488947368421052 CA_SCO= 1.7151052631578945
[['A', ' N ', 158.47, 114.845, 101.868], ['A', ' CA ', 157.372, 114.845, 102.84], ['A', ' C ', 157.987, 115.033, 104.215], ['A', ' O ', 158.146, 114.054, 104.934], ['A', ' CB ', 156.517, 113.576, 102.802], ['A', ' CG ', 155.922, 113.343, 101.486], ['A', ' ND1', 154.934, 114.135, 100.944], ['A', ' CD2', 156.139, 112.38, 100.612], ['A', ' CE1', 154.629, 113.687, 99.779], ['A', ' NE2', 155.34, 112.613, 99.549], ['A', ' H ', 159.356, 114.418, 102.11], ['A', ' HA ', 156.692, 115.667, 102.642], ['A', ' HB ', 157.131, 112.711, 103.061], ['A', ' HB ', 155.715, 113.646, 103.534], ['A', ' HD1', 154.422, 114.926, 101.323], ['A', ' HD2', 156.783, 111.536, 100.618], ['A', ' HE1', 153.869, 114.193, 99.198]] AA_SCO= 2.5031578947368422 CA_SCO= 1.7111052631578945
[['A', ' N ', 158.354, 116.261, 104.6], ['A', ' CA ', 159.181, 116.567, 105.749], ['A', ' C ', 158.715, 115.957, 107.056], ['A', ' O ', 157.554, 116.073, 107.44], ['A', ' CB ', 159.041, 118.071, 105.828], ['A', ' CG ', 158.776, 118.504, 104.441], ['A', ' CD ', 157.921, 117.441, 103.849], ['A', ' HA ', 160.221, 116.289, 105.538], ['A', ' HB ', 158.268, 118.354, 106.564], ['A', ' HB ', 159.98, 118.456, 106.181], ['A', ' HG ', 158.269, 119.462, 104.48], ['A', ' HG ', 159.717, 118.653, 103.897], ['A', ' HD ', 156.861, 117.645, 104.009], ['A', ' HD ', 158.179, 117.372, 102.784]] AA_SCO= 2.4699999999999998 CA_SCO= 1.6610526315789471
[['A', ' N ', 159.64, 115.37, 107.789], ['A', ' CA ', 159.321, 114.742, 109.05], ['A', ' C ', 159.367, 115.702, 110.225], ['A', ' O ', 158.741, 115.451, 111.259], ['A', ' CB ', 160.271, 113.612, 109.251], ['A', ' OG ', 161.576, 114.091, 109.383], ['A', ' H ', 160.594, 115.3, 107.43], ['A', ' HA ', 158.313, 114.334, 108.975], ['A', ' HB ', 159.979, 113.064, 110.136], ['A', ' HB ', 160.21, 112.932, 108.4], ['A', ' HG ', 162.145, 113.333, 109.214]] AA_SCO= 2.4584210526315786 CA_SCO= 1.6546842105263155
[['A', ' N ', 160.092, 116.807, 110.068], ['A', ' CA ', 160.15, 117.835, 111.092], ['A', ' C ', 158.995, 118.771, 110.759], ['A', ' O ', 158.29, 118.52, 109.791], ['A', ' CB ', 161.52, 118.523, 111.17], ['A', ' CG ', 161.82, 119.189, 112.578], ['A', ' OD1', 160.863, 119.576, 113.199], ['A', ' OD2', 162.948, 119.31, 112.997], ['A', ' H ', 160.627, 116.916, 109.219], ['A', ' HA ', 159.947, 117.398, 112.061], ['A', ' HB ', 162.308, 117.813, 110.922], ['A', ' HB ', 161.536, 119.31, 110.439]] AA_SCO= 2.4484210526315793 CA_SCO= 1.6545263157894734
[['A', ' N ', 158.836, 119.809, 111.561], ['A', ' CA ', 157.747, 120.779, 111.533], ['A', ' C ', 156.57, 120.071, 112.164], ['A', ' O ', 155.669, 119.61, 111.47], ['A', ' CB ', 157.35, 121.271, 110.124], ['A', ' CG1', 156.245, 122.328, 110.25], ['A', ' CG2', 158.537, 121.867, 109.422], ['A', ' H ', 159.515, 119.863, 112.302], ['A', ' HA ', 158.006, 121.643, 112.138], ['A', ' HB ', 156.943, 120.443, 109.545], ['A', ' HG1', 155.966, 122.646, 109.267], ['A', ' HG1', 155.381, 121.919, 110.735], ['A', ' HG1', 156.61, 123.178, 110.82], ['A', ' HG2', 158.242, 122.216, 108.433], ['A', ' HG2', 158.888, 122.693, 110.008], ['A', ' HG2', 159.325, 121.129, 109.316]] AA_SCO= 2.4463157894736844 CA_SCO= 1.5940526315789474
[['A', ' N ', 156.572, 119.958, 113.484], ['A', ' CA ', 155.515, 119.224, 114.139], ['A', ' C ', 154.765, 119.991, 115.213], ['A', ' O ', 155.171, 119.972, 116.375], ['A', ' CB ', 156.089, 117.974, 114.783], ['A', ' CG ', 156.764, 117.013, 113.837], ['A', ' CD ', 157.083, 115.723, 114.505], ['A', ' NE ', 158.077, 115.823, 115.526], ['A', ' CZ ', 159.399, 115.759, 115.314], ['A', ' NH1', 159.888, 115.602, 114.098], ['A', ' NH2', 160.223, 115.845, 116.346], ['A', ' H ', 157.33, 120.349, 114.021], ['A', ' HA ', 154.79, 118.915, 113.383], ['A', ' HB ', 156.816, 118.254, 115.543], ['A', ' HB ', 155.284, 117.424, 115.284], ['A', ' HG ', 156.117, 116.827, 112.985], ['A', ' HG ', 157.696, 117.45, 113.483], ['A', ' HD ', 156.175, 115.338, 114.97], ['A', ' HD ', 157.429, 115.011, 113.764], ['A', ' HE ', 157.754, 115.937, 116.48], ['A', ' HH1', 159.267, 115.525, 113.268], ['A', ' HH1', 160.886, 115.544, 113.967], ['A', ' HH2', 159.853, 115.956, 117.281], ['A', ' HH2', 161.223, 115.795, 116.204]] AA_SCO= 2.4315789473684215 CA_SCO= 1.5942631578947366
[['A', ' N ', 153.692, 120.683, 114.824], ['A', ' CA ', 152.75, 121.429, 115.695], ['A', ' C ', 153.29, 122.596, 116.52], ['A', ' O ', 152.646, 123.627, 116.618], ['A', ' CB ', 151.992, 120.478, 116.631], ['A', ' CG1', 151.242, 119.38, 115.807], ['A', ' CG2', 150.96, 121.289, 117.461], ['A', ' CD1', 150.164, 119.862, 114.817], ['A', ' H ', 153.489, 120.649, 113.832], ['A', ' HA ', 152.004, 121.869, 115.044], ['A', ' HB ', 152.686, 119.972, 117.304], ['A', ' HG1', 151.99, 118.816, 115.252], ['A', ' HG1', 150.77, 118.694, 116.517], ['A', ' HG2', 150.413, 120.614, 118.113], ['A', ' HG2', 151.452, 122.032, 118.067], ['A', ' HG2', 150.263, 121.8, 116.81], ['A', ' HD1', 149.73, 119.015, 114.321], ['A', ' HD1', 149.392, 120.381, 115.339], ['A', ' HD1', 150.58, 120.511, 114.076]] AA_SCO= 2.397894736842106 CA_SCO= 1.6028947368421052
[['A', ' N ', 154.414, 122.402, 117.179], ['A', ' CA ', 155.024, 123.4, 118.038], ['A', ' C ', 155.95, 124.319, 117.269], ['A', ' O ', 156.65, 125.133, 117.86], ['A', ' H ', 154.857, 121.507, 117.054], ['A', ' HA ', 154.24, 123.983, 118.508], ['A', ' HA ', 155.565, 122.909, 118.84]] AA_SCO= 2.4373684210526316 CA_SCO= 1.602578947368421
[['A', ' N ', 155.996, 124.16, 115.957], ['A', ' CA ', 156.846, 125.007, 115.142], ['A', ' C ', 158.281, 124.563, 114.933], ['A', ' O ', 159.186, 125.356, 115.139], ['A', ' H ', 155.399, 123.463, 115.542], ['A', ' HA ', 156.373, 125.1, 114.167], ['A', ' HA ', 156.849, 126.001, 115.568]] AA_SCO= 2.4347368421052638 CA_SCO= 1.6205263157894738
[['A', ' N ', 158.472, 123.323, 114.483], ['A', ' CA ', 159.793, 122.737, 114.194], ['A', ' C ', 160.43, 122.229, 115.468], ['A', ' O ', 160.363, 122.875, 116.5], ['A', ' CB ', 160.714, 123.783, 113.537], ['A', ' CG ', 161.987, 123.266, 112.937], ['A', ' SD ', 161.709, 122.305, 111.484], ['A', ' CE ', 161.488, 123.544, 110.271], ['A', ' H ', 157.648, 122.764, 114.363], ['A', ' HA ', 159.686, 121.884, 113.534], ['A', ' HB ', 160.165, 124.355, 112.798], ['A', ' HB ', 161.07, 124.465, 114.261], ['A', ' HG ', 162.629, 124.104, 112.675], ['A', ' HG ', 162.529, 122.65, 113.657], ['A', ' HE ', 161.319, 123.089, 109.305], ['A', ' HE ', 160.647, 124.182, 110.524], ['A', ' HE ', 162.371, 124.129, 110.224]] AA_SCO= 2.481578947368421 CA_SCO= 1.6223157894736842
[['A', ' N ', 161.004, 121.033, 115.428], ['A', ' CA ', 161.648, 120.471, 116.59], ['A', ' C ', 163.114, 120.858, 116.705], ['A', ' O ', 163.566, 121.32, 117.756], ['A', ' CB ', 161.519, 118.964, 116.553], ['A', ' H ', 161.026, 120.497, 114.566], ['A', ' HA ', 161.143, 120.832, 117.463], ['A', ' HB ', 161.97, 118.537, 117.445], ['A', ' HB ', 160.468, 118.698, 116.506], ['A', ' HB ', 162.035, 118.582, 115.666]] AA_SCO= 2.403684210526316 CA_SCO= 1.6234210526315789
[['A', ' N ', 163.862, 120.697, 115.624], ['A', ' CA ', 165.297, 120.931, 115.685], ['A', ' C ', 165.837, 122.195, 115.031], ['A', ' O ', 165.227, 122.765, 114.132], ['A', ' CB ', 165.974, 119.728, 115.091], ['A', ' CG ', 165.904, 118.517, 115.974], ['A', ' OD1', 166.522, 118.536, 117.028], ['A', ' OD2', 165.26, 117.554, 115.617], ['A', ' H ', 163.454, 120.32, 114.749], ['A', ' HA ', 165.572, 120.977, 116.737], ['A', ' HB ', 165.48, 119.487, 114.142], ['A', ' HB ', 167.015, 119.969, 114.888]] AA_SCO= 2.384210526315789 CA_SCO= 1.6079473684210528
[['A', ' N ', 167.027, 122.611, 115.475], ['A', ' CA ', 167.754, 123.714, 114.846], ['A', ' C ', 168.652, 123.2, 113.763], ['A', ' O ', 169.115, 122.062, 113.811], ['A', ' CB ', 168.669, 124.466, 115.805], ['A', ' CG ', 168.02, 125.368, 116.738], ['A', ' OD1', 167.404, 126.342, 116.292], ['A', ' ND2', 168.132, 125.08, 118.012], ['A', ' H ', 167.446, 122.114, 116.251], ['A', ' HA ', 167.039, 124.403, 114.395], ['A', ' HB ', 169.247, 123.743, 116.379], ['A', ' HB ', 169.392, 125.05, 115.226], ['A', ' HD2', 167.69, 125.656, 118.729], ['A', ' HD2', 168.653, 124.276, 118.294]] AA_SCO= 2.38 CA_SCO= 1.61
[['A', ' N ', 168.959, 124.047, 112.815], ['A', ' CA ', 169.995, 123.697, 111.871], ['A', ' C ', 171.248, 123.936, 112.677], ['A', ' O ', 171.369, 125.016, 113.246], ['A', ' CB ', 169.972, 124.616, 110.628], ['A', ' CG1', 168.672, 124.442, 109.846], ['A', ' CG2', 171.121, 124.359, 109.778], ['A', ' CD1', 168.488, 125.451, 108.708], ['A', ' H ', 168.513, 124.956, 112.806], ['A', ' HA ', 169.934, 122.646, 111.586], ['A', ' HB ', 170.021, 125.648, 110.963], ['A', ' HG1', 168.64, 123.433, 109.431], ['A', ' HG1', 167.836, 124.556, 110.535], ['A', ' HG2', 171.146, 125.014, 108.932], ['A', ' HG2', 172.022, 124.507, 110.353], ['A', ' HG2', 171.048, 123.339, 109.44], ['A', ' HD1', 167.564, 125.283, 108.217], ['A', ' HD1', 168.491, 126.445, 109.097], ['A', ' HD1', 169.267, 125.362, 107.971]] AA_SCO= 2.466315789473684 CA_SCO= 1.6188421052631579
[['A', ' N ', 172.172, 122.986, 112.752], ['A', ' CA ', 173.342, 123.268, 113.587], ['A', ' C ', 174.385, 124.11, 112.88], ['A', ' O ', 174.312, 124.361, 111.667], ['A', ' CB ', 174.028, 122.005, 114.081], ['A', ' OG1', 174.973, 122.376, 115.097], ['A', ' CG2', 174.76, 121.344, 112.934], ['A', ' H ', 172.023, 122.08, 112.286], ['A', ' HA ', 173.005, 123.82, 114.465], ['A', ' HB ', 173.286, 121.319, 114.494], ['A', ' HG1', 175.282, 121.588, 115.558], ['A', ' HG2', 175.255, 120.442, 113.278], ['A', ' HG2', 174.045, 121.096, 112.161], ['A', ' HG2', 175.498, 121.994, 112.527]] AA_SCO= 2.4752631578947364 CA_SCO= 1.6309473684210527
[['A', ' N ', 175.427, 124.509, 113.605], ['A', ' CA ', 176.441, 125.363, 112.987], ['A', ' C ', 177.503, 124.544, 112.248], ['A', ' O ', 178.669, 124.465, 112.625], ['A', ' CB ', 177.09, 126.276, 114.02], ['A', ' CG ', 177.958, 127.368, 113.406], ['A', ' CD ', 178.621, 128.26, 114.413], ['A', ' OE1', 178.683, 127.901, 115.563], ['A', ' OE2', 179.034, 129.336, 114.03], ['A', ' H ', 175.483, 124.225, 114.582], ['A', ' HA ', 175.948, 126.001, 112.257], ['A', ' HB ', 176.315, 126.758, 114.618], ['A', ' HB ', 177.708, 125.685, 114.696], ['A', ' HG ', 178.731, 126.921, 112.793], ['A', ' HG ', 177.329, 127.975, 112.756]] AA_SCO= 2.4531578947368415 CA_SCO= 1.6309473684210527
[['A', ' N ', 177.038, 123.964, 111.181], ['A', ' CA ', 177.723, 123.124, 110.225], ['A', ' C ', 176.806, 123.117, 109.058], ['A', ' O ', 177.151, 123.577, 107.972], ['A', ' CB ', 177.95, 121.693, 110.742], ['A', ' CG ', 178.607, 120.67, 109.754], ['A', ' CD1', 180.003, 121.123, 109.335], ['A', ' CD2', 178.655, 119.296, 110.441], ['A', ' H ', 176.045, 124.131, 111.058], ['A', ' HA ', 178.667, 123.588, 109.947], ['A', ' HB ', 178.572, 121.744, 111.635], ['A', ' HB ', 177.002, 121.262, 111.02], ['A', ' HG ', 177.993, 120.585, 108.853], ['A', ' HD1', 180.431, 120.388, 108.655], ['A', ' HD1', 179.951, 122.083, 108.827], ['A', ' HD1', 180.638, 121.212, 110.215], ['A', ' HD2', 179.086, 118.562, 109.758], ['A', ' HD2', 179.262, 119.35, 111.345], ['A', ' HD2', 177.645, 118.989, 110.706]] AA_SCO= 2.4573684210526316 CA_SCO= 1.6393684210526314
[['A', ' N ', 175.601, 122.636, 109.311], ['A', ' CA ', 174.578, 122.602, 108.311], ['A', ' C ', 174.233, 124.019, 107.865], ['A', ' O ', 174.078, 124.263, 106.676], ['A', ' CB ', 173.361, 121.909, 108.877], ['A', ' H ', 175.406, 122.253, 110.228], ['A', ' HA ', 174.949, 122.052, 107.447], ['A', ' HB ', 172.569, 121.869, 108.131], ['A', ' HB ', 173.599, 120.929, 109.189], ['A', ' HB ', 173.038, 122.452, 109.74]] AA_SCO= 2.4584210526315795 CA_SCO= 1.7995789473684212
[['A', ' N ', 174.192, 124.977, 108.797], ['A', ' CA ', 173.866, 126.349, 108.435], ['A', ' C ', 174.878, 126.902, 107.466], ['A', ' O ', 174.517, 127.539, 106.478], ['A', ' CB ', 173.839, 127.222, 109.676], ['A', ' CG ', 173.566, 128.719, 109.477], ['A', ' CD ', 173.604, 129.39, 110.799], ['A', ' NE ', 173.483, 130.833, 110.766], ['A', ' CZ ', 174.493, 131.69, 110.477], ['A', ' NH1', 175.694, 131.252, 110.132], ['A', ' NH2', 174.256, 132.976, 110.549], ['A', ' H ', 174.323, 124.737, 109.779], ['A', ' HA ', 172.885, 126.363, 107.963], ['A', ' HB ', 173.076, 126.845, 110.359], ['A', ' HB ', 174.794, 127.132, 110.194], ['A', ' HG ', 174.309, 129.166, 108.818], ['A', ' HG ', 172.574, 128.869, 109.059], ['A', ' HD ', 172.739, 129.028, 111.339], ['A', ' HD ', 174.508, 129.125, 111.343], ['A', ' HE ', 172.569, 131.274, 111.086], ['A', ' HH1', 175.878, 130.267, 110.078], ['A', ' HH1', 176.423, 131.916, 109.921], ['A', ' HH2', 173.309, 133.276, 110.82], ['A', ' HH2', 174.961, 133.656, 110.335]] AA_SCO= 2.445263157894737 CA_SCO= 1.8192105263157894
[['A', ' N ', 176.15, 126.669, 107.753], ['A', ' CA ', 177.216, 127.17, 106.915], ['A', ' C ', 177.267, 126.47, 105.574], ['A', ' O ', 177.476, 127.12, 104.545], ['A', ' CB ', 178.542, 127.046, 107.642], ['A', ' CG ', 178.683, 128.02, 108.796], ['A', ' CD ', 179.998, 127.842, 109.533], ['A', ' CE ', 180.149, 128.883, 110.637], ['A', ' NZ ', 181.383, 128.673, 111.448], ['A', ' H ', 176.367, 126.148, 108.59], ['A', ' HA ', 177.029, 128.227, 106.727], ['A', ' HB ', 178.644, 126.03, 108.036], ['A', ' HB ', 179.361, 127.214, 106.944], ['A', ' HG ', 178.622, 129.039, 108.412], ['A', ' HG ', 177.862, 127.868, 109.497], ['A', ' HD ', 180.03, 126.846, 109.984], ['A', ' HD ', 180.829, 127.938, 108.836], ['A', ' HE ', 180.192, 129.871, 110.186], ['A', ' HE ', 179.286, 128.837, 111.291], ['A', ' HZ ', 181.43, 129.39, 112.167], ['A', ' HZ ', 181.343, 127.763, 111.889], ['A', ' HZ ', 182.199, 128.729, 110.858]] AA_SCO= 2.4463157894736844 CA_SCO= 1.8190526315789473
[['A', ' N ', 177.045, 125.159, 105.555], ['A', ' CA ', 177.081, 124.467, 104.288], ['A', ' C ', 175.945, 124.906, 103.411], ['A', ' O ', 176.138, 125.162, 102.22], ['A', ' CB ', 176.974, 122.972, 104.477], ['A', ' CG ', 178.181, 122.339, 105.035], ['A', ' CD ', 178.033, 120.874, 105.183], ['A', ' NE ', 179.219, 120.329, 105.758], ['A', ' CZ ', 180.345, 120.061, 105.07], ['A', ' NH1', 180.405, 120.266, 103.771], ['A', ' NH2', 181.399, 119.599, 105.694], ['A', ' H ', 176.901, 124.639, 106.424], ['A', ' HA ', 178.023, 124.698, 103.792], ['A', ' HB ', 176.148, 122.756, 105.157], ['A', ' HB ', 176.749, 122.495, 103.523], ['A', ' HG ', 179.015, 122.551, 104.376], ['A', ' HG ', 178.394, 122.754, 106.012], ['A', ' HD ', 177.204, 120.661, 105.866], ['A', ' HD ', 177.843, 120.39, 104.224], ['A', ' HE ', 179.213, 120.137, 106.754], ['A', ' HH1', 179.603, 120.609, 103.27], ['A', ' HH1', 181.254, 120.053, 103.268], ['A', ' HH2', 181.365, 119.418, 106.686], ['A', ' HH2', 182.249, 119.395, 105.178]] AA_SCO= 2.487368421052632 CA_SCO= 1.8694210526315784
[['A', ' N ', 174.763, 125.054, 103.991], ['A', ' CA ', 173.639, 125.447, 103.191], ['A', ' C ', 173.808, 126.846, 102.704], ['A', ' O ', 173.446, 127.147, 101.566], ['A', ' CB ', 172.356, 125.383, 103.982], ['A', ' CG ', 171.853, 124.037, 104.413], ['A', ' CD1', 170.621, 124.303, 105.28], ['A', ' CD2', 171.593, 123.151, 103.195], ['A', ' H ', 174.631, 124.84, 104.984], ['A', ' HA ', 173.588, 124.807, 102.319], ['A', ' HB ', 172.505, 125.971, 104.893], ['A', ' HB ', 171.581, 125.855, 103.399], ['A', ' HG ', 172.572, 123.535, 105.033], ['A', ' HD1', 170.222, 123.38, 105.647], ['A', ' HD1', 170.913, 124.925, 106.125], ['A', ' HD1', 169.863, 124.818, 104.704], ['A', ' HD2', 171.203, 122.21, 103.514], ['A', ' HD2', 170.9, 123.614, 102.549], ['A', ' HD2', 172.507, 122.974, 102.651]] AA_SCO= 2.5500000000000003 CA_SCO= 1.8752105263157894
[['A', ' N ', 174.371, 127.701, 103.543], ['A', ' CA ', 174.567, 129.063, 103.167], ['A', ' C ', 175.434, 129.126, 101.952], ['A', ' O ', 175.105, 129.806, 100.976], ['A', ' CB ', 175.236, 129.827, 104.277], ['A', ' CG ', 175.415, 131.18, 103.912], ['A', ' CD1', 174.358, 131.976, 104.042], ['A', ' CD2', 176.604, 131.651, 103.418], ['A', ' CE1', 174.422, 133.237, 103.712], ['A', ' CE2', 176.687, 132.963, 103.067], ['A', ' CZ ', 175.584, 133.765, 103.223], ['A', ' OH ', 175.616, 135.091, 102.885], ['A', ' H ', 174.621, 127.421, 104.495], ['A', ' HA ', 173.606, 129.511, 102.925], ['A', ' HB ', 174.632, 129.783, 105.182], ['A', ' HB ', 176.205, 129.392, 104.501], ['A', ' HD1', 173.448, 131.584, 104.415], ['A', ' HD2', 177.466, 130.993, 103.307], ['A', ' HE1', 173.533, 133.849, 103.831], ['A', ' HE2', 177.614, 133.369, 102.673], ['A', ' HH ', 174.887, 135.55, 103.381]] AA_SCO= 2.5089473684210533 CA_SCO= 1.8753684210526311
[['A', ' N ', 176.557, 128.414, 101.997], ['A', ' CA ', 177.462, 128.437, 100.883], ['A', ' C ', 176.8, 127.908, 99.642], ['A', ' O ', 176.973, 128.481, 98.569], ['A', ' CB ', 178.677, 127.605, 101.192], ['A', ' H ', 176.793, 127.875, 102.837], ['A', ' HA ', 177.756, 129.47, 100.705], ['A', ' HB ', 179.365, 127.639, 100.35], ['A', ' HB ', 179.164, 127.997, 102.085], ['A', ' HB ', 178.365, 126.574, 101.372]] AA_SCO= 2.513157894736842 CA_SCO= 1.931473684210526
[['A', ' N ', 175.993, 126.859, 99.769], ['A', ' CA ', 175.363, 126.321, 98.588], ['A', ' C ', 174.41, 127.301, 97.956], ['A', ' O ', 174.409, 127.443, 96.736], ['A', ' CB ', 174.573, 125.073, 98.917], ['A', ' CG ', 175.375, 123.852, 99.221], ['A', ' CD ', 174.49, 122.718, 99.577], ['A', ' NE ', 175.238, 121.546, 99.926], ['A', ' CZ ', 175.745, 120.657, 99.052], ['A', ' NH1', 175.586, 120.793, 97.736], ['A', ' NH2', 176.414, 119.617, 99.509], ['A', ' H ', 175.891, 126.393, 100.676], ['A', ' HA ', 176.143, 126.073, 97.867], ['A', ' HB ', 173.942, 125.27, 99.781], ['A', ' HB ', 173.914, 124.834, 98.083], ['A', ' HG ', 175.945, 123.582, 98.334], ['A', ' HG ', 176.057, 124.043, 100.037], ['A', ' HD ', 173.891, 122.998, 100.442], ['A', ' HD ', 173.831, 122.483, 98.757], ['A', ' HE ', 175.393, 121.37, 100.911], ['A', ' HH1', 175.046, 121.566, 97.326], ['A', ' HH1', 175.975, 120.095, 97.12], ['A', ' HH2', 176.555, 119.472, 100.525], ['A', ' HH2', 176.783, 118.944, 98.86]] AA_SCO= 2.56 CA_SCO= 1.931473684210526
[['A', ' N ', 173.619, 128.003, 98.761], ['A', ' CA ', 172.656, 128.908, 98.174], ['A', ' C ', 173.322, 130.15, 97.622], ['A', ' O ', 172.899, 130.698, 96.599], ['A', ' CB ', 171.623, 129.344, 99.189], ['A', ' CG ', 170.675, 128.298, 99.757], ['A', ' CD1', 169.824, 129.041, 100.76], ['A', ' CD2', 169.836, 127.594, 98.647], ['A', ' H ', 173.644, 127.833, 99.773], ['A', ' HA ', 172.162, 128.395, 97.364], ['A', ' HB ', 172.165, 129.771, 100.038], ['A', ' HB ', 171.023, 130.12, 98.747], ['A', ' HG ', 171.247, 127.541, 100.296], ['A', ' HD1', 169.137, 128.384, 101.26], ['A', ' HD1', 170.466, 129.499, 101.484], ['A', ' HD1', 169.269, 129.813, 100.244], ['A', ' HD2', 169.167, 126.88, 99.076], ['A', ' HD2', 169.261, 128.31, 98.119], ['A', ' HD2', 170.487, 127.073, 97.954]] AA_SCO= 2.5294736842105263 CA_SCO= 1.9313157894736839
[['A', ' N ', 174.363, 130.623, 98.287], ['A', ' CA ', 175.039, 131.803, 97.804], ['A', ' C ', 175.696, 131.489, 96.463], ['A', ' O ', 175.681, 132.314, 95.549], ['A', ' CB ', 176.04, 132.3, 98.836], ['A', ' CG ', 176.736, 133.595, 98.468], ['A', ' CD ', 177.632, 134.068, 99.604], ['A', ' CE ', 178.38, 135.338, 99.24], ['A', ' NZ ', 179.305, 135.781, 100.331], ['A', ' H ', 174.674, 130.18, 99.159], ['A', ' HA ', 174.3, 132.585, 97.64], ['A', ' HB ', 175.526, 132.448, 99.79], ['A', ' HB ', 176.8, 131.531, 98.997], ['A', ' HG ', 177.341, 133.442, 97.571], ['A', ' HG ', 175.988, 134.358, 98.255], ['A', ' HD ', 177.01, 134.278, 100.472], ['A', ' HD ', 178.342, 133.285, 99.866], ['A', ' HE ', 178.96, 135.161, 98.336], ['A', ' HE ', 177.659, 136.132, 99.046], ['A', ' HZ ', 179.781, 136.624, 100.041], ['A', ' HZ ', 178.793, 135.967, 101.184], ['A', ' HZ ', 179.986, 135.056, 100.506]] AA_SCO= 2.6047368421052637 CA_SCO= 1.9354736842105265
[['A', ' N ', 176.279, 130.291, 96.352], ['A', ' CA ', 176.918, 129.821, 95.133], ['A', ' C ', 175.885, 129.535, 94.048], ['A', ' O ', 176.176, 129.688, 92.864], ['A', ' CB ', 177.727, 128.577, 95.435], ['A', ' CG ', 178.949, 128.829, 96.291], ['A', ' CD ', 179.546, 127.539, 96.769], ['A', ' OE1', 178.929, 126.482, 96.599], ['A', ' NE2', 180.731, 127.601, 97.365], ['A', ' H ', 176.304, 129.669, 97.166], ['A', ' HA ', 177.585, 130.6, 94.77], ['A', ' HB ', 177.089, 127.862, 95.956], ['A', ' HB ', 178.048, 128.114, 94.504], ['A', ' HG ', 179.692, 129.341, 95.683], ['A', ' HG ', 178.688, 129.445, 97.145], ['A', ' HE2', 181.167, 126.764, 97.699], ['A', ' HE2', 181.193, 128.481, 97.479]] AA_SCO= 2.5889473684210524 CA_SCO= 1.9223157894736842
[['A', ' N ', 174.696, 129.091, 94.462], ['A', ' CA ', 173.569, 128.798, 93.592], ['A', ' C ', 172.984, 130.015, 92.922], ['A', ' O ', 172.678, 129.978, 91.731], ['A', ' CB ', 172.445, 128.149, 94.404], ['A', ' CG ', 171.162, 127.862, 93.696], ['A', ' CD1', 171.39, 126.978, 92.583], ['A', ' CD2', 170.155, 127.246, 94.669], ['A', ' H ', 174.585, 128.884, 95.454], ['A', ' HA ', 173.927, 128.114, 92.827], ['A', ' HB ', 172.812, 127.223, 94.837], ['A', ' HB ', 172.195, 128.817, 95.191], ['A', ' HG ', 170.753, 128.783, 93.32], ['A', ' HD1', 170.444, 126.838, 92.138], ['A', ' HD1', 172.061, 127.407, 91.866], ['A', ' HD1', 171.79, 126.036, 92.92], ['A', ' HD2', 169.208, 127.047, 94.154], ['A', ' HD2', 170.537, 126.324, 95.062], ['A', ' HD2', 169.981, 127.936, 95.487]] AA_SCO= 2.565789473684211 CA_SCO= 1.9257894736842107
[['A', ' N ', 172.823, 131.094, 93.669], ['A', ' CA ', 172.219, 132.308, 93.15], ['A', ' C ', 172.514, 132.614, 91.674], ['A', ' O ', 171.547, 132.794, 90.932], ['A', ' CB ', 172.52, 133.468, 94.086], ['A', ' CG ', 171.896, 134.768, 93.682], ['A', ' CD ', 172.16, 135.824, 94.735], ['A', ' CE ', 171.566, 137.157, 94.339], ['A', ' NZ ', 171.798, 138.19, 95.378], ['A', ' H ', 173.055, 131.035, 94.668], ['A', ' HA ', 171.155, 132.179, 93.185], ['A', ' HB ', 172.118, 133.216, 95.07], ['A', ' HB ', 173.582, 133.601, 94.224], ['A', ' HG ', 172.314, 135.099, 92.729], ['A', ' HG ', 170.819, 134.634, 93.562], ['A', ' HD ', 171.723, 135.506, 95.685], ['A', ' HD ', 173.236, 135.939, 94.87], ['A', ' HE ', 172.019, 137.486, 93.405], ['A', ' HE ', 170.491, 137.042, 94.19], ['A', ' HZ ', 171.389, 139.066, 95.085], ['A', ' HZ ', 171.366, 137.891, 96.239], ['A', ' HZ ', 172.79, 138.314, 95.521]] AA_SCO= 2.416842105263158 CA_SCO= 1.925842105263158
[['A', ' N ', 173.765, 132.732, 91.188], ['A', ' CA ', 174.057, 133.009, 89.798], ['A', ' C ', 173.577, 131.941, 88.815], ['A', ' O ', 173.381, 132.258, 87.647], ['A', ' CB ', 175.58, 133.136, 89.79], ['A', ' CG ', 176.034, 132.431, 91.026], ['A', ' CD ', 174.963, 132.704, 92.037], ['A', ' HA ', 173.61, 133.979, 89.544], ['A', ' HB ', 175.986, 132.674, 88.875], ['A', ' HB ', 175.868, 134.196, 89.769], ['A', ' HG ', 176.157, 131.352, 90.834], ['A', ' HG ', 177.017, 132.805, 91.347], ['A', ' HD ', 174.985, 131.925, 92.766], ['A', ' HD ', 175.13, 133.684, 92.495]] AA_SCO= 2.4268421052631584 CA_SCO= 1.9459473684210526
[['A', ' N ', 173.373, 130.695, 89.253], ['A', ' CA ', 172.92, 129.663, 88.336], ['A', ' C ', 171.437, 129.8, 88.185], ['A', ' O ', 170.884, 129.552, 87.11], ['A', ' CB ', 173.263, 128.265, 88.844], ['A', ' CG ', 174.762, 127.941, 88.953], ['A', ' CD ', 175.492, 128.016, 87.592], ['A', ' CE ', 175.089, 126.884, 86.635], ['A', ' NZ ', 175.761, 127.03, 85.312], ['A', ' H ', 173.512, 130.432, 90.223], ['A', ' HA ', 173.359, 129.831, 87.355], ['A', ' HB ', 172.859, 128.162, 89.843], ['A', ' HB ', 172.769, 127.519, 88.232], ['A', ' HG ', 175.224, 128.654, 89.644], ['A', ' HG ', 174.881, 126.938, 89.366], ['A', ' HD ', 175.338, 128.974, 87.102], ['A', ' HD ', 176.56, 127.921, 87.779], ['A', ' HE ', 175.371, 125.928, 87.075], ['A', ' HE ', 174.017, 126.897, 86.469], ['A', ' HZ ', 175.481, 126.282, 84.699], ['A', ' HZ ', 175.46, 127.941, 84.9], ['A', ' HZ ', 176.76, 127.02, 85.42]] AA_SCO= 2.4263157894736844 CA_SCO= 1.8014736842105261
[['A', ' N ', 170.79, 130.227, 89.26], ['A', ' CA ', 169.368, 130.453, 89.191], ['A', ' C ', 169.168, 131.613, 88.275], ['A', ' O ', 168.25, 131.584, 87.464], ['A', ' CB ', 168.714, 130.686, 90.55], ['A', ' CG1', 167.238, 131.133, 90.393], ['A', ' CG2', 168.75, 129.395, 91.258], ['A', ' H ', 171.33, 130.381, 90.119], ['A', ' HA ', 168.896, 129.578, 88.748], ['A', ' HB ', 169.261, 131.452, 91.105], ['A', ' HG1', 166.791, 131.26, 91.38], ['A', ' HG1', 167.18, 132.083, 89.855], ['A', ' HG1', 166.684, 130.375, 89.839], ['A', ' HG2', 168.301, 129.473, 92.225], ['A', ' HG2', 168.204, 128.676, 90.674], ['A', ' HG2', 169.773, 129.085, 91.348]] AA_SCO= 2.4210526315789473 CA_SCO= 1.8012105263157894
[['A', ' N ', 170.013, 132.635, 88.396], ['A', ' CA ', 169.873, 133.773, 87.527], ['A', ' C ', 170.073, 133.36, 86.065], ['A', ' O ', 169.302, 133.78, 85.209], ['A', ' CB ', 170.868, 134.839, 87.886], ['A', ' CG ', 170.565, 135.517, 89.167], ['A', ' OD1', 169.459, 135.459, 89.702], ['A', ' ND2', 171.547, 136.193, 89.685], ['A', ' H ', 170.728, 132.615, 89.129], ['A', ' HA ', 168.876, 134.181, 87.642], ['A', ' HB ', 171.858, 134.401, 87.944], ['A', ' HB ', 170.892, 135.587, 87.095], ['A', ' HD2', 171.411, 136.693, 90.538], ['A', ' HD2', 172.432, 136.227, 89.223]] AA_SCO= 2.3184210526315794 CA_SCO= 1.7646315789473679
[['A', ' N ', 171.034, 132.475, 85.76], ['A', ' CA ', 171.193, 132.067, 84.364], ['A', ' C ', 169.958, 131.341, 83.866], ['A', ' O ', 169.496, 131.57, 82.741], ['A', ' CB ', 172.38, 131.114, 84.197], ['A', ' CG ', 173.762, 131.716, 84.351], ['A', ' CD ', 174.861, 130.644, 84.372], ['A', ' OE1', 174.53, 129.47, 84.35], ['A', ' OE2', 176.012, 130.992, 84.427], ['A', ' H ', 171.703, 132.161, 86.47], ['A', ' HA ', 171.347, 132.957, 83.755], ['A', ' HB ', 172.294, 130.317, 84.937], ['A', ' HB ', 172.33, 130.646, 83.215], ['A', ' HG ', 173.943, 132.387, 83.514], ['A', ' HG ', 173.804, 132.303, 85.254]] AA_SCO= 2.3415789473684216 CA_SCO= 1.7644210526315787
[['A', ' N ', 169.408, 130.484, 84.717], ['A', ' CA ', 168.235, 129.71, 84.389], ['A', ' C ', 167.032, 130.56, 84.118], ['A', ' O ', 166.35, 130.38, 83.104], ['A', ' CB ', 167.903, 128.75, 85.513], ['A', ' CG ', 166.642, 128.06, 85.308], ['A', ' ND1', 166.456, 127.116, 84.34], ['A', ' CD2', 165.472, 128.182, 85.95], ['A', ' CE1', 165.221, 126.681, 84.398], ['A', ' NE2', 164.609, 127.308, 85.379], ['A', ' H ', 169.87, 130.322, 85.618], ['A', ' HA ', 168.435, 129.126, 83.493], ['A', ' HB ', 168.699, 128.01, 85.615], ['A', ' HB ', 167.844, 129.292, 86.451], ['A', ' HD1', 167.131, 126.803, 83.675], ['A', ' HD2', 165.152, 128.809, 86.779], ['A', ' HE1', 164.865, 125.919, 83.701]] AA_SCO= 2.336315789473684 CA_SCO= 1.7367894736842102
[['A', ' N ', 166.756, 131.501, 85.0], ['A', ' CA ', 165.577, 132.287, 84.784], ['A', ' C ', 165.77, 133.208, 83.613], ['A', ' O ', 164.859, 133.36, 82.817], ['A', ' CB ', 165.172, 133.063, 86.043], ['A', ' CG1', 164.898, 132.058, 87.164], ['A', ' CG2', 166.19, 134.015, 86.43], ['A', ' H ', 167.354, 131.619, 85.822], ['A', ' HA ', 164.757, 131.607, 84.553], ['A', ' HB ', 164.296, 133.62, 85.858], ['A', ' HG1', 164.596, 132.584, 88.06], ['A', ' HG1', 164.103, 131.382, 86.856], ['A', ' HG1', 165.788, 131.483, 87.377], ['A', ' HG2', 165.856, 134.504, 87.303], ['A', ' HG2', 167.079, 133.498, 86.628], ['A', ' HG2', 166.366, 134.757, 85.668]] AA_SCO= 2.263157894736842 CA_SCO= 1.7366842105263158
[['A', ' N ', 166.96, 133.75, 83.393], ['A', ' CA ', 167.059, 134.645, 82.265], ['A', ' C ', 166.868, 133.857, 80.972], ['A', ' O ', 166.268, 134.369, 80.017], ['A', ' CB ', 168.366, 135.416, 82.306], ['A', ' CG ', 168.457, 136.409, 83.507], ['A', ' CD ', 167.35, 137.428, 83.561], ['A', ' OE1', 166.976, 137.91, 82.524], ['A', ' OE2', 166.884, 137.75, 84.659], ['A', ' H ', 167.755, 133.618, 84.026], ['A', ' HA ', 166.251, 135.371, 82.332], ['A', ' HB ', 169.197, 134.711, 82.393], ['A', ' HB ', 168.496, 135.975, 81.381], ['A', ' HG ', 168.423, 135.855, 84.429], ['A', ' HG ', 169.414, 136.922, 83.465]] AA_SCO= 2.1578947368421053 CA_SCO= 1.469052631578947
[['A', ' N ', 167.33, 132.603, 80.924], ['A', ' CA ', 167.08, 131.802, 79.742], ['A', ' C ', 165.604, 131.547, 79.557], ['A', ' O ', 165.071, 131.756, 78.466], ['A', ' CB ', 167.756, 130.43, 79.833], ['A', ' CG ', 167.43, 129.421, 78.659], ['A', ' CD1', 167.894, 129.984, 77.315], ['A', ' CD2', 168.077, 128.065, 78.96], ['A', ' H ', 167.9, 132.226, 81.691], ['A', ' HA ', 167.458, 132.349, 78.883], ['A', ' HB ', 168.834, 130.58, 79.868], ['A', ' HB ', 167.453, 129.961, 80.771], ['A', ' HG ', 166.352, 129.276, 78.599], ['A', ' HD1', 167.646, 129.277, 76.525], ['A', ' HD1', 167.396, 130.927, 77.105], ['A', ' HD1', 168.971, 130.138, 77.336], ['A', ' HD2', 167.831, 127.356, 78.167], ['A', ' HD2', 169.161, 128.181, 79.021], ['A', ' HD2', 167.699, 127.689, 79.912]] AA_SCO= 2.165263157894737 CA_SCO= 1.310315789473684
[['A', ' N ', 164.922, 131.119, 80.621], ['A', ' CA ', 163.514, 130.806, 80.475], ['A', ' C ', 162.679, 132.031, 80.204], ['A', ' O ', 161.658, 131.924, 79.558], ['A', ' CB ', 162.972, 130.075, 81.701], ['A', ' CG ', 163.47, 128.641, 81.873], ['A', ' SD ', 163.147, 127.567, 80.427], ['A', ' CE ', 161.34, 127.416, 80.344], ['A', ' H ', 165.4, 130.975, 81.516], ['A', ' HA ', 163.406, 130.153, 79.615], ['A', ' HB ', 163.28, 130.624, 82.596], ['A', ' HB ', 161.882, 130.079, 81.684], ['A', ' HG ', 164.546, 128.669, 82.049], ['A', ' HG ', 162.999, 128.197, 82.75], ['A', ' HE ', 161.067, 126.791, 79.496], ['A', ' HE ', 160.969, 126.957, 81.257], ['A', ' HE ', 160.888, 128.405, 80.218]] AA_SCO= 2.158421052631579 CA_SCO= 1.307
[['A', ' N ', 163.092, 133.185, 80.705], ['A', ' CA ', 162.377, 134.427, 80.491], ['A', ' C ', 162.56, 134.9, 79.055], ['A', ' O ', 161.62, 135.428, 78.472], ['A', ' CB ', 162.781, 135.507, 81.506], ['A', ' CG1', 162.32, 135.052, 82.923], ['A', ' CG2', 162.128, 136.854, 81.119], ['A', ' CD1', 162.903, 135.869, 84.08], ['A', ' H ', 163.919, 133.192, 81.296], ['A', ' HA ', 161.316, 134.233, 80.638], ['A', ' HB ', 163.87, 135.608, 81.523], ['A', ' HG1', 161.253, 135.092, 82.967], ['A', ' HG1', 162.604, 134.02, 83.062], ['A', ' HG2', 162.402, 137.62, 81.833], ['A', ' HG2', 162.465, 137.169, 80.134], ['A', ' HG2', 161.044, 136.743, 81.102], ['A', ' HD1', 162.541, 135.483, 85.028], ['A', ' HD1', 163.996, 135.799, 84.056], ['A', ' HD1', 162.608, 136.906, 83.993]] AA_SCO= 2.187894736842105 CA_SCO= 1.3039473684210527
[['A', ' N ', 163.786, 134.813, 78.502], ['A', ' CA ', 163.996, 135.187, 77.1], ['A', ' C ', 163.144, 134.275, 76.202], ['A', ' O ', 162.48, 134.74, 75.26], ['A', ' H ', 164.581, 134.481, 79.055], ['A', ' HA ', 163.721, 136.23, 76.952], ['A', ' HA ', 165.051, 135.079, 76.852]] AA_SCO= 2.1047368421052632 CA_SCO= 1.2967368421052632
[['A', ' N ', 163.122, 132.986, 76.545], ['A', ' CA ', 162.287, 132.009, 75.876], ['A', ' C ', 160.912, 132.37, 76.356], ['A', ' O ', 160.776, 133.311, 77.116], ['A', ' CB ', 162.628, 130.573, 76.273], ['A', ' CG ', 164.023, 130.045, 75.933], ['A', ' CD1', 164.172, 128.707, 76.57], ['A', ' CD2', 164.188, 129.913, 74.438], ['A', ' H ', 163.727, 132.664, 77.31], ['A', ' HA ', 162.334, 132.133, 74.8], ['A', ' HB ', 162.505, 130.493, 77.353], ['A', ' HB ', 161.912, 129.902, 75.805], ['A', ' HG ', 164.783, 130.709, 76.324], ['A', ' HD1', 165.156, 128.296, 76.348], ['A', ' HD1', 164.057, 128.798, 77.648], ['A', ' HD1', 163.403, 128.054, 76.175], ['A', ' HD2', 165.178, 129.515, 74.22], ['A', ' HD2', 163.427, 129.232, 74.044], ['A', ' HD2', 164.083, 130.885, 73.965]] AA_SCO= 2.1184210526315788 CA_SCO= 1.2833157894736844
[['A', ' N ', 159.877, 131.755, 75.831], ['A', ' CA ', 158.486, 132.024, 76.229], ['A', ' C ', 158.007, 133.245, 75.496], ['A', ' O ', 156.985, 133.186, 74.833], ['A', ' CB ', 158.276, 132.324, 77.731], ['A', ' CG1', 158.739, 131.173, 78.546], ['A', ' CG2', 156.738, 132.547, 77.968], ['A', ' CD1', 158.795, 131.505, 80.019], ['A', ' H ', 160.052, 131.042, 75.133], ['A', ' HA ', 157.862, 131.189, 75.944], ['A', ' HB ', 158.762, 133.229, 78.063], ['A', ' HG1', 158.128, 130.333, 78.341], ['A', ' HG1', 159.742, 130.912, 78.259], ['A', ' HG2', 156.527, 132.756, 79.007], ['A', ' HG2', 156.388, 133.39, 77.385], ['A', ' HG2', 156.191, 131.651, 77.667], ['A', ' HD1', 159.182, 130.653, 80.572], ['A', ' HD1', 159.445, 132.353, 80.178], ['A', ' HD1', 157.83, 131.757, 80.403]] AA_SCO= 2.081578947368421 CA_SCO= 1.2815789473684214
[['A', ' N ', 158.679, 134.376, 75.666], ['A', ' CA ', 158.315, 135.517, 74.849], ['A', ' C ', 158.825, 135.246, 73.428], ['A', ' O ', 158.116, 135.453, 72.437], ['A', ' CB ', 158.874, 136.815, 75.419], ['A', ' CG ', 158.21, 137.248, 76.733], ['A', ' CD ', 158.729, 138.564, 77.262], ['A', ' OE1', 159.688, 139.062, 76.724], ['A', ' OE2', 158.15, 139.078, 78.193], ['A', ' H ', 159.467, 134.382, 76.326], ['A', ' HA ', 157.23, 135.598, 74.816], ['A', ' HB ', 159.945, 136.688, 75.614], ['A', ' HB ', 158.762, 137.617, 74.691], ['A', ' HG ', 157.133, 137.324, 76.579], ['A', ' HG ', 158.384, 136.469, 77.481]] AA_SCO= 2.154210526315789 CA_SCO= 1.2775263157894738
[['A', ' N ', 160.038, 134.69, 73.335], ['A', ' CA ', 160.637, 134.305, 72.069], ['A', ' C ', 159.969, 133.009, 71.65], ['A', ' O ', 159.959, 132.048, 72.419], ['A', ' CB ', 162.151, 134.107, 72.163], ['A', ' CG ', 162.807, 133.875, 70.78], ['A', ' OD1', 162.079, 133.82, 69.797], ['A', ' OD2', 164.006, 133.75, 70.703], ['A', ' H ', 160.613, 134.574, 74.175], ['A', ' HA ', 160.427, 135.07, 71.321], ['A', ' HB ', 162.605, 134.981, 72.635], ['A', ' HB ', 162.363, 133.256, 72.792]] AA_SCO= 2.0978947368421053 CA_SCO= 1.2623684210526318
[['A', ' N ', 159.34, 133.001, 70.479], ['A', ' CA ', 158.557, 131.853, 70.012], ['A', ' C ', 157.432, 131.626, 70.993], ['A', ' O ', 157.121, 130.498, 71.384], ['A', ' CB ', 159.416, 130.584, 69.909], ['A', ' CG ', 160.719, 130.761, 69.138], ['A', ' CD ', 160.527, 130.996, 67.646], ['A', ' CE ', 161.884, 131.255, 66.975], ['A', ' NZ ', 162.353, 132.695, 67.167], ['A', ' H ', 159.427, 133.825, 69.9], ['A', ' HA ', 158.116, 132.085, 69.044], ['A', ' HB ', 159.648, 130.195, 70.898], ['A', ' HB ', 158.842, 129.814, 69.398], ['A', ' HG ', 161.28, 131.573, 69.561], ['A', ' HG ', 161.308, 129.857, 69.266], ['A', ' HD ', 160.057, 130.126, 67.189], ['A', ' HD ', 159.894, 131.863, 67.484], ['A', ' HE ', 162.619, 130.59, 67.425], ['A', ' HE ', 161.817, 131.041, 65.91], ['A', ' HZ ', 163.251, 132.821, 66.73], ['A', ' HZ ', 161.689, 133.317, 66.741], ['A', ' HZ ', 162.433, 132.961, 68.174]] AA_SCO= 1.9973684210526315 CA_SCO= 1.215421052631579
[['A', ' N ', 156.816, 132.734, 71.363], ['A', ' CA ', 155.73, 132.75, 72.298], ['A', ' C ', 154.363, 132.558, 71.694], ['A', ' O ', 154.193, 132.126, 70.55], ['A', ' H ', 157.158, 133.614, 71.0], ['A', ' HA ', 155.899, 131.977, 73.046], ['A', ' HA ', 155.748, 133.705, 72.824]] AA_SCO= 1.9868421052631582 CA_SCO= 1.010157894736842
[['A', ' N ', 153.383, 132.852, 72.519], ['A', ' CA ', 151.99, 132.661, 72.226], ['A', ' C ', 151.349, 134.028, 71.958], ['A', ' O ', 151.953, 135.037, 72.311], ['A', ' CB ', 151.414, 131.926, 73.429], ['A', ' CG ', 152.179, 130.601, 73.814], ['A', ' CD1', 151.597, 130.038, 75.061], ['A', ' CD2', 152.082, 129.575, 72.71], ['A', ' H ', 153.639, 133.23, 73.421], ['A', ' HA ', 151.923, 132.045, 71.342], ['A', ' HB ', 151.4, 132.594, 74.291], ['A', ' HB ', 150.418, 131.634, 73.201], ['A', ' HG ', 153.228, 130.826, 74.001], ['A', ' HD1', 152.131, 129.128, 75.328], ['A', ' HD1', 151.695, 130.755, 75.862], ['A', ' HD1', 150.548, 129.805, 74.901], ['A', ' HD2', 152.617, 128.672, 73.013], ['A', ' HD2', 151.05, 129.331, 72.54], ['A', ' HD2', 152.526, 129.952, 71.793]] AA_SCO= 2.08578947368421 CA_SCO= 0.992736842105263
[['A', ' N ', 150.174, 134.108, 71.3], ['A', ' CA ', 149.45, 135.331, 70.971], ['A', ' C ', 149.127, 136.212, 72.159], ['A', ' O ', 148.792, 135.73, 73.246], ['A', ' CB ', 148.146, 134.785, 70.395], ['A', ' CG ', 148.495, 133.449, 69.846], ['A', ' CD ', 149.514, 132.894, 70.794], ['A', ' HA ', 150.015, 135.898, 70.217], ['A', ' HB ', 147.401, 134.726, 71.195], ['A', ' HB ', 147.753, 135.48, 69.637], ['A', ' HG ', 147.589, 132.823, 69.798], ['A', ' HG ', 148.871, 133.535, 68.817], ['A', ' HD ', 149.018, 132.351, 71.587], ['A', ' HD ', 150.18, 132.269, 70.202]] AA_SCO= 2.0010526315789474 CA_SCO= 0.9459473684210524
[['A', ' N ', 149.203, 137.51, 71.933], ['A', ' CA ', 148.92, 138.473, 72.967], ['A', ' C ', 147.475, 138.36, 73.391], ['A', ' O ', 146.58, 138.218, 72.559], ['A', ' CB ', 149.206, 139.879, 72.453], ['A', ' CG ', 150.662, 140.105, 72.075], ['A', ' CD ', 150.979, 139.664, 70.662], ['A', ' OE1', 150.106, 139.111, 70.019], ['A', ' OE2', 152.081, 139.872, 70.229], ['A', ' H ', 149.483, 137.856, 71.009], ['A', ' HA ', 149.557, 138.265, 73.826], ['A', ' HB ', 148.588, 140.082, 71.578], ['A', ' HB ', 148.939, 140.607, 73.217], ['A', ' HG ', 150.895, 141.165, 72.175], ['A', ' HG ', 151.294, 139.553, 72.769]] AA_SCO= 1.985263157894737 CA_SCO= 1.06
[['A', ' N ', 147.238, 138.435, 74.691], ['A', ' CA ', 145.885, 138.343, 75.207], ['A', ' C ', 145.533, 136.905, 75.562], ['A', ' O ', 144.452, 136.625, 76.098], ['A', ' H ', 148.01, 138.554, 75.333], ['A', ' HA ', 145.786, 138.977, 76.084], ['A', ' HA ', 145.185, 138.719, 74.462]] AA_SCO= 1.9552631578947368 CA_SCO= 1.060157894736842
[['A', ' N ', 146.42, 135.967, 75.247], ['A', ' CA ', 146.101, 134.608, 75.577], ['A', ' C ', 146.202, 134.453, 77.066], ['A', ' O ', 147.233, 134.766, 77.672], ['A', ' CB ', 147.042, 133.652, 74.849], ['A', ' CG ', 146.844, 132.165, 75.114], ['A', ' CD1', 145.497, 131.692, 74.593], ['A', ' CD2', 147.934, 131.416, 74.448], ['A', ' H ', 147.29, 136.177, 74.747], ['A', ' HA ', 145.082, 134.407, 75.276], ['A', ' HB ', 146.921, 133.817, 73.776], ['A', ' HB ', 148.068, 133.912, 75.107], ['A', ' HG ', 146.893, 131.995, 76.175], ['A', ' HD1', 145.374, 130.635, 74.788], ['A', ' HD1', 144.684, 132.219, 75.071], ['A', ' HD1', 145.463, 131.864, 73.525], ['A', ' HD2', 147.843, 130.359, 74.659], ['A', ' HD2', 147.884, 131.583, 73.383], ['A', ' HD2', 148.866, 131.768, 74.826]] AA_SCO= 2.0473684210526315 CA_SCO= 1.0920526315789474
[['A', ' N ', 145.103, 134.007, 77.658], ['A', ' CA ', 144.992, 133.849, 79.091], ['A', ' C ', 144.642, 135.155, 79.808], ['A', ' O ', 144.813, 135.239, 81.019], ['A', ' H ', 144.303, 133.776, 77.077], ['A', ' HA ', 144.219, 133.107, 79.298], ['A', ' HA ', 145.918, 133.457, 79.493]] AA_SCO= 1.980526315789474 CA_SCO= 1.0631578947368419
[['A', ' N ', 144.2, 136.194, 79.091], ['A', ' CA ', 143.864, 137.449, 79.759], ['A', ' C ', 142.357, 137.61, 79.792], ['A', ' O ', 141.731, 137.787, 78.747], ['A', ' CB ', 144.477, 138.628, 78.999], ['A', ' CG1', 144.134, 139.921, 79.673], ['A', ' CG2', 145.94, 138.45, 78.941], ['A', ' H ', 144.079, 136.125, 78.076], ['A', ' HA ', 144.243, 137.43, 80.781], ['A', ' HB ', 144.067, 138.658, 77.989], ['A', ' HG1', 144.576, 140.747, 79.12], ['A', ' HG1', 143.054, 140.057, 79.709], ['A', ' HG1', 144.53, 139.903, 80.673], ['A', ' HG2', 146.403, 139.274, 78.408], ['A', ' HG2', 146.293, 138.428, 79.941], ['A', ' HG2', 146.182, 137.516, 78.439]] AA_SCO= 2.025263157894737 CA_SCO= 1.0876842105263158
[['A', ' N ', 141.767, 137.579, 80.987], ['A', ' CA ', 140.311, 137.593, 81.096], ['A', ' C ', 139.949, 137.64, 82.547], ['A', ' O ', 138.823, 137.939, 82.948], ['A', ' CB ', 139.744, 136.279, 80.565], ['A', ' CG ', 140.099, 135.169, 81.497], ['A', ' ND1', 141.397, 134.865, 81.799], ['A', ' CD2', 139.336, 134.287, 82.186], ['A', ' CE1', 141.429, 133.865, 82.636], ['A', ' NE2', 140.191, 133.48, 82.886], ['A', ' H ', 142.321, 137.474, 81.839], ['A', ' HA ', 139.88, 138.449, 80.578], ['A', ' HB ', 138.661, 136.342, 80.49], ['A', ' HB ', 140.135, 136.048, 79.576], ['A', ' HD2', 138.252, 134.232, 82.174], ['A', ' HE1', 142.329, 133.416, 83.045], ['A', ' HE2', 139.943, 132.679, 83.505]] AA_SCO= 2.0389473684210526 CA_SCO= 1.0625263157894735
[['A', ' N ', 140.926, 137.232, 83.305], ['A', ' CA ', 140.841, 136.921, 84.695], ['A', ' C ', 140.528, 138.02, 85.645], ['A', ' O ', 140.961, 139.162, 85.493], ['A', ' CB ', 142.158, 136.356, 85.096], ['A', ' CG ', 143.192, 137.323, 84.736], ['A', ' OD1', 143.327, 137.708, 83.544], ['A', ' ND2', 143.924, 137.784, 85.701], ['A', ' H ', 141.824, 137.085, 82.852], ['A', ' HA ', 140.068, 136.16, 84.811], ['A', ' HB ', 142.168, 136.216, 86.168], ['A', ' HB ', 142.362, 135.409, 84.637], ['A', ' HD2', 144.635, 138.443, 85.505], ['A', ' HD2', 143.778, 137.465, 86.641]] AA_SCO= 2.0989473684210527 CA_SCO= 1.3223684210526316
[['A', ' N ', 139.798, 137.621, 86.666], ['A', ' CA ', 139.493, 138.448, 87.791], ['A', ' C ', 140.613, 138.344, 88.826], ['A', ' O ', 140.968, 137.233, 89.229], ['A', ' CB ', 138.196, 137.983, 88.418], ['A', ' CG ', 137.855, 138.635, 89.743], ['A', ' CD ', 137.506, 140.071, 89.675], ['A', ' OE1', 136.562, 140.466, 88.979], ['A', ' NE2', 138.239, 140.894, 90.408], ['A', ' H ', 139.454, 136.671, 86.662], ['A', ' HA ', 139.356, 139.451, 87.42], ['A', ' HB ', 137.374, 138.18, 87.732], ['A', ' HB ', 138.237, 136.915, 88.558], ['A', ' HG ', 137.02, 138.1, 90.158], ['A', ' HG ', 138.696, 138.536, 90.414], ['A', ' HE2', 138.046, 141.878, 90.418], ['A', ' HE2', 139.034, 140.529, 90.955]] AA_SCO= 2.121052631578947 CA_SCO= 1.4385263157894734
[['A', ' N ', 141.278, 139.439, 89.174], ['A', ' CA ', 142.303, 139.503, 90.181], ['A', ' C ', 141.711, 139.504, 91.581], ['A', ' O ', 140.57, 139.938, 91.749], ['A', ' CB ', 142.976, 140.849, 89.855], ['A', ' CG ', 141.897, 141.688, 89.258], ['A', ' CD ', 141.058, 140.729, 88.463], ['A', ' HA ', 142.986, 138.658, 90.031], ['A', ' HB ', 143.369, 141.309, 90.772], ['A', ' HB ', 143.826, 140.696, 89.174], ['A', ' HG ', 141.324, 142.186, 90.056], ['A', ' HG ', 142.332, 142.483, 88.634], ['A', ' HD ', 140.04, 141.086, 88.53], ['A', ' HD ', 141.414, 140.672, 87.422]] AA_SCO= 2.1510526315789473 CA_SCO= 1.4266842105263156
[['A', ' N ', 142.448, 139.081, 92.606], ['A', ' CA ', 143.728, 138.367, 92.618], ['A', ' C ', 143.876, 138.018, 94.08], ['A', ' O ', 143.489, 138.82, 94.934], ['A', ' CB ', 144.97, 139.17, 92.154], ['A', ' OG1', 146.071, 138.302, 92.127], ['A', ' CG2', 145.283, 140.322, 93.094], ['A', ' H ', 142.039, 139.213, 93.522], ['A', ' HA ', 143.657, 137.441, 92.045], ['A', ' HB ', 144.832, 139.543, 91.183], ['A', ' HG1', 145.95, 137.68, 91.395], ['A', ' HG2', 146.166, 140.848, 92.735], ['A', ' HG2', 144.44, 141.011, 93.122], ['A', ' HG2', 145.486, 139.963, 94.099]] AA_SCO= 2.0068421052631575 CA_SCO= 1.3960000000000001
[['A', ' N ', 144.467, 136.896, 94.396], ['A', ' CA ', 144.665, 136.562, 95.789], ['A', ' C ', 146.109, 136.389, 96.234], ['A', ' O ', 146.846, 135.586, 95.668], ['A', ' CB ', 143.867, 135.296, 96.063], ['A', ' CG ', 143.993, 134.663, 97.412], ['A', ' CD1', 143.443, 135.56, 98.462], ['A', ' CD2', 143.236, 133.364, 97.398], ['A', ' H ', 144.713, 136.238, 93.658], ['A', ' HA ', 144.242, 137.368, 96.381], ['A', ' HB ', 142.831, 135.546, 95.94], ['A', ' HB ', 144.12, 134.561, 95.306], ['A', ' HG ', 145.045, 134.468, 97.639], ['A', ' HD1', 143.566, 135.048, 99.384], ['A', ' HD1', 143.98, 136.499, 98.504], ['A', ' HD1', 142.385, 135.756, 98.275], ['A', ' HD2', 143.316, 132.878, 98.37], ['A', ' HD2', 142.186, 133.558, 97.177], ['A', ' HD2', 143.645, 132.704, 96.637]] AA_SCO= 2.119473684210526 CA_SCO= 1.3929473684210527
[['A', ' N ', 146.489, 137.11, 97.289], ['A', ' CA ', 147.814, 136.989, 97.893], ['A', ' C ', 147.793, 137.534, 99.332], ['A', ' O ', 146.978, 138.407, 99.63], ['A', ' CB ', 148.819, 137.716, 97.046], ['A', ' H ', 145.82, 137.759, 97.684], ['A', ' HA ', 148.079, 135.929, 97.936], ['A', ' HB ', 149.782, 137.573, 97.487], ['A', ' HB ', 148.804, 137.295, 96.051], ['A', ' HB ', 148.573, 138.776, 97.001]] AA_SCO= 1.991578947368421 CA_SCO= 1.3624210526315788
[['A', ' N ', 148.702, 137.071, 100.202], ['A', ' CA ', 148.828, 137.622, 101.572], ['A', ' C ', 150.254, 138.107, 101.901], ['A', ' O ', 150.434, 139.025, 102.703], ['A', ' CB ', 148.486, 136.571, 102.606], ['A', ' OG ', 149.469, 135.572, 102.645], ['A', ' H ', 149.306, 136.323, 99.901], ['A', ' HA ', 148.15, 138.467, 101.669], ['A', ' HB ', 148.401, 137.033, 103.587], ['A', ' HB ', 147.52, 136.125, 102.367], ['A', ' HG ', 149.551, 135.219, 101.734]] AA_SCO= 1.999473684210526 CA_SCO= 1.3598421052631577
[['A', ' N ', 151.255, 137.537, 101.241], ['A', ' CA ', 152.662, 137.909, 101.45], ['A', ' C ', 153.385, 137.579, 100.17], ['A', ' O ', 152.767, 137.079, 99.245], ['A', ' CB ', 153.315, 137.14, 102.593], ['A', ' CG ', 154.562, 137.771, 103.143], ['A', ' ND1', 155.772, 137.801, 102.456], ['A', ' CD2', 154.786, 138.371, 104.329], ['A', ' CE1', 156.682, 138.398, 103.216], ['A', ' NE2', 156.105, 138.755, 104.35], ['A', ' H ', 151.026, 136.759, 100.625], ['A', ' HA ', 152.761, 138.976, 101.636], ['A', ' HB ', 152.605, 137.037, 103.413], ['A', ' HB ', 153.583, 136.14, 102.254], ['A', ' HD2', 154.055, 138.517, 105.125], ['A', ' HE1', 157.726, 138.567, 102.953], ['A', ' HE2', 156.557, 139.227, 105.12]] AA_SCO= 2.0068421052631575 CA_SCO= 1.3603684210526317
[['A', ' N ', 154.679, 137.836, 100.086], ['A', ' CA ', 155.408, 137.505, 98.877], ['A', ' C ', 155.925, 136.074, 98.953], ['A', ' O ', 156.002, 135.38, 97.94], ['A', ' CB ', 156.579, 138.461, 98.656], ['A', ' CG ', 157.315, 138.226, 97.333], ['A', ' CD ', 156.44, 138.506, 96.156], ['A', ' OE1', 156.001, 139.632, 95.972], ['A', ' NE2', 156.143, 137.483, 95.383], ['A', ' H ', 155.158, 138.2, 100.894], ['A', ' HA ', 154.73, 137.585, 98.033], ['A', ' HB ', 156.214, 139.486, 98.665], ['A', ' HB ', 157.293, 138.353, 99.472], ['A', ' HG ', 158.166, 138.898, 97.288], ['A', ' HG ', 157.652, 137.196, 97.263], ['A', ' HE2', 155.482, 137.617, 94.607], ['A', ' HE2', 156.5, 136.566, 95.603]] AA_SCO= 2.012105263157894 CA_SCO= 1.3752105263157894
[['A', ' N ', 156.424, 135.697, 100.129], ['A', ' CA ', 156.97, 134.356, 100.383], ['A', ' C ', 156.453, 133.977, 101.748], ['A', ' O ', 156.609, 134.796, 102.631], ['A', ' CB ', 158.53, 134.351, 100.449], ['A', ' CG1', 159.183, 134.887, 99.127], ['A', ' CG2', 159.075, 132.922, 100.794], ['A', ' CD1', 159.039, 134.016, 97.89], ['A', ' H ', 156.326, 136.357, 100.918], ['A', ' HA ', 156.598, 133.651, 99.645], ['A', ' HB ', 158.842, 135.031, 101.242], ['A', ' HG1', 158.751, 135.85, 98.911], ['A', ' HG1', 160.249, 135.028, 99.309], ['A', ' HG2', 160.16, 132.966, 100.866], ['A', ' HG2', 158.675, 132.588, 101.748], ['A', ' HG2', 158.793, 132.207, 100.027], ['A', ' HD1', 159.528, 134.503, 97.046], ['A', ' HD1', 159.5, 133.048, 98.048], ['A', ' HD1', 157.989, 133.873, 97.648]] AA_SCO= 2.1042105263157893 CA_SCO= 1.4321578947368423
[['A', ' N ', 155.927, 132.769, 101.983], ['A', ' CA ', 155.525, 132.451, 103.374], ['A', ' C ', 154.424, 133.393, 103.862], ['A', ' O ', 154.668, 134.446, 104.451], ['A', ' CB ', 156.726, 132.433, 104.334], ['A', ' CG ', 156.377, 132.088, 105.763], ['A', ' CD1', 156.048, 130.806, 106.112], ['A', ' CD2', 156.422, 133.056, 106.724], ['A', ' CE1', 155.761, 130.483, 107.391], ['A', ' CE2', 156.133, 132.737, 108.025], ['A', ' CZ ', 155.806, 131.446, 108.356], ['A', ' OH ', 155.513, 131.114, 109.652], ['A', ' H ', 155.794, 132.086, 101.217], ['A', ' HA ', 155.105, 131.447, 103.38], ['A', ' HB ', 157.454, 131.702, 103.984], ['A', ' HB ', 157.233, 133.385, 104.358], ['A', ' HD1', 156.006, 130.049, 105.385], ['A', ' HD2', 156.688, 134.08, 106.453], ['A', ' HE1', 155.495, 129.456, 107.646], ['A', ' HE2', 156.168, 133.508, 108.795], ['A', ' HH ', 155.474, 131.91, 110.187]] AA_SCO= 1.9726315789473678 CA_SCO= 1.618526315789474
[['A', ' N ', 153.199, 132.96, 103.674], ['A', ' CA ', 152.037, 133.78, 103.952], ['A', ' C ', 151.704, 133.98, 105.391], ['A', ' O ', 152.417, 133.556, 106.301], ['A', ' H ', 153.069, 132.058, 103.253], ['A', ' HA ', 152.153, 134.746, 103.477], ['A', ' HA ', 151.169, 133.318, 103.481]] AA_SCO= 2.0626315789473684 CA_SCO= 1.624
[['A', ' N ', 150.603, 134.68, 105.585], ['A', ' CA ', 150.17, 135.045, 106.911], ['A', ' C ', 148.676, 134.858, 107.086], ['A', ' O ', 147.958, 134.535, 106.14], ['A', ' CB ', 150.516, 136.528, 107.115], ['A', ' CG ', 150.651, 136.983, 108.551], ['A', ' OD1', 150.413, 136.18, 109.43], ['A', ' OD2', 150.941, 138.154, 108.765], ['A', ' H ', 150.065, 134.979, 104.769], ['A', ' HA ', 150.693, 134.424, 107.64], ['A', ' HB ', 151.446, 136.751, 106.59], ['A', ' HB ', 149.73, 137.126, 106.652]] AA_SCO= 2.163684210526316 CA_SCO= 1.6680526315789472
[['A', ' N ', 148.216, 135.152, 108.281], ['A', ' CA ', 146.807, 135.157, 108.611], ['A', ' C ', 146.434, 136.61, 108.515], ['A', ' O ', 147.333, 137.446, 108.438], ['A', ' CB ', 146.539, 134.572, 109.979], ['A', ' CG ', 147.136, 135.334, 111.119], ['A', ' CD ', 146.862, 134.669, 112.389], ['A', ' NE ', 147.44, 135.397, 113.499], ['A', ' CZ ', 147.304, 135.052, 114.795], ['A', ' NH1', 146.592, 133.999, 115.117], ['A', ' NH2', 147.89, 135.78, 115.736], ['A', ' H ', 148.913, 135.401, 108.988], ['A', ' HA ', 146.244, 134.597, 107.865], ['A', ' HB ', 145.466, 134.508, 110.146], ['A', ' HB ', 146.932, 133.553, 110.02], ['A', ' HG ', 148.217, 135.396, 110.991], ['A', ' HG ', 146.722, 136.338, 111.162], ['A', ' HD ', 145.784, 134.603, 112.537], ['A', ' HD ', 147.293, 133.664, 112.37], ['A', ' HE ', 147.999, 136.216, 113.281], ['A', ' HH1', 146.129, 133.447, 114.399], ['A', ' HH1', 146.469, 133.719, 116.086], ['A', ' HH2', 148.438, 136.591, 115.482], ['A', ' HH2', 147.788, 135.523, 116.707]] AA_SCO= 2.098421052631579 CA_SCO= 1.6944736842105264
[['A', ' N ', 145.148, 136.939, 108.503], ['A', ' CA ', 144.79, 138.334, 108.284], ['A', ' C ', 145.279, 138.577, 106.871], ['A', ' O ', 145.823, 137.652, 106.267], ['A', ' CB ', 145.301, 139.353, 109.352], ['A', ' OG1', 146.711, 139.348, 109.467], ['A', ' CG2', 144.713, 139.038, 110.7], ['A', ' H ', 144.432, 136.233, 108.588], ['A', ' HA ', 143.704, 138.428, 108.268], ['A', ' HB ', 144.985, 140.35, 109.056], ['A', ' HG1', 147.107, 139.097, 108.626], ['A', ' HG2', 145.06, 139.772, 111.427], ['A', ' HG2', 143.629, 139.071, 110.64], ['A', ' HG2', 145.029, 138.047, 111.009]] AA_SCO= 1.9647368421052627 CA_SCO= 1.6933157894736839
[['A', ' N ', 144.966, 139.721, 106.267], ['A', ' CA ', 145.168, 139.922, 104.818], ['A', ' C ', 144.109, 139.041, 104.146], ['A', ' O ', 143.103, 139.534, 103.628], ['A', ' CB ', 146.575, 139.565, 104.283], ['A', ' CG ', 147.727, 140.509, 104.642], ['A', ' CD ', 148.331, 140.184, 106.033], ['A', ' CE ', 149.682, 140.903, 106.239], ['A', ' NZ ', 150.264, 140.705, 107.644], ['A', ' H ', 144.546, 140.459, 106.811], ['A', ' HA ', 144.954, 140.962, 104.561], ['A', ' HB ', 146.885, 138.579, 104.523], ['A', ' HB ', 146.52, 139.588, 103.196], ['A', ' HG ', 148.51, 140.414, 103.883], ['A', ' HG ', 147.366, 141.535, 104.641], ['A', ' HD ', 147.648, 140.506, 106.816], ['A', ' HD ', 148.473, 139.105, 106.13], ['A', ' HE ', 150.395, 140.522, 105.505], ['A', ' HE ', 149.535, 141.967, 106.068], ['A', ' HZ ', 151.135, 141.201, 107.719], ['A', ' HZ ', 149.618, 141.064, 108.331], ['A', ' HZ ', 150.446, 139.702, 107.871]] AA_SCO= 1.9110526315789471 CA_SCO= 1.6559473684210524
[['A', ' N ', 144.286, 137.723, 104.214], ['A', ' CA ', 143.254, 136.835, 103.743], ['A', ' C ', 142.172, 136.85, 104.776], ['A', ' O ', 142.125, 136.072, 105.738], ['A', ' CB ', 143.733, 135.417, 103.547], ['A', ' CG ', 142.652, 134.554, 102.994], ['A', ' CD1', 142.186, 134.761, 101.739], ['A', ' CD2', 142.108, 133.541, 103.719], ['A', ' CE1', 141.207, 133.981, 101.2], ['A', ' CE2', 141.124, 132.768, 103.178], ['A', ' CZ ', 140.674, 132.983, 101.929], ['A', ' H ', 145.127, 137.369, 104.657], ['A', ' HA ', 142.847, 137.219, 102.809], ['A', ' HB ', 144.577, 135.405, 102.863], ['A', ' HB ', 144.067, 135.002, 104.497], ['A', ' HD1', 142.601, 135.571, 101.167], ['A', ' HD2', 142.464, 133.353, 104.735], ['A', ' HE1', 140.858, 134.171, 100.184], ['A', ' HE2', 140.705, 131.973, 103.742], ['A', ' HZ ', 139.887, 132.353, 101.519]] AA_SCO= 1.72 CA_SCO= 1.668684210526316
[['A', ' N ', 141.275, 137.769, 104.568], ['A', ' CA ', 140.243, 137.977, 105.522], ['A', ' C ', 139.148, 136.988, 105.216], ['A', ' O ', 138.247, 137.252, 104.409], ['A', ' CB ', 139.735, 139.406, 105.426], ['A', ' CG ', 138.767, 139.769, 106.49], ['A', ' OD1', 138.55, 138.961, 107.364], ['A', ' OD2', 138.235, 140.853, 106.432], ['A', ' H ', 141.405, 138.395, 103.769], ['A', ' HA ', 140.628, 137.791, 106.525], ['A', ' HB ', 140.583, 140.092, 105.468], ['A', ' HB ', 139.27, 139.542, 104.479]] AA_SCO= 1.7042105263157896 CA_SCO= 1.6658947368421053
[['A', ' N ', 139.18, 135.865, 105.918], ['A', ' CA ', 138.274, 134.74, 105.702], ['A', ' C ', 136.941, 134.986, 106.392], ['A', ' O ', 136.521, 134.29, 107.313], ['A', ' CB ', 138.996, 133.465, 106.203], ['A', ' CG ', 138.333, 132.041, 106.078], ['A', ' CD1', 137.794, 131.815, 104.755], ['A', ' CD2', 139.413, 130.99, 106.312], ['A', ' H ', 139.976, 135.768, 106.55], ['A', ' HA ', 138.104, 134.651, 104.631], ['A', ' HB ', 139.968, 133.425, 105.736], ['A', ' HB ', 139.157, 133.617, 107.26], ['A', ' HG ', 137.535, 131.934, 106.816], ['A', ' HD1', 137.357, 130.817, 104.703], ['A', ' HD1', 137.05, 132.535, 104.641], ['A', ' HD1', 138.537, 131.914, 103.991], ['A', ' HD2', 138.975, 129.996, 106.232], ['A', ' HD2', 140.196, 131.081, 105.593], ['A', ' HD2', 139.828, 131.119, 107.276]] AA_SCO= 1.7173684210526317 CA_SCO= 1.683
[['A', ' N ', 136.286, 136.01, 105.847], ['A', ' CA ', 135.008, 136.584, 106.209], ['A', ' C ', 134.414, 136.963, 104.867], ['A', ' O ', 133.203, 136.999, 104.66], ['A', ' CB ', 135.185, 137.816, 107.101], ['A', ' CG ', 133.888, 138.284, 107.799], ['A', ' OD1', 133.342, 137.514, 108.556], ['A', ' OD2', 133.466, 139.399, 107.577], ['A', ' H ', 136.775, 136.476, 105.09], ['A', ' HA ', 134.38, 135.841, 106.698], ['A', ' HB ', 135.938, 137.603, 107.864], ['A', ' HB ', 135.578, 138.644, 106.502]] AA_SCO= 1.644736842105263 CA_SCO= 1.6515789473684213
[['A', ' N ', 135.331, 137.22, 103.93], ['A', ' CA ', 135.036, 137.645, 102.566], ['A', ' C ', 134.988, 136.456, 101.636], ['A', ' O ', 134.903, 136.595, 100.423], ['A', ' CB ', 136.089, 138.612, 102.068], ['A', ' CG ', 136.084, 139.967, 102.697], ['A', ' CD ', 137.32, 140.734, 102.37], ['A', ' NE ', 137.521, 140.984, 100.944], ['A', ' CZ ', 138.645, 141.549, 100.429], ['A', ' NH1', 139.626, 141.939, 101.229], ['A', ' NH2', 138.77, 141.704, 99.125], ['A', ' H ', 136.32, 137.152, 104.192], ['A', ' HA ', 134.066, 138.142, 102.554], ['A', ' HB ', 137.057, 138.192, 102.265], ['A', ' HB ', 136.001, 138.734, 100.991], ['A', ' HG ', 135.227, 140.528, 102.334], ['A', ' HG ', 136.025, 139.863, 103.783], ['A', ' HD ', 137.288, 141.691, 102.887], ['A', ' HD ', 138.162, 140.169, 102.716], ['A', ' HE ', 136.778, 140.688, 100.272], ['A', ' HH1', 139.549, 141.818, 102.229], ['A', ' HH1', 140.462, 142.352, 100.84], ['A', ' HH2', 138.022, 141.365, 98.502], ['A', ' HH2', 139.597, 142.113, 98.734]] AA_SCO= 1.7299999999999998 CA_SCO= 1.499105263157895
[['A', ' N ', 135.091, 135.28, 102.201], ['A', ' CA ', 135.131, 134.06, 101.435], ['A', ' C ', 133.874, 133.199, 101.446], ['A', ' O ', 133.295, 132.939, 102.502], ['A', ' CB ', 136.229, 133.229, 101.988], ['A', ' CG ', 136.244, 131.967, 101.427], ['A', ' CD1', 136.718, 131.795, 100.2], ['A', ' CD2', 135.729, 130.905, 102.12], ['A', ' CE1', 136.693, 130.602, 99.646], ['A', ' CE2', 135.697, 129.693, 101.568], ['A', ' CZ ', 136.176, 129.535, 100.322], ['A', ' H ', 135.132, 135.232, 103.209], ['A', ' HA ', 135.347, 134.317, 100.399], ['A', ' HB ', 137.197, 133.697, 101.868], ['A', ' HB ', 136.017, 133.14, 103.005], ['A', ' HD1', 137.109, 132.637, 99.652], ['A', ' HD2', 135.327, 131.056, 103.125], ['A', ' HE1', 137.078, 130.489, 98.663], ['A', ' HE2', 135.283, 128.842, 102.108], ['A', ' HZ ', 136.143, 128.547, 99.871]] AA_SCO= 1.7352631578947368 CA_SCO= 1.5138947368421056
[['A', ' N ', 133.51, 132.691, 100.263], ['A', ' CA ', 132.404, 131.759, 100.092], ['A', ' C ', 132.853, 130.395, 99.545], ['A', ' O ', 133.663, 130.306, 98.623], ['A', ' CB ', 131.338, 132.359, 99.157], ['A', ' OG1', 130.832, 133.561, 99.731], ['A', ' CG2', 130.191, 131.394, 98.956], ['A', ' H ', 133.999, 132.993, 99.418], ['A', ' HA ', 131.948, 131.592, 101.067], ['A', ' HB ', 131.792, 132.591, 98.191], ['A', ' HG1', 131.534, 134.218, 99.73], ['A', ' HG2', 129.456, 131.854, 98.301], ['A', ' HG2', 130.541, 130.478, 98.503], ['A', ' HG2', 129.729, 131.169, 99.914]] AA_SCO= 1.8242105263157893 CA_SCO= 1.4373157894736845
[['A', ' N ', 132.341, 129.317, 100.133], ['A', ' CA ', 132.643, 127.97, 99.642], ['A', ' C ', 131.541, 127.468, 98.71], ['A', ' O ', 130.387, 127.339, 99.126], ['A', ' CB ', 132.786, 126.995, 100.809], ['A', ' CG ', 133.098, 125.542, 100.419], ['A', ' CD ', 134.486, 125.335, 99.905], ['A', ' OE1', 135.321, 126.133, 100.21], ['A', ' OE2', 134.714, 124.359, 99.229], ['A', ' H ', 131.705, 129.436, 100.91], ['A', ' HA ', 133.58, 127.997, 99.083], ['A', ' HB ', 133.576, 127.335, 101.471], ['A', ' HB ', 131.862, 126.989, 101.384], ['A', ' HG ', 132.956, 124.912, 101.296], ['A', ' HG ', 132.39, 125.214, 99.664]] AA_SCO= 1.784736842105263 CA_SCO= 1.4392105263157895
[['A', ' N ', 131.881, 127.178, 97.461], ['A', ' CA ', 130.907, 126.718, 96.488], ['A', ' C ', 131.05, 125.281, 96.022], ['A', ' O ', 132.118, 124.799, 95.643], ['A', ' CB ', 130.9, 127.664, 95.279], ['A', ' CG1', 130.501, 129.071, 95.697], ['A', ' CG2', 130.075, 127.16, 94.141], ['A', ' CD1', 129.116, 129.245, 96.307], ['A', ' H ', 132.842, 127.316, 97.135], ['A', ' HA ', 129.931, 126.763, 96.954], ['A', ' HB ', 131.915, 127.764, 94.923], ['A', ' HG1', 131.247, 129.454, 96.395], ['A', ' HG1', 130.518, 129.664, 94.822], ['A', ' HG2', 130.148, 127.867, 93.346], ['A', ' HG2', 130.446, 126.204, 93.791], ['A', ' HG2', 129.038, 127.052, 94.437], ['A', ' HD1', 128.96, 130.299, 96.514], ['A', ' HD1', 128.352, 128.912, 95.612], ['A', ' HD1', 129.02, 128.696, 97.236]] AA_SCO= 1.9110526315789471 CA_SCO= 1.4171578947368422
[['A', ' N ', 129.933, 124.583, 96.03], ['A', ' CA ', 129.909, 123.224, 95.542], ['A', ' C ', 129.923, 123.354, 94.037], ['A', ' O ', 129.107, 124.116, 93.505], ['A', ' CB ', 128.693, 122.501, 96.073], ['A', ' CG ', 128.691, 122.383, 97.565], ['A', ' SD ', 130.065, 121.386, 98.169], ['A', ' CE ', 131.235, 122.608, 98.801], ['A', ' H ', 129.091, 125.027, 96.377], ['A', ' HA ', 130.807, 122.721, 95.874], ['A', ' HB ', 127.792, 123.037, 95.775], ['A', ' HB ', 128.622, 121.498, 95.655], ['A', ' HG ', 128.753, 123.371, 98.02], ['A', ' HG ', 127.76, 121.915, 97.887], ['A', ' HE ', 132.101, 122.103, 99.217], ['A', ' HE ', 131.563, 123.271, 98.015], ['A', ' HE ', 130.758, 123.194, 99.586]] AA_SCO= 1.923157894736842 CA_SCO= 1.418
[['A', ' N ', 130.721, 122.539, 93.331], ['A', ' CA ', 130.993, 122.629, 91.917], ['A', ' C ', 129.776, 122.531, 91.055], ['A', ' O ', 129.745, 123.103, 89.978], ['A', ' CB ', 131.897, 121.426, 91.664], ['A', ' CG ', 131.585, 120.465, 92.768], ['A', ' CD ', 131.261, 121.321, 93.961], ['A', ' HA ', 131.53, 123.563, 91.719], ['A', ' HB ', 131.68, 120.993, 90.679], ['A', ' HB ', 132.956, 121.743, 91.655], ['A', ' HG ', 130.744, 119.805, 92.476], ['A', ' HG ', 132.454, 119.805, 92.935], ['A', ' HD ', 130.501, 120.794, 94.553], ['A', ' HD ', 132.155, 121.522, 94.531]] AA_SCO= 1.865789473684211 CA_SCO= 1.4043157894736842
[['A', ' N ', 128.708, 121.923, 91.53], ['A', ' CA ', 127.554, 121.826, 90.678], ['A', ' C ', 127.042, 123.194, 90.249], ['A', ' O ', 126.563, 123.346, 89.127], ['A', ' CB ', 126.453, 121.043, 91.38], ['A', ' CG ', 126.793, 119.571, 91.623], ['A', ' CD ', 127.618, 119.332, 92.862], ['A', ' OE1', 127.975, 120.29, 93.514], ['A', ' OE2', 127.9, 118.195, 93.157], ['A', ' H ', 128.676, 121.445, 92.436], ['A', ' HA ', 127.858, 121.294, 89.789], ['A', ' HB ', 126.235, 121.507, 92.344], ['A', ' HB ', 125.543, 121.083, 90.784], ['A', ' HG ', 125.87, 118.999, 91.695], ['A', ' HG ', 127.347, 119.198, 90.767]] AA_SCO= 1.8621052631578945 CA_SCO= 1.3943684210526315
[['A', ' N ', 127.218, 124.209, 91.094], ['A', ' CA ', 126.725, 125.544, 90.809], ['A', ' C ', 127.474, 126.244, 89.678], ['A', ' O ', 127.027, 127.278, 89.188], ['A', ' CB ', 126.814, 126.398, 92.054], ['A', ' OG ', 125.94, 125.95, 93.058], ['A', ' H ', 127.671, 124.052, 92.001], ['A', ' HA ', 125.678, 125.463, 90.519], ['A', ' HB ', 127.833, 126.367, 92.423], ['A', ' HB ', 126.59, 127.433, 91.804], ['A', ' HG ', 126.09, 126.525, 93.814]] AA_SCO= 1.574736842105263 CA_SCO= 1.3976842105263156
[['A', ' N ', 128.646, 125.735, 89.311], ['A', ' CA ', 129.449, 126.328, 88.255], ['A', ' C ', 129.372, 125.681, 86.904], ['A', ' O ', 130.029, 126.155, 85.959], ['A', ' CB ', 130.882, 126.405, 88.667], ['A', ' CG ', 131.091, 127.567, 89.44], ['A', ' CD1', 130.499, 127.909, 90.588], ['A', ' CD2', 131.953, 128.636, 89.099], ['A', ' NE1', 130.927, 129.125, 90.982], ['A', ' CE2', 131.812, 129.588, 90.08], ['A', ' CE3', 132.813, 128.867, 88.04], ['A', ' CZ2', 132.487, 130.758, 90.045], ['A', ' CZ3', 133.498, 130.049, 88.008], ['A', ' CH2', 133.332, 130.971, 88.987], ['A', ' H ', 128.97, 124.863, 89.734], ['A', ' HA ', 129.105, 127.355, 88.135], ['A', ' HB ', 131.119, 125.522, 89.257], ['A', ' HB ', 131.527, 126.406, 87.8], ['A', ' HD1', 129.774, 127.312, 91.119], ['A', ' HE1', 130.625, 129.615, 91.811], ['A', ' HE3', 132.943, 128.134, 87.248], ['A', ' HZ2', 132.364, 131.513, 90.81], ['A', ' HZ3', 134.178, 130.235, 87.171], ['A', ' HH2', 133.875, 131.897, 88.927]] AA_SCO= 1.7405263157894737 CA_SCO= 1.4164210526315786
[['A', ' N ', 128.608, 124.615, 86.763], ['A', ' CA ', 128.593, 124.011, 85.461], ['A', ' C ', 127.158, 123.876, 85.028], ['A', ' O ', 126.296, 123.471, 85.798], ['A', ' CB ', 129.316, 122.672, 85.498], ['A', ' CG ', 130.744, 122.788, 86.024], ['A', ' CD1', 130.986, 122.49, 87.328], ['A', ' CD2', 131.777, 123.217, 85.234], ['A', ' CE1', 132.249, 122.609, 87.86], ['A', ' CE2', 133.06, 123.336, 85.767], ['A', ' CZ ', 133.285, 123.037, 87.069], ['A', ' OH ', 134.55, 123.156, 87.599], ['A', ' H ', 128.041, 124.238, 87.536], ['A', ' HA ', 129.087, 124.66, 84.739], ['A', ' HB ', 128.778, 121.992, 86.134], ['A', ' HB ', 129.341, 122.242, 84.499], ['A', ' HD1', 130.167, 122.153, 87.94], ['A', ' HD2', 131.589, 123.46, 84.198], ['A', ' HE1', 132.422, 122.368, 88.902], ['A', ' HE2', 133.888, 123.671, 85.15], ['A', ' HH ', 135.172, 123.44, 86.907]] AA_SCO= 1.7173684210526317 CA_SCO= 1.4245263157894734
[['A', ' N ', 126.892, 124.249, 83.791], ['A', ' CA ', 125.557, 124.139, 83.249], ['A', ' C ', 125.266, 122.73, 82.795], ['A', ' O ', 124.146, 122.237, 82.907], ['A', ' CB ', 125.448, 125.143, 82.119], ['A', ' CG ', 126.61, 124.977, 81.143], ['A', ' OD1', 127.552, 124.239, 81.47], ['A', ' OD2', 126.602, 125.618, 80.113], ['A', ' H ', 127.639, 124.575, 83.178], ['A', ' HA ', 124.841, 124.405, 84.028], ['A', ' HB ', 124.507, 124.993, 81.588], ['A', ' HB ', 125.449, 126.155, 82.521]] AA_SCO= 1.5231578947368423 CA_SCO= 1.4199473684210522
[['A', ' N ', 126.317, 122.086, 82.336], ['A', ' CA ', 126.309, 120.728, 81.834], ['A', ' C ', 126.465, 119.743, 82.997], ['A', ' O ', 127.534, 119.75, 83.624], ['A', ' CB ', 127.461, 120.509, 80.843], ['A', ' CG ', 127.395, 119.128, 80.196], ['A', ' OD1', 126.533, 118.366, 80.629], ['A', ' OD2', 128.173, 118.824, 79.299], ['A', ' H ', 127.154, 122.661, 82.249], ['A', ' HA ', 125.39, 120.574, 81.286], ['A', ' HB ', 127.42, 121.278, 80.066], ['A', ' HB ', 128.418, 120.619, 81.36]] AA_SCO= 1.5115789473684211 CA_SCO= 1.4236315789473681
[['A', ' N ', 125.453, 118.896, 83.319], ['A', ' CA ', 125.454, 117.911, 84.389], ['A', ' C ', 126.623, 116.944, 84.239], ['A', ' O ', 127.093, 116.368, 85.216], ['A', ' CB ', 124.13, 117.18, 84.191], ['A', ' CG ', 123.253, 118.169, 83.497], ['A', ' CD ', 124.173, 118.934, 82.583], ['A', ' HA ', 125.467, 118.427, 85.35], ['A', ' HB ', 124.293, 116.266, 83.596], ['A', ' HB ', 123.729, 116.862, 85.162], ['A', ' HG ', 122.454, 117.652, 82.948], ['A', ' HG ', 122.763, 118.821, 84.234], ['A', ' HD ', 124.269, 118.439, 81.602], ['A', ' HD ', 123.768, 119.937, 82.507]] AA_SCO= 1.6289473684210527 CA_SCO= 1.4037894736842103
[['A', ' N ', 127.142, 116.812, 83.013], ['A', ' CA ', 128.266, 115.929, 82.774], ['A', ' C ', 129.455, 116.407, 83.561], ['A', ' O ', 130.263, 115.607, 84.017], ['A', ' CB ', 128.645, 115.9, 81.297], ['A', ' CG ', 129.84, 115.011, 80.932], ['A', ' CD ', 129.636, 113.56, 81.181], ['A', ' OE1', 128.509, 113.138, 81.307], ['A', ' OE2', 130.621, 112.857, 81.23], ['A', ' H ', 126.754, 117.319, 82.203], ['A', ' HA ', 128.003, 114.922, 83.103], ['A', ' HB ', 127.783, 115.596, 80.702], ['A', ' HB ', 128.91, 116.904, 80.986], ['A', ' HG ', 130.045, 115.148, 79.872], ['A', ' HG ', 130.719, 115.348, 81.477]] AA_SCO= 1.6542105263157894 CA_SCO= 1.4457894736842103
[['A', ' N ', 129.604, 117.71, 83.71], ['A', ' CA ', 130.736, 118.184, 84.44], ['A', ' C ', 130.332, 118.334, 85.875], ['A', ' O ', 131.038, 117.9, 86.787], ['A', ' CB ', 131.258, 119.508, 83.928], ['A', ' CG1', 131.732, 119.335, 82.486], ['A', ' CG2', 132.384, 119.906, 84.85], ['A', ' CD1', 132.09, 120.635, 81.782], ['A', ' H ', 128.914, 118.373, 83.353], ['A', ' HA ', 131.54, 117.452, 84.377], ['A', ' HB ', 130.48, 120.259, 83.923], ['A', ' HG1', 132.566, 118.668, 82.471], ['A', ' HG1', 130.926, 118.869, 81.917], ['A', ' HG2', 132.836, 120.813, 84.522], ['A', ' HG2', 132.04, 120.042, 85.865], ['A', ' HG2', 133.105, 119.123, 84.84], ['A', ' HD1', 132.389, 120.414, 80.76], ['A', ' HD1', 131.222, 121.297, 81.768], ['A', ' HD1', 132.911, 121.129, 82.29]] AA_SCO= 1.9515789473684209 CA_SCO= 1.4617368421052632
[['A', ' N ', 129.151, 118.882, 86.102], ['A', ' CA ', 128.743, 119.142, 87.466], ['A', ' C ', 128.817, 117.893, 88.329], ['A', ' O ', 129.263, 117.962, 89.468], ['A', ' CB ', 127.314, 119.639, 87.471], ['A', ' H ', 128.574, 119.191, 85.315], ['A', ' HA ', 129.409, 119.894, 87.885], ['A', ' HB ', 126.988, 119.838, 88.466], ['A', ' HB ', 127.217, 120.541, 86.873], ['A', ' HB ', 126.695, 118.872, 87.064]] AA_SCO= 1.8610526315789473 CA_SCO= 1.4679473684210524
[['A', ' N ', 128.464, 116.737, 87.774], ['A', ' CA ', 128.462, 115.499, 88.526], ['A', ' C ', 129.755, 114.699, 88.451], ['A', ' O ', 129.824, 113.612, 89.026], ['A', ' CB ', 127.303, 114.625, 88.069], ['A', ' CG ', 125.942, 115.22, 88.368], ['A', ' CD ', 124.824, 114.294, 87.926], ['A', ' CE ', 123.459, 114.883, 88.255], ['A', ' NZ ', 122.345, 113.985, 87.827], ['A', ' H ', 128.113, 116.715, 86.813], ['A', ' HA ', 128.301, 115.752, 89.574], ['A', ' HB ', 127.376, 114.467, 86.991], ['A', ' HB ', 127.364, 113.652, 88.552], ['A', ' HG ', 125.857, 115.416, 89.437], ['A', ' HG ', 125.848, 116.167, 87.834], ['A', ' HD ', 124.894, 114.141, 86.847], ['A', ' HD ', 124.93, 113.331, 88.422], ['A', ' HE ', 123.391, 115.042, 89.331], ['A', ' HE ', 123.354, 115.843, 87.748], ['A', ' HZ ', 121.459, 114.411, 88.064], ['A', ' HZ ', 122.391, 113.839, 86.829], ['A', ' HZ ', 122.426, 113.097, 88.301]] AA_SCO= 1.8863157894736844 CA_SCO= 1.476
[['A', ' N ', 130.751, 115.178, 87.715], ['A', ' CA ', 132.031, 114.481, 87.6], ['A', ' C ', 133.158, 115.23, 88.263], ['A', ' O ', 134.122, 114.619, 88.714], ['A', ' CB ', 132.426, 114.211, 86.165], ['A', ' CG ', 131.597, 113.174, 85.46], ['A', ' CD ', 132.039, 112.988, 84.059], ['A', ' NE ', 133.41, 112.462, 83.962], ['A', ' CZ ', 134.152, 112.474, 82.827], ['A', ' NH1', 133.645, 112.954, 81.705], ['A', ' NH2', 135.388, 111.99, 82.812], ['A', ' H ', 130.642, 116.093, 87.284], ['A', ' HA ', 131.937, 113.518, 88.1], ['A', ' HB ', 132.344, 115.137, 85.592], ['A', ' HB ', 133.468, 113.9, 86.131], ['A', ' HG ', 131.682, 112.223, 85.98], ['A', ' HG ', 130.552, 113.492, 85.451], ['A', ' HD ', 131.366, 112.285, 83.571], ['A', ' HD ', 132.001, 113.941, 83.539], ['A', ' HE ', 133.828, 112.072, 84.795], ['A', ' HH1', 132.668, 113.279, 81.661], ['A', ' HH1', 134.2, 112.954, 80.856], ['A', ' HH2', 135.812, 111.546, 83.634], ['A', ' HH2', 135.92, 112.006, 81.951]] AA_SCO= 1.976842105263158 CA_SCO= 1.511157894736842
[['A', ' N ', 133.056, 116.547, 88.316], ['A', ' CA ', 134.121, 117.34, 88.878], ['A', ' C ', 134.356, 116.904, 90.307], ['A', ' O ', 133.418, 116.765, 91.096], ['A', ' CB ', 133.763, 118.817, 88.792], ['A', ' H ', 132.253, 117.012, 87.898], ['A', ' HA ', 135.032, 117.147, 88.32], ['A', ' HB ', 134.567, 119.417, 89.21], ['A', ' HB ', 133.605, 119.088, 87.746], ['A', ' HB ', 132.845, 118.997, 89.351]] AA_SCO= 1.8952631578947372 CA_SCO= 1.7029473684210528
[['A', ' N ', 135.627, 116.764, 90.644], ['A', ' CA ', 136.073, 116.302, 91.954], ['A', ' C ', 136.732, 117.355, 92.822], ['A', ' O ', 137.601, 117.046, 93.637], ['A', ' CB ', 137.049, 115.156, 91.772], ['A', ' SG ', 136.325, 113.705, 91.011], ['A', ' H ', 136.315, 116.902, 89.897], ['A', ' HA ', 135.203, 115.921, 92.489], ['A', ' HB ', 137.879, 115.48, 91.143], ['A', ' HB ', 137.465, 114.858, 92.733], ['A', ' HG ', 137.46, 112.981, 91.037]] AA_SCO= 1.8726315789473684 CA_SCO= 1.6988947368421055
[['A', ' N ', 136.333, 118.598, 92.663], ['A', ' CA ', 136.869, 119.652, 93.497], ['A', ' C ', 135.828, 120.69, 93.8], ['A', ' O ', 134.856, 120.839, 93.066], ['A', ' CB ', 138.016, 120.314, 92.816], ['A', ' OG ', 137.604, 120.96, 91.647], ['A', ' H ', 135.647, 118.82, 91.957], ['A', ' HA ', 137.205, 119.22, 94.441], ['A', ' HB ', 138.409, 121.023, 93.484], ['A', ' HB ', 138.794, 119.59, 92.595], ['A', ' HG ', 138.388, 121.377, 91.295]] AA_SCO= 1.8973684210526314 CA_SCO= 1.8033157894736844
[['A', ' N ', 136.019, 121.415, 94.89], ['A', ' CA ', 135.106, 122.48, 95.242], ['A', ' C ', 135.63, 123.772, 94.693], ['A', ' O ', 136.758, 123.828, 94.21], ['A', ' CB ', 134.882, 122.583, 96.751], ['A', ' OG1', 136.099, 122.925, 97.396], ['A', ' CG2', 134.367, 121.256, 97.304], ['A', ' H ', 136.82, 121.248, 95.484], ['A', ' HA ', 134.15, 122.301, 94.771], ['A', ' HB ', 134.148, 123.368, 96.951], ['A', ' HG1', 135.862, 123.408, 98.231], ['A', ' HG2', 134.214, 121.354, 98.375], ['A', ' HG2', 133.424, 121.003, 96.824], ['A', ' HG2', 135.092, 120.466, 97.118]] AA_SCO= 1.9221052631578945 CA_SCO= 1.8006842105263154
[['A', ' N ', 134.814, 124.813, 94.744], ['A', ' CA ', 135.192, 126.111, 94.245], ['A', ' C ', 135.263, 127.188, 95.306], ['A', ' O ', 134.239, 127.681, 95.77], ['A', ' CB ', 134.19, 126.518, 93.165], ['A', ' CG1', 134.293, 125.461, 92.052], ['A', ' CG2', 134.307, 128.001, 92.735], ['A', ' CD1', 133.378, 125.649, 90.938], ['A', ' H ', 133.88, 124.704, 95.145], ['A', ' HA ', 136.154, 126.016, 93.753], ['A', ' HB ', 133.194, 126.381, 93.574], ['A', ' HG1', 135.308, 125.411, 91.693], ['A', ' HG1', 134.04, 124.494, 92.477], ['A', ' HG2', 133.552, 128.232, 92.002], ['A', ' HG2', 134.16, 128.665, 93.578], ['A', ' HG2', 135.255, 128.191, 92.332], ['A', ' HD1', 133.498, 124.83, 90.224], ['A', ' HD1', 132.361, 125.659, 91.316], ['A', ' HD1', 133.596, 126.584, 90.44]] AA_SCO= 1.9136842105263154 CA_SCO= 1.8702105263157893
[['A', ' N ', 136.444, 127.529, 95.789], ['A', ' CA ', 136.636, 128.604, 96.7], ['A', ' C ', 136.212, 129.836, 95.931], ['A', ' O ', 136.578, 129.955, 94.763], ['A', ' CB ', 138.137, 128.554, 96.934], ['A', ' CG ', 138.537, 127.182, 96.601], ['A', ' CD ', 137.641, 126.789, 95.48], ['A', ' HA ', 136.029, 128.442, 97.603], ['A', ' HB ', 138.589, 129.221, 96.254], ['A', ' HB ', 138.411, 128.862, 97.941], ['A', ' HG ', 139.602, 127.159, 96.307], ['A', ' HG ', 138.443, 126.516, 97.474], ['A', ' HD ', 138.061, 127.105, 94.515], ['A', ' HD ', 137.494, 125.711, 95.548]] AA_SCO= 1.8868421052631577 CA_SCO= 1.8711578947368421
[['A', ' N ', 135.525, 130.782, 96.538], ['A', ' CA ', 135.156, 131.94, 95.767], ['A', ' C ', 135.293, 133.224, 96.614], ['A', ' O ', 134.427, 133.555, 97.439], ['A', ' CB ', 133.711, 131.673, 95.338], ['A', ' CG ', 133.107, 132.568, 94.396], ['A', ' CD1', 133.783, 132.403, 93.079], ['A', ' CD2', 131.662, 132.287, 94.262], ['A', ' H ', 135.167, 130.664, 97.487], ['A', ' HA ', 135.83, 132.019, 94.922], ['A', ' HB ', 133.668, 130.669, 94.915], ['A', ' HB ', 133.092, 131.673, 96.236], ['A', ' HG ', 133.26, 133.555, 94.734], ['A', ' HD1', 133.334, 133.086, 92.366], ['A', ' HD1', 134.815, 132.606, 93.165], ['A', ' HD1', 133.655, 131.381, 92.735], ['A', ' HD2', 131.217, 132.981, 93.543], ['A', ' HD2', 131.55, 131.285, 93.902], ['A', ' HD2', 131.169, 132.398, 95.228]] AA_SCO= 1.928421052631579 CA_SCO= 1.8733157894736845
[['A', ' N ', 136.372, 133.972, 96.41], ['A', ' CA ', 136.655, 135.105, 97.293], ['A', ' C ', 135.918, 136.339, 96.808], ['A', ' O ', 135.983, 136.691, 95.635], ['A', ' CB ', 138.158, 135.337, 97.39], ['A', ' CG ', 138.572, 136.176, 98.533], ['A', ' CD1', 138.415, 135.626, 99.78], ['A', ' CD2', 139.138, 137.407, 98.394], ['A', ' CE1', 138.798, 136.286, 100.891], ['A', ' CE2', 139.541, 138.083, 99.534], ['A', ' CZ ', 139.362, 137.507, 100.778], ['A', ' OH ', 139.753, 138.138, 101.925], ['A', ' H ', 137.011, 133.732, 95.662], ['A', ' HA ', 136.276, 134.877, 98.285], ['A', ' HB ', 138.664, 134.416, 97.481], ['A', ' HB ', 138.509, 135.811, 96.472], ['A', ' HD1', 137.981, 134.648, 99.876], ['A', ' HD2', 139.278, 137.85, 97.406], ['A', ' HE1', 138.663, 135.831, 101.876], ['A', ' HE2', 140.0, 139.064, 99.447], ['A', ' HH ', 139.424, 137.619, 102.688]] AA_SCO= 1.9731578947368418 CA_SCO= 1.6809473684210527
[['A', ' N ', 135.136, 136.947, 97.687], ['A', ' CA ', 134.286, 138.085, 97.373], ['A', ' C ', 133.209, 137.707, 96.378], ['A', ' O ', 132.613, 138.573, 95.74], ['A', ' CB ', 135.064, 139.287, 96.817], ['A', ' CG ', 135.962, 139.96, 97.821], ['A', ' OD1', 135.577, 140.081, 98.969], ['A', ' OD2', 137.023, 140.4, 97.429], ['A', ' H ', 135.121, 136.625, 98.651], ['A', ' HA ', 133.797, 138.4, 98.296], ['A', ' HB ', 135.659, 139.001, 95.959], ['A', ' HB ', 134.35, 140.029, 96.463]] AA_SCO= 2.2931578947368414 CA_SCO= 1.6808947368421054
[['A', ' N ', 132.942, 136.416, 96.226], ['A', ' CA ', 131.901, 135.997, 95.313], ['A', ' C ', 132.389, 135.89, 93.873], ['A', ' O ', 131.593, 135.634, 92.967], ['A', ' H ', 133.457, 135.707, 96.758], ['A', ' HA ', 131.509, 135.035, 95.639], ['A', ' HA ', 131.075, 136.704, 95.362]] AA_SCO= 2.28578947368421 CA_SCO= 1.6787894736842108
[['A', ' N ', 133.683, 136.074, 93.641], ['A', ' CA ', 134.205, 136.003, 92.294], ['A', ' C ', 135.399, 135.077, 92.276], ['A', ' O ', 136.129, 134.974, 93.254], ['A', ' CB ', 134.572, 137.393, 91.827], ['A', ' CG ', 133.379, 138.335, 91.796], ['A', ' CD ', 133.701, 139.711, 91.381], ['A', ' NE ', 134.13, 139.795, 90.011], ['A', ' CZ ', 133.355, 139.828, 88.926], ['A', ' NH1', 132.041, 139.74, 89.0], ['A', ' NH2', 133.967, 139.95, 87.774], ['A', ' H ', 134.324, 136.299, 94.409], ['A', ' HA ', 133.443, 135.595, 91.63], ['A', ' HB ', 135.335, 137.815, 92.484], ['A', ' HB ', 134.984, 137.334, 90.825], ['A', ' HG ', 132.621, 137.925, 91.135], ['A', ' HG ', 132.967, 138.416, 92.801], ['A', ' HD ', 132.828, 140.349, 91.513], ['A', ' HD ', 134.51, 140.086, 92.009], ['A', ' HE ', 135.118, 139.904, 89.826], ['A', ' HH1', 131.588, 139.644, 89.896], ['A', ' HH1', 131.485, 139.768, 88.157], ['A', ' HH2', 134.993, 140.025, 87.797], ['A', ' HH2', 133.453, 139.983, 86.909]] AA_SCO= 2.3089473684210526 CA_SCO= 1.682526315789474
[['A', ' N ', 135.607, 134.367, 91.189], ['A', ' CA ', 136.776, 133.526, 91.134], ['A', ' C ', 137.973, 134.419, 91.043], ['A', ' O ', 137.904, 135.441, 90.372], ['A', ' CB ', 136.666, 132.602, 89.973], ['A', ' CG ', 136.38, 133.371, 88.776], ['A', ' OD1', 135.272, 133.933, 88.674], ['A', ' ND2', 137.305, 133.457, 87.879], ['A', ' H ', 134.989, 134.439, 90.383], ['A', ' HA ', 136.864, 132.948, 92.057], ['A', ' HB ', 137.6, 132.063, 89.841], ['A', ' HB ', 135.883, 131.876, 90.149], ['A', ' HD2', 137.148, 133.987, 87.051], ['A', ' HD2', 138.195, 133.009, 88.029]] AA_SCO= 2.501578947368421 CA_SCO= 1.6892105263157897
[['A', ' N ', 139.054, 134.075, 91.721], ['A', ' CA ', 140.244, 134.901, 91.603], ['A', ' C ', 141.473, 134.104, 91.307], ['A', ' O ', 141.643, 133.021, 91.857], ['A', ' CB ', 140.487, 135.707, 92.896], ['A', ' CG1', 139.347, 136.681, 93.124], ['A', ' CG2', 140.624, 134.764, 94.115], ['A', ' H ', 139.049, 133.223, 92.264], ['A', ' HA ', 140.094, 135.604, 90.786], ['A', ' HB ', 141.398, 136.288, 92.78], ['A', ' HG1', 139.543, 137.267, 94.019], ['A', ' HG1', 139.273, 137.343, 92.272], ['A', ' HG1', 138.409, 136.148, 93.247], ['A', ' HG2', 140.786, 135.365, 95.001], ['A', ' HG2', 139.709, 134.191, 94.24], ['A', ' HG2', 141.462, 134.081, 93.994]] AA_SCO= 2.594736842105263 CA_SCO= 1.6895263157894735
[['A', ' N ', 142.387, 134.684, 90.548], ['A', ' CA ', 143.648, 133.985, 90.347], ['A', ' C ', 144.475, 134.047, 91.591], ['A', ' O ', 144.518, 135.089, 92.253], ['A', ' CB ', 144.523, 134.597, 89.271], ['A', ' CG ', 144.068, 134.484, 87.892], ['A', ' CD ', 145.082, 135.078, 86.968], ['A', ' OE1', 145.947, 135.763, 87.464], ['A', ' OE2', 145.033, 134.833, 85.79], ['A', ' H ', 142.158, 135.58, 90.098], ['A', ' HA ', 143.437, 132.944, 90.108], ['A', ' HB ', 144.639, 135.659, 89.486], ['A', ' HB ', 145.517, 134.147, 89.331], ['A', ' HG ', 143.899, 133.444, 87.643], ['A', ' HG ', 143.13, 135.014, 87.814]] AA_SCO= 2.588947368421053 CA_SCO= 1.7093157894736841
[['A', ' N ', 145.165, 132.969, 91.866], ['A', ' CA ', 146.109, 132.925, 92.959], ['A', ' C ', 147.369, 132.325, 92.339], ['A', ' O ', 147.263, 131.535, 91.406], ['A', ' CB ', 145.548, 132.082, 94.101], ['A', ' CG1', 145.487, 130.669, 93.716], ['A', ' CG2', 146.321, 132.283, 95.296], ['A', ' H ', 145.019, 132.148, 91.27], ['A', ' HA ', 146.32, 133.934, 93.32], ['A', ' HB ', 144.519, 132.39, 94.295], ['A', ' HG1', 145.074, 130.16, 94.54], ['A', ' HG1', 144.858, 130.548, 92.845], ['A', ' HG1', 146.471, 130.264, 93.503], ['A', ' HG2', 145.895, 131.684, 96.105], ['A', ' HG2', 147.302, 132.0, 95.109], ['A', ' HG2', 146.295, 133.315, 95.568]] AA_SCO= 2.6373684210526314 CA_SCO= 1.7091052631578947
[['A', ' N ', 148.559, 132.665, 92.797], ['A', ' CA ', 149.707, 132.067, 92.143], ['A', ' C ', 150.839, 133.054, 92.118], ['A', ' O ', 150.829, 133.985, 92.906], ['A', ' H ', 148.677, 133.313, 93.569], ['A', ' HA ', 150.004, 131.158, 92.65], ['A', ' HA ', 149.417, 131.798, 91.134]] AA_SCO= 2.5421052631578944 CA_SCO= 1.696052631578947
[['A', ' N ', 151.926, 132.759, 91.393], ['A', ' CA ', 153.107, 133.584, 91.23], ['A', ' C ', 152.933, 134.862, 90.414], ['A', ' O ', 153.746, 135.755, 90.555], ['A', ' CB ', 154.072, 132.632, 90.557], ['A', ' CG ', 153.209, 131.632, 89.897], ['A', ' CD ', 152.018, 131.469, 90.747], ['A', ' HA ', 153.488, 133.847, 92.229], ['A', ' HB ', 154.699, 133.19, 89.843], ['A', ' HB ', 154.76, 132.199, 91.307], ['A', ' HG ', 152.993, 131.897, 88.851], ['A', ' HG ', 153.748, 130.715, 89.893], ['A', ' HD ', 151.178, 131.258, 90.084], ['A', ' HD ', 152.182, 130.663, 91.491]] AA_SCO= 2.5515789473684207 CA_SCO= 1.6889473684210525
[['A', ' N ', 151.908, 134.984, 89.531], ['A', ' CA ', 151.79, 136.306, 88.891], ['A', ' C ', 150.895, 137.103, 89.801], ['A', ' O ', 150.883, 138.326, 89.811], ['A', ' CB ', 151.239, 136.33, 87.483], ['A', ' CG ', 149.779, 135.995, 87.309], ['A', ' CD ', 149.312, 136.364, 85.951], ['A', ' NE ', 149.358, 137.796, 85.758], ['A', ' CZ ', 148.444, 138.676, 86.201], ['A', ' NH1', 147.368, 138.299, 86.869], ['A', ' NH2', 148.636, 139.947, 85.952], ['A', ' H ', 151.267, 134.236, 89.325], ['A', ' HA ', 152.759, 136.793, 88.865], ['A', ' HB ', 151.403, 137.321, 87.075], ['A', ' HB ', 151.809, 135.645, 86.879], ['A', ' HG ', 149.627, 134.926, 87.434], ['A', ' HG ', 149.164, 136.531, 88.02], ['A', ' HD ', 149.985, 135.934, 85.227], ['A', ' HD ', 148.294, 136.005, 85.772], ['A', ' HE ', 150.149, 138.176, 85.24], ['A', ' HH1', 147.166, 137.304, 87.06], ['A', ' HH1', 146.712, 138.992, 87.19], ['A', ' HH2', 149.459, 140.239, 85.406], ['A', ' HH2', 147.975, 140.635, 86.267]] AA_SCO= 2.5984210526315787 CA_SCO= 1.688578947368421
[['A', ' N ', 150.101, 136.383, 90.556], ['A', ' CA ', 149.32, 136.976, 91.588], ['A', ' C ', 150.408, 137.142, 92.584], ['A', ' O ', 151.48, 136.618, 92.34], ['A', ' CB ', 148.189, 136.111, 92.06], ['A', ' H ', 150.078, 135.386, 90.436], ['A', ' HA ', 148.944, 137.949, 91.277], ['A', ' HB ', 147.69, 136.575, 92.911], ['A', ' HB ', 147.472, 135.958, 91.254], ['A', ' HB ', 148.59, 135.184, 92.36]] AA_SCO= 2.59578947368421 CA_SCO= 1.5592105263157894
[['A', ' N ', 150.282, 137.958, 93.594], ['A', ' CA ', 151.415, 138.012, 94.516], ['A', ' C ', 152.699, 138.414, 93.77], ['A', ' O ', 153.795, 137.951, 94.077], ['A', ' CB ', 151.617, 136.633, 95.122], ['A', ' CG ', 152.474, 136.535, 96.285], ['A', ' CD ', 152.534, 135.156, 96.702], ['A', ' NE ', 153.234, 134.364, 95.74], ['A', ' CZ ', 153.185, 133.03, 95.62], ['A', ' NH1', 152.447, 132.286, 96.415], ['A', ' NH2', 153.903, 132.477, 94.692], ['A', ' H ', 149.41, 138.435, 93.783], ['A', ' HA ', 151.21, 138.74, 95.301], ['A', ' HB ', 150.668, 136.173, 95.35], ['A', ' HB ', 152.102, 135.983, 94.417], ['A', ' HG ', 153.48, 136.851, 96.107], ['A', ' HG ', 152.043, 137.131, 97.053], ['A', ' HD ', 153.037, 135.07, 97.661], ['A', ' HD ', 151.523, 134.795, 96.762], ['A', ' HE ', 153.815, 134.874, 95.08], ['A', ' HH1', 151.885, 132.721, 97.163], ['A', ' HH1', 152.47, 131.259, 96.306], ['A', ' HH2', 154.512, 133.068, 94.122], ['A', ' HH2', 153.922, 131.479, 94.562]] AA_SCO= 2.5173684210526313 CA_SCO= 1.5666842105263157
[['A', ' N ', 152.544, 139.288, 92.793], ['A', ' CA ', 153.644, 139.822, 92.008], ['A', ' C ', 153.155, 141.166, 91.548], ['A', ' O ', 153.913, 142.03, 91.142], ['A', ' CB ', 153.987, 138.903, 90.857], ['A', ' CG ', 155.254, 139.213, 90.109], ['A', ' SD ', 156.716, 139.005, 91.097], ['A', ' CE ', 156.913, 137.237, 91.155], ['A', ' H ', 151.61, 139.578, 92.577], ['A', ' HA ', 154.516, 139.967, 92.644], ['A', ' HB ', 154.043, 137.918, 91.239], ['A', ' HB ', 153.192, 138.932, 90.133], ['A', ' HG ', 155.327, 138.576, 89.232], ['A', ' HG ', 155.236, 140.218, 89.786], ['A', ' HE ', 157.797, 136.992, 91.738], ['A', ' HE ', 156.036, 136.773, 91.616], ['A', ' HE ', 157.031, 136.852, 90.148]] AA_SCO= 2.506842105263157 CA_SCO= 1.5632105263157894
[['A', ' N ', 151.835, 141.309, 91.637], ['A', ' CA ', 151.074, 142.493, 91.277], ['A', ' C ', 150.614, 143.138, 92.576], ['A', ' O ', 149.813, 144.069, 92.587], ['A', ' CB ', 149.851, 142.129, 90.407], ['A', ' CG1', 150.292, 141.508, 89.115], ['A', ' CG2', 148.961, 141.144, 91.159], ['A', ' H ', 151.326, 140.517, 91.971], ['A', ' HA ', 151.719, 143.188, 90.735], ['A', ' HB ', 149.292, 143.033, 90.173], ['A', ' HG1', 149.427, 141.258, 88.512], ['A', ' HG1', 150.899, 142.214, 88.581], ['A', ' HG1', 150.863, 140.622, 89.307], ['A', ' HG2', 148.099, 140.895, 90.543], ['A', ' HG2', 149.508, 140.242, 91.377], ['A', ' HG2', 148.615, 141.591, 92.078]] AA_SCO= 2.5278947368421045 CA_SCO= 1.5636842105263158
[['A', ' N ', 151.103, 142.543, 93.654], ['A', ' CA ', 150.927, 142.885, 95.044], ['A', ' C ', 152.314, 142.691, 95.59], ['A', ' O ', 153.019, 141.801, 95.117], ['A', ' CB ', 149.971, 141.946, 95.783], ['A', ' CG ', 148.523, 141.946, 95.353], ['A', ' CD ', 147.779, 143.194, 95.744], ['A', ' OE1', 148.329, 144.005, 96.46], ['A', ' OE2', 146.642, 143.33, 95.349], ['A', ' H ', 151.758, 141.804, 93.473], ['A', ' HA ', 150.623, 143.926, 95.157], ['A', ' HB ', 150.333, 140.929, 95.688], ['A', ' HB ', 149.99, 142.189, 96.847], ['A', ' HG ', 148.477, 141.841, 94.285], ['A', ' HG ', 148.025, 141.081, 95.791]] AA_SCO= 2.5363157894736843 CA_SCO= 1.568315789473684
[['A', ' N ', 152.716, 143.479, 96.572], ['A', ' CA ', 154.031, 143.383, 97.231], ['A', ' C ', 155.129, 143.899, 96.284], ['A', ' O ', 155.791, 144.897, 96.57], ['A', ' CB ', 154.313, 141.945, 97.667], ['A', ' CG ', 153.206, 141.444, 98.467], ['A', ' CD1', 152.45, 140.419, 97.987], ['A', ' CD2', 152.847, 142.038, 99.643], ['A', ' CE1', 151.366, 140.004, 98.657], ['A', ' CE2', 151.748, 141.611, 100.315], ['A', ' CZ ', 151.007, 140.599, 99.808], ['A', ' H ', 152.06, 144.172, 96.902], ['A', ' HA ', 154.025, 144.024, 98.112], ['A', ' HB ', 154.474, 141.292, 96.838], ['A', ' HB ', 155.214, 141.918, 98.271], ['A', ' HD1', 152.729, 139.949, 97.037], ['A', ' HD2', 153.433, 142.868, 100.035], ['A', ' HE1', 150.784, 139.214, 98.279], ['A', ' HE2', 151.45, 142.088, 101.252], ['A', ' HZ ', 150.123, 140.268, 100.334]] AA_SCO= 2.447368421052632 CA_SCO= 1.569157894736842
[['A', ' N ', 155.287, 143.233, 95.149], ['A', ' CA ', 156.14, 143.668, 94.054], ['A', ' C ', 155.23, 144.26, 92.994], ['A', ' O ', 154.032, 143.999, 92.998], ['A', ' CB ', 156.978, 142.525, 93.478], ['A', ' CG ', 158.008, 141.964, 94.447], ['A', ' CD ', 158.882, 140.879, 93.826], ['A', ' OE1', 158.938, 140.755, 92.603], ['A', ' NE2', 159.579, 140.122, 94.66], ['A', ' H ', 154.706, 142.408, 95.028], ['A', ' HA ', 156.809, 144.451, 94.405], ['A', ' HB ', 156.314, 141.708, 93.188], ['A', ' HB ', 157.488, 142.862, 92.576], ['A', ' HG ', 158.653, 142.773, 94.778], ['A', ' HG ', 157.485, 141.542, 95.298], ['A', ' HE2', 160.194, 139.384, 94.309], ['A', ' HE2', 159.524, 140.287, 95.643]] AA_SCO= 2.4794736842105265 CA_SCO= 1.5716842105263158
[['A', ' N ', 155.747, 145.113, 92.122], ['A', ' CA ', 154.884, 145.582, 91.046], ['A', ' C ', 155.047, 144.686, 89.829], ['A', ' O ', 156.148, 144.204, 89.554], ['A', ' H ', 156.721, 145.37, 92.158], ['A', ' HA ', 153.844, 145.573, 91.371], ['A', ' HA ', 155.138, 146.609, 90.789]] AA_SCO= 2.4742105263157894 CA_SCO= 1.5817894736842104
[['A', ' N ', 153.971, 144.516, 89.079], ['A', ' CA ', 153.959, 143.724, 87.859], ['A', ' C ', 152.713, 144.155, 87.118], ['A', ' O ', 151.696, 144.434, 87.752], ['A', ' CB ', 154.007, 142.249, 88.227], ['A', ' CG ', 154.229, 141.232, 87.195], ['A', ' CD1', 155.49, 141.01, 86.697], ['A', ' CD2', 153.212, 140.439, 86.772], ['A', ' CE1', 155.715, 140.018, 85.778], ['A', ' CE2', 153.431, 139.453, 85.869], ['A', ' CZ ', 154.686, 139.235, 85.364], ['A', ' H ', 153.108, 144.947, 89.379], ['A', ' HA ', 154.832, 143.967, 87.251], ['A', ' HB ', 154.817, 142.152, 88.92], ['A', ' HB ', 153.123, 141.987, 88.759], ['A', ' HD1', 156.318, 141.634, 87.046], ['A', ' HD2', 152.211, 140.593, 87.169], ['A', ' HE1', 156.715, 139.853, 85.383], ['A', ' HE2', 152.604, 138.838, 85.552], ['A', ' HZ ', 154.855, 138.438, 84.635]] AA_SCO= 2.332105263157895 CA_SCO= 1.7818421052631577
[['A', ' N ', 152.807, 144.354, 85.816], ['A', ' CA ', 151.645, 144.801, 85.059], ['A', ' C ', 151.191, 143.783, 84.04], ['A', ' O ', 150.047, 143.802, 83.585], ['A', ' CB ', 151.943, 146.132, 84.386], ['A', ' CG ', 152.18, 147.261, 85.371], ['A', ' CD ', 152.443, 148.577, 84.661], ['A', ' CE ', 152.676, 149.705, 85.659], ['A', ' NZ ', 152.973, 151.0, 84.981], ['A', ' H ', 153.674, 144.118, 85.319], ['A', ' HA ', 150.818, 144.951, 85.751], ['A', ' HB ', 152.831, 146.027, 83.759], ['A', ' HB ', 151.112, 146.407, 83.74], ['A', ' HG ', 151.306, 147.364, 86.015], ['A', ' HG ', 153.037, 147.017, 85.995], ['A', ' HD ', 153.322, 148.479, 84.022], ['A', ' HD ', 151.586, 148.827, 84.036], ['A', ' HE ', 151.785, 149.825, 86.274], ['A', ' HE ', 153.516, 149.442, 86.302], ['A', ' HZ ', 153.121, 151.718, 85.677], ['A', ' HZ ', 153.806, 150.905, 84.416], ['A', ' HZ ', 152.196, 151.26, 84.391]] AA_SCO= 2.311578947368421 CA_SCO= 1.7817894736842106
[['A', ' N ', 152.104, 142.923, 83.653], ['A', ' CA ', 151.886, 141.952, 82.617], ['A', ' C ', 150.768, 140.993, 82.997], ['A', ' O ', 150.664, 140.575, 84.154], ['A', ' CB ', 153.197, 141.209, 82.374], ['A', ' CG ', 154.359, 142.083, 81.852], ['A', ' CD ', 155.204, 142.822, 82.943], ['A', ' OE1', 154.681, 143.166, 84.002], ['A', ' OE2', 156.367, 143.03, 82.696], ['A', ' H ', 153.03, 142.966, 84.066], ['A', ' HA ', 151.596, 142.475, 81.706], ['A', ' HB ', 153.519, 140.737, 83.284], ['A', ' HB ', 153.039, 140.431, 81.638], ['A', ' HG ', 155.029, 141.449, 81.271], ['A', ' HG ', 153.942, 142.827, 81.174]] AA_SCO= 2.311578947368421 CA_SCO= 1.784
[['A', ' N ', 149.947, 140.644, 82.004], ['A', ' CA ', 148.825, 139.722, 82.145], ['A', ' C ', 148.911, 138.653, 81.07], ['A', ' O ', 149.488, 138.893, 80.011], ['A', ' CB ', 147.503, 140.451, 81.969], ['A', ' CG ', 147.24, 141.583, 82.941], ['A', ' CD ', 145.922, 142.222, 82.712], ['A', ' NE ', 144.842, 141.316, 83.046], ['A', ' CZ ', 143.525, 141.543, 82.854], ['A', ' NH1', 143.106, 142.676, 82.324], ['A', ' NH2', 142.661, 140.609, 83.204], ['A', ' H ', 150.116, 141.048, 81.094], ['A', ' HA ', 148.865, 139.25, 83.123], ['A', ' HB ', 147.449, 140.862, 80.963], ['A', ' HB ', 146.691, 139.734, 82.069], ['A', ' HG ', 147.254, 141.203, 83.951], ['A', ' HG ', 148.01, 142.346, 82.832], ['A', ' HD ', 145.837, 143.112, 83.335], ['A', ' HD ', 145.833, 142.495, 81.66], ['A', ' HE ', 145.102, 140.446, 83.483], ['A', ' HH1', 143.767, 143.39, 82.057], ['A', ' HH1', 142.117, 142.832, 82.188], ['A', ' HH2', 143.005, 139.726, 83.586], ['A', ' HH2', 141.666, 140.749, 83.089]] AA_SCO= 2.311578947368421 CA_SCO= 1.783842105263158
[['A', ' N ', 148.322, 137.484, 81.313], ['A', ' CA ', 148.298, 136.428, 80.297], ['A', ' C ', 149.246, 135.293, 80.605], ['A', ' O ', 149.942, 135.31, 81.623], ['A', ' H ', 147.848, 137.317, 82.188], ['A', ' HA ', 147.288, 136.032, 80.217], ['A', ' HA ', 148.54, 136.847, 79.321]] AA_SCO= 2.283157894736842 CA_SCO= 1.7842631578947366
[['A', ' N ', 149.281, 134.315, 79.713], ['A', ' CA ', 150.078, 133.113, 79.935], ['A', ' C ', 151.567, 133.38, 79.939], ['A', ' O ', 152.314, 132.717, 80.663], ['A', ' CB ', 149.776, 132.041, 78.879], ['A', ' CG1', 148.391, 131.67, 78.945], ['A', ' CG2', 150.063, 132.517, 77.486], ['A', ' H ', 148.669, 134.417, 78.898], ['A', ' HA ', 149.801, 132.704, 80.908], ['A', ' HB ', 150.368, 131.157, 79.095], ['A', ' HG1', 148.244, 130.907, 78.199], ['A', ' HG1', 148.157, 131.293, 79.941], ['A', ' HG1', 147.778, 132.511, 78.724], ['A', ' HG2', 149.815, 131.714, 76.821], ['A', ' HG2', 149.456, 133.385, 77.243], ['A', ' HG2', 151.1, 132.759, 77.359]] AA_SCO= 2.276842105263158 CA_SCO= 1.7842631578947366
[['A', ' N ', 152.011, 134.351, 79.155], ['A', ' CA ', 153.424, 134.635, 79.159], ['A', ' C ', 153.76, 135.324, 80.456], ['A', ' O ', 154.858, 135.185, 80.958], ['A', ' CB ', 153.866, 135.465, 77.941], ['A', ' CG1', 153.566, 134.685, 76.651], ['A', ' CG2', 153.169, 136.815, 77.926], ['A', ' H ', 151.362, 134.868, 78.577], ['A', ' HA ', 153.969, 133.691, 79.121], ['A', ' HB ', 154.949, 135.615, 77.988], ['A', ' HG1', 153.911, 135.264, 75.791], ['A', ' HG1', 154.085, 133.729, 76.672], ['A', ' HG1', 152.501, 134.512, 76.56], ['A', ' HG2', 153.508, 137.376, 77.056], ['A', ' HG2', 152.092, 136.681, 77.868], ['A', ' HG2', 153.413, 137.386, 78.814]] AA_SCO= 2.2905263157894735 CA_SCO= 1.7813684210526317
[['A', ' N ', 152.832, 136.097, 81.004], ['A', ' CA ', 153.11, 136.742, 82.264], ['A', ' C ', 153.237, 135.692, 83.357], ['A', ' O ', 154.166, 135.725, 84.161], ['A', ' CB ', 152.007, 137.715, 82.6], ['A', ' H ', 151.934, 136.203, 80.552], ['A', ' HA ', 154.055, 137.276, 82.175], ['A', ' HB ', 152.221, 138.211, 83.519], ['A', ' HB ', 151.928, 138.442, 81.807], ['A', ' HB ', 151.072, 137.19, 82.693]] AA_SCO= 2.3284210526315787 CA_SCO= 1.7808421052631582
[['A', ' N ', 152.37, 134.686, 83.316], ['A', ' CA ', 152.358, 133.644, 84.335], ['A', ' C ', 153.606, 132.799, 84.327], ['A', ' O ', 154.171, 132.475, 85.381], ['A', ' CB ', 151.189, 132.703, 84.103], ['A', ' CG ', 149.849, 133.265, 84.352], ['A', ' CD ', 148.815, 132.326, 83.926], ['A', ' OE1', 149.014, 131.126, 84.049], ['A', ' NE2', 147.723, 132.832, 83.413], ['A', ' H ', 151.635, 134.709, 82.605], ['A', ' HA ', 152.27, 134.11, 85.308], ['A', ' HB ', 151.209, 132.379, 83.068], ['A', ' HB ', 151.309, 131.81, 84.721], ['A', ' HG ', 149.73, 133.441, 85.415], ['A', ' HG ', 149.731, 134.177, 83.791], ['A', ' HE2', 146.992, 132.22, 83.099], ['A', ' HE2', 147.598, 133.825, 83.356]] AA_SCO= 2.3626315789473686 CA_SCO= 1.794105263157895
[['A', ' N ', 154.122, 132.516, 83.145], ['A', ' CA ', 155.239, 131.604, 83.082], ['A', ' C ', 156.572, 132.355, 83.076], ['A', ' O ', 157.639, 131.766, 82.918], ['A', ' CB ', 155.003, 130.645, 81.896], ['A', ' CG ', 156.004, 129.555, 81.732], ['A', ' ND1', 156.29, 128.624, 82.698], ['A', ' CD2', 156.71, 129.208, 80.677], ['A', ' CE1', 157.204, 127.795, 82.242], ['A', ' NE2', 157.498, 128.136, 81.023], ['A', ' H ', 153.636, 132.806, 82.287], ['A', ' HA ', 155.237, 130.982, 83.973], ['A', ' HB ', 154.021, 130.183, 82.007], ['A', ' HB ', 154.982, 131.227, 80.972], ['A', ' HD1', 155.866, 128.482, 83.602], ['A', ' HD2', 156.744, 129.624, 79.708], ['A', ' HE1', 157.583, 126.99, 82.868]] AA_SCO= 2.3710526315789475 CA_SCO= 1.8007894736842112
[['A', ' N ', 156.494, 133.652, 83.364], ['A', ' CA ', 157.617, 134.545, 83.571], ['A', ' C ', 157.676, 134.918, 85.03], ['A', ' O ', 158.741, 134.867, 85.644], ['A', ' CB ', 157.535, 135.783, 82.683], ['A', ' CG1', 158.59, 136.817, 83.079], ['A', ' CG2', 157.832, 135.33, 81.242], ['A', ' H ', 155.568, 134.067, 83.478], ['A', ' HA ', 158.536, 134.017, 83.313], ['A', ' HB ', 156.54, 136.227, 82.759], ['A', ' HG1', 158.521, 137.672, 82.409], ['A', ' HG1', 158.425, 137.155, 84.1], ['A', ' HG1', 159.561, 136.393, 83.007], ['A', ' HG2', 157.776, 136.184, 80.566], ['A', ' HG2', 158.83, 134.896, 81.195], ['A', ' HG2', 157.118, 134.581, 80.932]] AA_SCO= 2.3536842105263163 CA_SCO= 1.8010526315789481
[['A', ' N ', 156.522, 135.22, 85.621], ['A', ' CA ', 156.463, 135.608, 87.01], ['A', ' C ', 157.066, 134.527, 87.874], ['A', ' O ', 157.713, 134.829, 88.869], ['A', ' CB ', 155.043, 135.863, 87.42], ['A', ' H ', 155.664, 135.259, 85.075], ['A', ' HA ', 157.038, 136.513, 87.139], ['A', ' HB ', 155.025, 136.165, 88.459], ['A', ' HB ', 154.621, 136.65, 86.802], ['A', ' HB ', 154.46, 134.949, 87.29]] AA_SCO= 2.364736842105263 CA_SCO= 1.9312631578947375
[['A', ' N ', 156.894, 133.27, 87.497], ['A', ' CA ', 157.47, 132.188, 88.274], ['A', ' C ', 158.983, 132.266, 88.334], ['A', ' O ', 159.594, 131.975, 89.362], ['A', ' CB ', 157.119, 130.897, 87.621], ['A', ' CG ', 155.734, 130.598, 87.741], ['A', ' CD ', 155.395, 129.436, 87.048], ['A', ' NE ', 153.991, 129.271, 86.992], ['A', ' CZ ', 153.23, 128.727, 87.924], ['A', ' NH1', 153.745, 128.228, 89.037], ['A', ' NH2', 151.947, 128.701, 87.684], ['A', ' H ', 156.302, 133.065, 86.683], ['A', ' HA ', 157.065, 132.225, 89.287], ['A', ' HB ', 157.37, 130.938, 86.559], ['A', ' HB ', 157.694, 130.082, 88.066], ['A', ' HG ', 155.57, 130.412, 88.779], ['A', ' HG ', 155.115, 131.42, 87.407], ['A', ' HD ', 155.765, 129.526, 86.029], ['A', ' HD ', 155.837, 128.578, 87.543], ['A', ' HE ', 153.515, 129.612, 86.158], ['A', ' HH1', 154.747, 128.239, 89.187], ['A', ' HH1', 153.146, 127.796, 89.724], ['A', ' HH2', 151.607, 129.04, 86.766], ['A', ' HH2', 151.271, 128.282, 88.336]] AA_SCO= 2.3615789473684217 CA_SCO= 1.9314736842105262
[['A', ' N ', 159.597, 132.642, 87.226], ['A', ' CA ', 161.032, 132.707, 87.141], ['A', ' C ', 161.533, 133.869, 87.996], ['A', ' O ', 162.562, 133.79, 88.682], ['A', ' CB ', 161.396, 132.828, 85.686], ['A', ' H ', 159.058, 132.947, 86.421], ['A', ' HA ', 161.449, 131.783, 87.541], ['A', ' HB ', 162.42, 132.846, 85.557], ['A', ' HB ', 160.993, 131.968, 85.152], ['A', ' HB ', 160.96, 133.733, 85.283]] AA_SCO= 2.379473684210527 CA_SCO= 1.9316842105263161
[['A', ' N ', 160.76, 134.946, 87.995], ['A', ' CA ', 161.127, 136.111, 88.772], ['A', ' C ', 161.01, 135.757, 90.25], ['A', ' O ', 161.812, 136.197, 91.092], ['A', ' CB ', 160.182, 137.26, 88.446], ['A', ' CG ', 160.227, 137.794, 87.001], ['A', ' CD1', 159.125, 138.817, 86.837], ['A', ' CD2', 161.576, 138.389, 86.676], ['A', ' H ', 159.939, 134.955, 87.38], ['A', ' HA ', 162.159, 136.372, 88.565], ['A', ' HB ', 159.168, 136.927, 88.639], ['A', ' HB ', 160.396, 138.089, 89.121], ['A', ' HG ', 160.029, 136.976, 86.31], ['A', ' HD1', 159.124, 139.184, 85.812], ['A', ' HD1', 158.169, 138.376, 87.056], ['A', ' HD1', 159.294, 139.647, 87.52], ['A', ' HD2', 161.564, 138.755, 85.648], ['A', ' HD2', 161.783, 139.217, 87.354], ['A', ' HD2', 162.352, 137.64, 86.769]] AA_SCO= 2.356842105263158 CA_SCO= 1.937684210526316
[['A', ' N ', 159.995, 134.961, 90.567], ['A', ' CA ', 159.787, 134.516, 91.918], ['A', ' C ', 160.936, 133.649, 92.39], ['A', ' O ', 161.385, 133.796, 93.521], ['A', ' CB ', 158.482, 133.785, 92.082], ['A', ' CG ', 158.252, 133.372, 93.479], ['A', ' CD ', 156.935, 132.888, 93.693], ['A', ' OE1', 156.02, 133.629, 93.481], ['A', ' OE2', 156.781, 131.737, 94.002], ['A', ' H ', 159.326, 134.697, 89.838], ['A', ' HA ', 159.744, 135.397, 92.556], ['A', ' HB ', 157.657, 134.412, 91.753], ['A', ' HB ', 158.481, 132.893, 91.463], ['A', ' HG ', 158.954, 132.578, 93.743], ['A', ' HG ', 158.439, 134.218, 94.142]] AA_SCO= 2.3526315789473684 CA_SCO= 1.9440000000000004
[['A', ' N ', 161.48, 132.786, 91.533], ['A', ' CA ', 162.591, 131.957, 91.985], ['A', ' C ', 163.705, 132.832, 92.505], ['A', ' O ', 164.272, 132.545, 93.563], ['A', ' CB ', 163.163, 131.138, 90.849], ['A', ' CG ', 162.271, 130.126, 90.383], ['A', ' SD ', 162.814, 129.267, 88.927], ['A', ' CE ', 163.985, 128.176, 89.591], ['A', ' H ', 161.042, 132.653, 90.615], ['A', ' HA ', 162.247, 131.308, 92.789], ['A', ' HB ', 163.393, 131.79, 90.013], ['A', ' HB ', 164.089, 130.674, 91.171], ['A', ' HG ', 162.173, 129.414, 91.183], ['A', ' HG ', 161.307, 130.548, 90.191], ['A', ' HE ', 164.363, 127.563, 88.791], ['A', ' HE ', 164.796, 128.726, 90.052], ['A', ' HE ', 163.511, 127.536, 90.329]] AA_SCO= 2.443157894736842 CA_SCO= 1.9149999999999996
[['A', ' N ', 164.008, 133.92, 91.792], ['A', ' CA ', 165.064, 134.802, 92.271], ['A', ' C ', 164.698, 135.388, 93.638], ['A', ' O ', 165.54, 135.444, 94.542], ['A', ' CB ', 165.334, 135.925, 91.27], ['A', ' CG ', 166.003, 135.45, 89.994], ['A', ' CD ', 166.522, 136.614, 89.089], ['A', ' CE ', 165.391, 137.363, 88.377], ['A', ' NZ ', 165.904, 138.347, 87.329], ['A', ' H ', 163.524, 134.073, 90.896], ['A', ' HA ', 165.975, 134.216, 92.392], ['A', ' HB ', 164.391, 136.398, 91.002], ['A', ' HB ', 165.968, 136.681, 91.73], ['A', ' HG ', 166.841, 134.796, 90.245], ['A', ' HG ', 165.27, 134.862, 89.447], ['A', ' HD ', 167.082, 137.321, 89.703], ['A', ' HD ', 167.204, 136.212, 88.34], ['A', ' HE ', 164.722, 136.647, 87.896], ['A', ' HE ', 164.828, 137.92, 89.123], ['A', ' HZ ', 165.118, 138.824, 86.916], ['A', ' HZ ', 166.506, 139.023, 87.77], ['A', ' HZ ', 166.429, 137.89, 86.548]] AA_SCO= 2.43 CA_SCO= 1.844052631578947
[['A', ' N ', 163.435, 135.782, 93.81], ['A', ' CA ', 162.997, 136.348, 95.086], ['A', ' C ', 163.101, 135.353, 96.234], ['A', ' O ', 163.592, 135.681, 97.326], ['A', ' CB ', 161.532, 136.83, 95.001], ['A', ' OG1', 161.417, 137.89, 94.034], ['A', ' CG2', 161.039, 137.326, 96.349], ['A', ' H ', 162.8, 135.747, 93.005], ['A', ' HA ', 163.633, 137.202, 95.316], ['A', ' HB ', 160.902, 136.003, 94.688], ['A', ' HG1', 161.629, 137.547, 93.149], ['A', ' HG2', 160.012, 137.647, 96.247], ['A', ' HG2', 161.087, 136.538, 97.095], ['A', ' HG2', 161.652, 138.165, 96.675]] AA_SCO= 2.401578947368421 CA_SCO= 1.8431052631578946
[['A', ' N ', 162.632, 134.14, 95.997], ['A', ' CA ', 162.633, 133.12, 97.018], ['A', ' C ', 164.039, 132.769, 97.433], ['A', ' O ', 164.322, 132.626, 98.623], ['A', ' CB ', 161.926, 131.888, 96.503], ['A', ' H ', 162.243, 133.946, 95.076], ['A', ' HA ', 162.107, 133.506, 97.889], ['A', ' HB ', 161.91, 131.129, 97.271], ['A', ' HB ', 160.904, 132.142, 96.219], ['A', ' HB ', 162.455, 131.512, 95.629]] AA_SCO= 2.5142105263157895 CA_SCO= 1.7890526315789477
[['A', ' N ', 164.95, 132.706, 96.479], ['A', ' CA ', 166.297, 132.352, 96.833], ['A', ' C ', 166.949, 133.425, 97.668], ['A', ' O ', 167.638, 133.104, 98.642], ['A', ' CB ', 167.102, 132.035, 95.592], ['A', ' CG ', 168.549, 131.635, 95.809], ['A', ' CD1', 168.674, 130.483, 96.738], ['A', ' CD2', 169.076, 131.196, 94.526], ['A', ' H ', 164.677, 132.814, 95.498], ['A', ' HA ', 166.232, 131.447, 97.429], ['A', ' HB ', 166.602, 131.248, 95.045], ['A', ' HB ', 167.097, 132.929, 94.959], ['A', ' HG ', 169.123, 132.481, 96.193], ['A', ' HD1', 169.73, 130.225, 96.811], ['A', ' HD1', 168.308, 130.734, 97.727], ['A', ' HD1', 168.117, 129.633, 96.348], ['A', ' HD2', 170.11, 130.889, 94.657], ['A', ' HD2', 168.492, 130.356, 94.194], ['A', ' HD2', 169.003, 132.007, 93.805]] AA_SCO= 2.4826315789473683 CA_SCO= 1.738
[['A', ' N ', 166.725, 134.695, 97.342], ['A', ' CA ', 167.333, 135.728, 98.15], ['A', ' C ', 166.838, 135.646, 99.583], ['A', ' O ', 167.633, 135.796, 100.517], ['A', ' CB ', 167.03, 137.096, 97.584], ['A', ' OG ', 167.676, 137.295, 96.357], ['A', ' H ', 166.189, 134.944, 96.502], ['A', ' HA ', 168.412, 135.577, 98.147], ['A', ' HB ', 165.951, 137.188, 97.444], ['A', ' HB ', 167.336, 137.863, 98.294], ['A', ' HG ', 167.357, 138.14, 96.028]] AA_SCO= 2.471578947368421 CA_SCO= 1.736631578947368
[['A', ' N ', 165.554, 135.338, 99.787], ['A', ' CA ', 165.089, 135.262, 101.163], ['A', ' C ', 165.703, 134.07, 101.888], ['A', ' O ', 165.995, 134.161, 103.084], ['A', ' CB ', 163.576, 135.182, 101.259], ['A', ' CG ', 163.021, 135.14, 102.716], ['A', ' CD ', 163.395, 136.369, 103.497], ['A', ' NE ', 162.815, 136.386, 104.819], ['A', ' CZ ', 163.216, 137.196, 105.828], ['A', ' NH1', 164.207, 138.063, 105.664], ['A', ' NH2', 162.611, 137.123, 107.006], ['A', ' H ', 164.911, 135.255, 98.988], ['A', ' HA ', 165.412, 136.175, 101.658], ['A', ' HB ', 163.134, 136.037, 100.751], ['A', ' HB ', 163.231, 134.282, 100.739], ['A', ' HG ', 161.932, 135.085, 102.688], ['A', ' HG ', 163.404, 134.269, 103.25], ['A', ' HD ', 164.469, 136.393, 103.627], ['A', ' HD ', 163.074, 137.262, 102.963], ['A', ' HE ', 162.029, 135.74, 105.013], ['A', ' HH1', 164.705, 138.148, 104.763], ['A', ' HH1', 164.492, 138.654, 106.429], ['A', ' HH2', 161.851, 136.433, 107.157], ['A', ' HH2', 162.901, 137.715, 107.765]] AA_SCO= 2.441578947368421 CA_SCO= 1.7363157894736843
[['A', ' N ', 165.865, 132.938, 101.202], ['A', ' CA ', 166.461, 131.777, 101.849], ['A', ' C ', 167.877, 132.103, 102.333], ['A', ' O ', 168.281, 131.728, 103.441], ['A', ' CB ', 166.504, 130.611, 100.871], ['A', ' H ', 165.532, 132.886, 100.231], ['A', ' HA ', 165.856, 131.518, 102.713], ['A', ' HB ', 166.937, 129.743, 101.341], ['A', ' HB ', 165.513, 130.372, 100.529], ['A', ' HB ', 167.11, 130.897, 100.014]] AA_SCO= 2.4110526315789476 CA_SCO= 1.734842105263158
[['A', ' N ', 168.604, 132.876, 101.535], ['A', ' CA ', 169.956, 133.25, 101.896], ['A', ' C ', 169.929, 134.14, 103.127], ['A', ' O ', 170.723, 133.924, 104.046], ['A', ' CB ', 170.675, 133.927, 100.72], ['A', ' CG1', 170.876, 132.865, 99.609], ['A', ' CG2', 172.041, 134.474, 101.191], ['A', ' CD1', 171.286, 133.391, 98.247], ['A', ' H ', 168.218, 133.133, 100.618], ['A', ' HA ', 170.508, 132.348, 102.145], ['A', ' HB ', 170.058, 134.734, 100.321], ['A', ' HG1', 171.642, 132.175, 99.943], ['A', ' HG1', 169.945, 132.316, 99.484], ['A', ' HG2', 172.565, 134.942, 100.367], ['A', ' HG2', 171.909, 135.22, 101.983], ['A', ' HG2', 172.638, 133.653, 101.572], ['A', ' HD1', 171.391, 132.555, 97.557], ['A', ' HD1', 170.513, 134.066, 97.877], ['A', ' HD1', 172.227, 133.919, 98.309]] AA_SCO= 2.378421052631579 CA_SCO= 1.6599473684210526
[['A', ' N ', 169.012, 135.107, 103.17], ['A', ' CA ', 168.914, 136.008, 104.313], ['A', ' C ', 168.621, 135.257, 105.611], ['A', ' O ', 169.155, 135.614, 106.666], ['A', ' CB ', 167.807, 137.032, 104.089], ['A', ' CG ', 168.1, 138.062, 103.024], ['A', ' CD ', 166.919, 138.951, 102.724], ['A', ' OE1', 165.851, 138.698, 103.251], ['A', ' OE2', 167.078, 139.88, 101.969], ['A', ' H ', 168.408, 135.254, 102.353], ['A', ' HA ', 169.866, 136.531, 104.416], ['A', ' HB ', 166.897, 136.513, 103.804], ['A', ' HB ', 167.603, 137.557, 105.021], ['A', ' HG ', 168.929, 138.681, 103.364], ['A', ' HG ', 168.417, 137.557, 102.119]] AA_SCO= 2.397894736842105 CA_SCO= 1.664
[['A', ' N ', 167.79, 134.218, 105.563], ['A', ' CA ', 167.529, 133.514, 106.807], ['A', ' C ', 168.789, 132.868, 107.304], ['A', ' O ', 169.067, 132.924, 108.495], ['A', ' CB ', 166.44, 132.44, 106.7], ['A', ' CG1', 165.088, 133.066, 106.345], ['A', ' CG2', 166.355, 131.622, 108.061], ['A', ' CD1', 164.523, 134.065, 107.34], ['A', ' H ', 167.312, 133.992, 104.68], ['A', ' HA ', 167.238, 134.24, 107.559], ['A', ' HB ', 166.687, 131.765, 105.883], ['A', ' HG1', 165.186, 133.571, 105.391], ['A', ' HG1', 164.367, 132.261, 106.233], ['A', ' HG2', 165.587, 130.86, 107.999], ['A', ' HG2', 167.3, 131.135, 108.269], ['A', ' HG2', 166.121, 132.287, 108.881], ['A', ' HD1', 163.579, 134.415, 106.964], ['A', ' HD1', 164.359, 133.597, 108.306], ['A', ' HD1', 165.179, 134.916, 107.458]] AA_SCO= 2.387894736842105 CA_SCO= 1.660736842105263
[['A', ' N ', 169.555, 132.25, 106.419], ['A', ' CA ', 170.79, 131.64, 106.873], ['A', ' C ', 171.826, 132.691, 107.291], ['A', ' O ', 172.63, 132.423, 108.173], ['A', ' CB ', 171.333, 130.701, 105.816], ['A', ' CG ', 170.522, 129.427, 105.554], ['A', ' CD1', 171.088, 128.749, 104.383], ['A', ' CD2', 170.585, 128.464, 106.739], ['A', ' H ', 169.253, 132.186, 105.439], ['A', ' HA ', 170.566, 131.064, 107.764], ['A', ' HB ', 171.356, 131.253, 104.876], ['A', ' HB ', 172.345, 130.411, 106.093], ['A', ' HG ', 169.508, 129.7, 105.347], ['A', ' HD1', 170.516, 127.854, 104.16], ['A', ' HD1', 171.06, 129.417, 103.549], ['A', ' HD1', 172.1, 128.487, 104.61], ['A', ' HD2', 170.021, 127.567, 106.505], ['A', ' HD2', 171.623, 128.194, 106.925], ['A', ' HD2', 170.167, 128.917, 107.618]] AA_SCO= 2.344210526315789 CA_SCO= 1.6422631578947369
[['A', ' N ', 171.787, 133.91, 106.717], ['A', ' CA ', 172.693, 134.971, 107.194], ['A', ' C ', 172.44, 135.24, 108.671], ['A', ' O ', 173.373, 135.545, 109.422], ['A', ' CB ', 172.476, 136.337, 106.502], ['A', ' CG ', 173.016, 136.545, 105.102], ['A', ' OD1', 173.912, 135.866, 104.716], ['A', ' OD2', 172.525, 137.418, 104.435], ['A', ' H ', 171.171, 134.065, 105.914], ['A', ' HA ', 173.723, 134.644, 107.061], ['A', ' HB ', 171.415, 136.54, 106.475], ['A', ' HB ', 172.912, 137.106, 107.136]] AA_SCO= 2.3894736842105258 CA_SCO= 1.6423157894736842
[['A', ' N ', 171.178, 135.122, 109.091], ['A', ' CA ', 170.793, 135.33, 110.477], ['A', ' C ', 170.656, 133.964, 111.143], ['A', ' O ', 171.65, 133.257, 111.301], ['A', ' CB ', 169.473, 136.102, 110.557], ['A', ' CG ', 169.549, 137.534, 110.068], ['A', ' CD ', 168.217, 138.264, 110.15], ['A', ' OE1', 167.225, 137.636, 110.454], ['A', ' OE2', 168.199, 139.451, 109.914], ['A', ' H ', 170.448, 134.917, 108.398], ['A', ' HA ', 171.572, 135.894, 110.988], ['A', ' HB ', 168.722, 135.593, 109.944], ['A', ' HB ', 169.116, 136.129, 111.585], ['A', ' HG ', 170.288, 138.071, 110.66], ['A', ' HG ', 169.89, 137.527, 109.031]] AA_SCO= 2.351052631578947 CA_SCO= 1.5965263157894736
[['A', ' N ', 169.45, 133.587, 111.559], ['A', ' CA ', 169.248, 132.279, 112.166], ['A', ' C ', 170.287, 131.859, 113.191], ['A', ' O ', 171.266, 131.177, 112.872], ['A', ' CB ', 169.205, 131.199, 111.096], ['A', ' CG ', 169.026, 129.744, 111.585], ['A', ' CD1', 167.67, 129.577, 112.282], ['A', ' CD2', 169.195, 128.853, 110.407], ['A', ' H ', 168.658, 134.195, 111.416], ['A', ' HA ', 168.288, 132.312, 112.669], ['A', ' HB ', 168.377, 131.421, 110.436], ['A', ' HB ', 170.126, 131.25, 110.507], ['A', ' HG ', 169.786, 129.476, 112.309], ['A', ' HD1', 167.563, 128.545, 112.614], ['A', ' HD1', 167.612, 130.223, 113.153], ['A', ' HD1', 166.869, 129.828, 111.591], ['A', ' HD2', 169.095, 127.83, 110.74], ['A', ' HD2', 168.443, 129.081, 109.652], ['A', ' HD2', 170.187, 129.005, 109.989]] AA_SCO= 2.3021052631578947 CA_SCO= 1.560736842105263
[['A', ' N ', 170.128, 132.289, 114.427], ['A', ' CA ', 171.051, 131.797, 115.429], ['A', ' C ', 170.748, 130.306, 115.535], ['A', ' O ', 169.578, 129.926, 115.47], ['A', ' CB ', 170.894, 132.477, 116.777], ['A', ' CG ', 172.11, 132.208, 117.643], ['A', ' OD1', 172.325, 131.07, 118.025], ['A', ' OD2', 172.838, 133.141, 117.904], ['A', ' H ', 169.359, 132.892, 114.675], ['A', ' HA ', 172.077, 131.925, 115.08], ['A', ' HB ', 170.778, 133.552, 116.641], ['A', ' HB ', 170.004, 132.099, 117.286]] AA_SCO= 2.332105263157895 CA_SCO= 1.5239473684210525
[['A', ' N ', 171.773, 129.473, 115.686], ['A', ' CA ', 171.604, 128.024, 115.753], ['A', ' C ', 171.398, 127.494, 117.159], ['A', ' O ', 171.207, 126.29, 117.356], ['A', ' CB ', 172.824, 127.32, 115.159], ['A', ' OG1', 173.989, 127.677, 115.915], ['A', ' CG2', 173.007, 127.743, 113.737], ['A', ' H ', 172.71, 129.854, 115.762], ['A', ' HA ', 170.728, 127.756, 115.161], ['A', ' HB ', 172.684, 126.24, 115.198], ['A', ' HG1', 173.985, 127.196, 116.752], ['A', ' HG2', 173.874, 127.24, 113.317], ['A', ' HG2', 172.117, 127.472, 113.166], ['A', ' HG2', 173.152, 128.819, 113.696]] AA_SCO= 2.282631578947368 CA_SCO= 1.4875263157894736
[['A', ' N ', 171.452, 128.366, 118.156], ['A', ' CA ', 171.232, 127.917, 119.521], ['A', ' C ', 170.037, 128.666, 120.061], ['A', ' O ', 170.108, 129.818, 120.491], ['A', ' CB ', 172.442, 128.176, 120.379], ['A', ' OG ', 172.209, 127.775, 121.702], ['A', ' H ', 171.644, 129.363, 117.97], ['A', ' HA ', 171.006, 126.852, 119.528], ['A', ' HB ', 173.296, 127.636, 119.975], ['A', ' HB ', 172.683, 129.241, 120.35], ['A', ' HG ', 173.011, 127.986, 122.185]] AA_SCO= 2.149473684210527 CA_SCO= 1.4802105263157896
[['A', ' N ', 168.913, 127.988, 120.044], ['A', ' CA ', 167.662, 128.609, 120.385], ['A', ' C ', 166.649, 127.545, 120.731], ['A', ' O ', 166.817, 126.393, 120.323], ['A', ' CB ', 167.184, 129.424, 119.191], ['A', ' H ', 168.939, 127.032, 119.721], ['A', ' HA ', 167.827, 129.248, 121.25], ['A', ' HB ', 166.236, 129.913, 119.394], ['A', ' HB ', 167.927, 130.182, 118.937], ['A', ' HB ', 167.056, 128.749, 118.345]] AA_SCO= 2.1531578947368417 CA_SCO= 1.4348421052631581
[['A', ' N ', 165.612, 127.857, 121.502], ['A', ' CA ', 164.488, 126.991, 121.666], ['A', ' C ', 163.875, 127.017, 120.303], ['A', ' O ', 163.915, 128.062, 119.662], ['A', ' CB ', 163.651, 127.692, 122.728], ['A', ' CG ', 164.059, 129.151, 122.621], ['A', ' CD ', 165.526, 129.125, 122.225], ['A', ' HA ', 164.815, 125.982, 121.957], ['A', ' HB ', 162.581, 127.534, 122.522], ['A', ' HB ', 163.855, 127.256, 123.718], ['A', ' HG ', 163.435, 129.658, 121.866], ['A', ' HG ', 163.88, 129.667, 123.576], ['A', ' HD ', 165.711, 129.986, 121.581], ['A', ' HD ', 166.178, 129.115, 123.111]] AA_SCO= 2.1763157894736844 CA_SCO= 1.4580000000000002
[['A', ' N ', 163.319, 125.922, 119.855], ['A', ' CA ', 162.738, 125.924, 118.53], ['A', ' C ', 161.269, 125.618, 118.624], ['A', ' O ', 160.441, 126.341, 118.081], ['A', ' CB ', 163.452, 124.906, 117.645], ['A', ' CG1', 162.874, 124.877, 116.304], ['A', ' CG2', 164.844, 125.247, 117.549], ['A', ' H ', 163.287, 125.1, 120.441], ['A', ' HA ', 162.858, 126.91, 118.086], ['A', ' HB ', 163.329, 123.913, 118.074], ['A', ' HG1', 163.383, 124.128, 115.698], ['A', ' HG1', 161.84, 124.644, 116.366], ['A', ' HG1', 162.996, 125.84, 115.851], ['A', ' HG2', 165.33, 124.514, 116.923], ['A', ' HG2', 164.944, 126.232, 117.111], ['A', ' HG2', 165.303, 125.244, 118.532]] AA_SCO= 2.0626315789473684 CA_SCO= 1.5048947368421055
[['A', ' N ', 160.96, 124.504, 119.269], ['A', ' CA ', 159.598, 124.051, 119.373], ['A', ' C ', 158.963, 124.659, 120.601], ['A', ' O ', 159.594, 124.712, 121.658], ['A', ' CB ', 159.563, 122.551, 119.487], ['A', ' CG ', 158.217, 121.924, 119.36], ['A', ' CD ', 158.323, 120.464, 119.287], ['A', ' NE ', 157.03, 119.829, 119.056], ['A', ' CZ ', 156.166, 119.433, 120.016], ['A', ' NH1', 156.433, 119.624, 121.293], ['A', ' NH2', 155.04, 118.842, 119.658], ['A', ' H ', 161.685, 123.939, 119.675], ['A', ' HA ', 159.05, 124.363, 118.48], ['A', ' HB ', 160.205, 122.139, 118.783], ['A', ' HB ', 159.947, 122.27, 120.463], ['A', ' HG ', 157.579, 122.203, 120.2], ['A', ' HG ', 157.78, 122.268, 118.428], ['A', ' HD ', 158.975, 120.204, 118.452], ['A', ' HD ', 158.754, 120.076, 120.205], ['A', ' HE ', 156.76, 119.651, 118.085], ['A', ' HH1', 157.29, 120.077, 121.573], ['A', ' HH1', 155.777, 119.32, 121.998], ['A', ' HH2', 154.843, 118.687, 118.669], ['A', ' HH2', 154.383, 118.527, 120.355]] AA_SCO= 1.9821052631578946 CA_SCO= 1.4958947368421054
[['A', ' N ', 157.73, 125.104, 120.452], ['A', ' CA ', 156.919, 125.662, 121.508], ['A', ' C ', 156.434, 124.608, 122.488], ['A', ' O ', 156.179, 123.463, 122.125], ['A', ' CB ', 155.73, 126.353, 120.898], ['A', ' H ', 157.327, 125.06, 119.518], ['A', ' HA ', 157.524, 126.385, 122.055], ['A', ' HB ', 155.123, 126.804, 121.681], ['A', ' HB ', 156.07, 127.12, 120.21], ['A', ' HB ', 155.159, 125.611, 120.36]] AA_SCO= 1.9689473684210528 CA_SCO= 1.5472631578947371
[['A', ' N ', 156.284, 125.011, 123.737], ['A', ' CA ', 155.735, 124.179, 124.806], ['A', ' C ', 154.234, 124.448, 124.911], ['A', ' O ', 153.839, 125.593, 125.144], ['A', ' CB ', 156.408, 124.475, 126.143], ['A', ' CG ', 155.974, 123.507, 127.24], ['A', ' OD1', 155.334, 122.526, 126.922], ['A', ' OD2', 156.295, 123.747, 128.382], ['A', ' H ', 156.547, 125.96, 123.962], ['A', ' HA ', 155.884, 123.129, 124.554], ['A', ' HB ', 157.491, 124.414, 126.027], ['A', ' HB ', 156.165, 125.489, 126.458]] AA_SCO= 1.9857894736842103 CA_SCO= 1.5922105263157897
[['A', ' N ', 153.39, 123.469, 124.619], ['A', ' CA ', 151.958, 123.739, 124.609], ['A', ' C ', 151.08, 122.569, 125.021], ['A', ' O ', 151.507, 121.419, 125.034], ['A', ' CB ', 151.542, 124.165, 123.219], ['A', ' CG ', 151.753, 123.083, 122.257], ['A', ' CD1', 150.748, 122.181, 121.972], ['A', ' CD2', 152.971, 122.936, 121.652], ['A', ' CE1', 150.971, 121.155, 121.115], ['A', ' CE2', 153.195, 121.918, 120.799], ['A', ' CZ ', 152.199, 121.019, 120.531], ['A', ' H ', 153.745, 122.539, 124.437], ['A', ' HA ', 151.764, 124.558, 125.302], ['A', ' HB ', 150.488, 124.44, 123.209], ['A', ' HB ', 152.127, 125.032, 122.912], ['A', ' HD1', 149.773, 122.286, 122.446], ['A', ' HD2', 153.766, 123.644, 121.871], ['A', ' HE1', 150.177, 120.442, 120.899], ['A', ' HE2', 154.169, 121.811, 120.336], ['A', ' HZ ', 152.384, 120.197, 119.845]] AA_SCO= 2.0194736842105256 CA_SCO= 1.5927368421052632
[['A', ' N ', 149.838, 122.911, 125.373], ['A', ' CA ', 148.758, 121.992, 125.734], ['A', ' C ', 147.792, 121.839, 124.558], ['A', ' O ', 147.184, 122.823, 124.132], ['A', ' CB ', 148.044, 122.491, 126.995], ['A', ' CG ', 146.983, 121.521, 127.588], ['A', ' OD1', 146.354, 120.749, 126.876], ['A', ' OD2', 146.831, 121.554, 128.799], ['A', ' H ', 149.613, 123.895, 125.366], ['A', ' HA ', 149.189, 121.011, 125.944], ['A', ' HB ', 148.787, 122.699, 127.767], ['A', ' HB ', 147.546, 123.435, 126.767]] AA_SCO= 1.9731578947368418 CA_SCO= 1.5887368421052634
[['A', ' N ', 147.707, 120.637, 123.99], ['A', ' CA ', 146.902, 120.367, 122.797], ['A', ' C ', 145.392, 120.369, 123.038], ['A', ' O ', 144.595, 120.278, 122.094], ['A', ' CB ', 147.296, 119.036, 122.151], ['A', ' CG ', 146.876, 117.762, 122.915], ['A', ' CD ', 147.843, 117.353, 123.984], ['A', ' OE1', 148.55, 118.207, 124.468], ['A', ' OE2', 147.875, 116.198, 124.321], ['A', ' H ', 148.236, 119.862, 124.404], ['A', ' HA ', 147.111, 121.148, 122.09], ['A', ' HB ', 146.861, 118.979, 121.154], ['A', ' HB ', 148.378, 119.004, 122.031], ['A', ' HG ', 145.898, 117.898, 123.366], ['A', ' HG ', 146.789, 116.952, 122.192]] AA_SCO= 2.0084210526315784 CA_SCO= 1.5780526315789474
[['A', ' N ', 144.967, 120.414, 124.286], ['A', ' CA ', 143.545, 120.365, 124.539], ['A', ' C ', 142.92, 121.725, 124.34], ['A', ' O ', 142.677, 122.457, 125.299], ['A', ' CB ', 143.256, 119.901, 125.945], ['A', ' CG ', 143.683, 118.488, 126.243], ['A', ' CD ', 143.484, 118.161, 127.667], ['A', ' NE ', 144.352, 118.974, 128.507], ['A', ' CZ ', 144.333, 119.024, 129.859], ['A', ' NH1', 143.487, 118.281, 130.565], ['A', ' NH2', 145.178, 119.832, 130.469], ['A', ' H ', 145.634, 120.509, 125.071], ['A', ' HA ', 143.098, 119.668, 123.846], ['A', ' HB ', 143.758, 120.567, 126.645], ['A', ' HB ', 142.185, 119.97, 126.134], ['A', ' HG ', 143.105, 117.792, 125.634], ['A', ' HG ', 144.748, 118.38, 126.014], ['A', ' HD ', 142.45, 118.357, 127.943], ['A', ' HD ', 143.723, 117.112, 127.836], ['A', ' HE ', 145.045, 119.582, 128.017], ['A', ' HH1', 142.841, 117.663, 130.099], ['A', ' HH1', 143.489, 118.334, 131.574], ['A', ' HH2', 145.825, 120.417, 129.895], ['A', ' HH2', 145.196, 119.899, 131.469]] AA_SCO= 2.0431578947368423 CA_SCO= 1.6167368421052632
[['A', ' N ', 142.635, 122.035, 123.09], ['A', ' CA ', 142.105, 123.331, 122.725], ['A', ' C ', 140.641, 123.468, 123.093], ['A', ' O ', 139.96, 122.495, 123.463], ['A', ' H ', 142.929, 121.364, 122.383], ['A', ' HA ', 142.687, 124.117, 123.208], ['A', ' HA ', 142.208, 123.468, 121.649]] AA_SCO= 1.887894736842105 CA_SCO= 1.5772631578947365
[['A', ' N ', 140.137, 124.694, 122.941], ['A', ' CA ', 138.748, 125.009, 123.244], ['A', ' C ', 137.927, 125.144, 121.983], ['A', ' O ', 136.699, 125.182, 122.026], ['A', ' CB ', 138.666, 126.327, 124.013], ['A', ' OG1', 139.183, 127.382, 123.186], ['A', ' CG2', 139.5, 126.225, 125.273], ['A', ' H ', 140.751, 125.445, 122.65], ['A', ' HA ', 138.326, 124.204, 123.847], ['A', ' HB ', 137.63, 126.542, 124.272], ['A', ' HG1', 138.514, 127.626, 122.519], ['A', ' HG2', 139.447, 127.167, 125.818], ['A', ' HG2', 139.113, 125.42, 125.897], ['A', ' HG2', 140.536, 126.016, 125.02]] AA_SCO= 1.8221052631578947 CA_SCO= 1.580578947368421
[['A', ' N ', 138.628, 125.288, 120.876], ['A', ' CA ', 138.065, 125.435, 119.552], ['A', ' C ', 137.934, 126.889, 119.118], ['A', ' O ', 137.233, 127.67, 119.76], ['A', ' H ', 139.629, 125.221, 120.96], ['A', ' HA ', 138.705, 124.897, 118.857], ['A', ' HA ', 137.087, 124.955, 119.519]] AA_SCO= 1.8710526315789473 CA_SCO= 1.5965789473684209
[['A', ' N ', 138.577, 127.271, 118.011], ['A', ' CA ', 138.417, 128.637, 117.533], ['A', ' C ', 138.587, 128.806, 116.02], ['A', ' O ', 138.813, 129.925, 115.572], ['A', ' CB ', 139.351, 129.601, 118.265], ['A', ' CG ', 140.817, 129.426, 117.987], ['A', ' CD ', 141.664, 130.526, 118.656], ['A', ' CE ', 141.964, 130.226, 120.13], ['A', ' NZ ', 142.846, 131.274, 120.759], ['A', ' H ', 139.189, 126.635, 117.532], ['A', ' HA ', 137.397, 128.947, 117.765], ['A', ' HB ', 139.083, 130.624, 118.003], ['A', ' HB ', 139.198, 129.493, 119.336], ['A', ' HG ', 141.127, 128.463, 118.387], ['A', ' HG ', 141.01, 129.441, 116.913], ['A', ' HD ', 142.615, 130.612, 118.122], ['A', ' HD ', 141.147, 131.478, 118.587], ['A', ' HE ', 141.039, 130.163, 120.694], ['A', ' HE ', 142.483, 129.267, 120.187], ['A', ' HZ ', 143.082, 131.024, 121.732], ['A', ' HZ ', 143.754, 131.344, 120.288], ['A', ' HZ ', 142.409, 132.168, 120.742]] AA_SCO= 1.9068421052631581 CA_SCO= 1.581631578947368
[['A', ' N ', 138.526, 127.723, 115.234], ['A', ' CA ', 138.711, 127.835, 113.78], ['A', ' C ', 139.949, 128.628, 113.42], ['A', ' O ', 139.857, 129.721, 112.859], ['A', ' CB ', 137.486, 128.47, 113.131], ['A', ' CG ', 136.162, 127.708, 113.286], ['A', ' CD1', 135.043, 128.575, 112.766], ['A', ' CD2', 136.19, 126.385, 112.471], ['A', ' H ', 138.322, 126.823, 115.626], ['A', ' HA ', 138.848, 126.836, 113.378], ['A', ' HB ', 137.349, 129.469, 113.54], ['A', ' HB ', 137.682, 128.571, 112.087], ['A', ' HG ', 135.993, 127.495, 114.337], ['A', ' HD1', 134.094, 128.053, 112.877], ['A', ' HD1', 135.013, 129.506, 113.332], ['A', ' HD1', 135.216, 128.797, 111.712], ['A', ' HD2', 135.244, 125.864, 112.591], ['A', ' HD2', 136.331, 126.597, 111.436], ['A', ' HD2', 136.971, 125.751, 112.786]] AA_SCO= 1.9015789473684213 CA_SCO= 1.6264210526315785
[['A', ' N ', 141.099, 128.112, 113.822], ['A', ' CA ', 142.349, 128.798, 113.618], ['A', ' C ', 142.637, 128.82, 112.147], ['A', ' O ', 142.347, 127.857, 111.436], ['A', ' H ', 141.087, 127.181, 114.218], ['A', ' HA ', 142.281, 129.811, 114.009], ['A', ' HA ', 143.147, 128.285, 114.146]] AA_SCO= 1.986842105263158 CA_SCO= 1.6327368421052628
[['A', ' N ', 143.241, 129.896, 111.682], ['A', ' CA ', 143.546, 130.027, 110.266], ['A', ' C ', 145.013, 130.215, 110.032], ['A', ' O ', 145.624, 131.128, 110.584], ['A', ' CB ', 142.833, 131.245, 109.671], ['A', ' CG1', 141.342, 131.104, 109.872], ['A', ' CG2', 143.163, 131.33, 108.143], ['A', ' CD1', 140.573, 132.373, 109.639], ['A', ' H ', 143.487, 130.634, 112.36], ['A', ' HA ', 143.228, 129.125, 109.745], ['A', ' HB ', 143.159, 132.151, 110.179], ['A', ' HG1', 140.992, 130.336, 109.204], ['A', ' HG1', 141.133, 130.791, 110.889], ['A', ' HG2', 142.667, 132.178, 107.69], ['A', ' HG2', 144.233, 131.444, 107.983], ['A', ' HG2', 142.825, 130.413, 107.653], ['A', ' HD1', 139.51, 132.187, 109.799], ['A', ' HD1', 140.915, 133.13, 110.344], ['A', ' HD1', 140.721, 132.731, 108.642]] AA_SCO= 1.995263157894737 CA_SCO= 1.669052631578947
[['A', ' N ', 145.568, 129.407, 109.161], ['A', ' CA ', 146.961, 129.569, 108.82], ['A', ' C ', 147.081, 129.557, 107.325], ['A', ' O ', 146.361, 128.819, 106.652], ['A', ' H ', 144.991, 128.677, 108.727], ['A', ' HA ', 147.355, 130.501, 109.227], ['A', ' HA ', 147.53, 128.743, 109.238]] AA_SCO= 1.9905263157894737 CA_SCO= 1.7106315789473683
[['A', ' N ', 148.015, 130.308, 106.768], ['A', ' CA ', 148.103, 130.247, 105.334], ['A', ' C ', 149.502, 130.454, 104.84], ['A', ' O ', 150.251, 131.289, 105.336], ['A', ' CB ', 147.179, 131.263, 104.729], ['A', ' H ', 148.621, 130.912, 107.309], ['A', ' HA ', 147.798, 129.257, 105.037], ['A', ' HB ', 147.229, 131.155, 103.66], ['A', ' HB ', 146.166, 131.084, 105.069], ['A', ' HB ', 147.487, 132.265, 105.021]] AA_SCO= 2.1089473684210525 CA_SCO= 1.7155789473684204
[['A', ' N ', 149.844, 129.691, 103.834], ['A', ' CA ', 151.161, 129.75, 103.269], ['A', ' C ', 151.218, 130.141, 101.817], ['A', ' O ', 150.517, 129.618, 100.952], ['A', ' CB ', 151.866, 128.406, 103.472], ['A', ' CG1', 151.927, 128.041, 104.98], ['A', ' CG2', 153.251, 128.444, 102.869], ['A', ' CD1', 152.762, 128.932, 105.897], ['A', ' H ', 149.15, 129.019, 103.493], ['A', ' HA ', 151.719, 130.502, 103.814], ['A', ' HB ', 151.289, 127.61, 102.992], ['A', ' HG1', 150.92, 128.05, 105.369], ['A', ' HG1', 152.301, 127.036, 105.048], ['A', ' HG2', 153.721, 127.509, 103.031], ['A', ' HG2', 153.216, 128.624, 101.806], ['A', ' HG2', 153.833, 129.22, 103.336], ['A', ' HD1', 152.695, 128.541, 106.917], ['A', ' HD1', 153.798, 128.923, 105.587], ['A', ' HD1', 152.395, 129.956, 105.896]] AA_SCO= 2.061052631578947 CA_SCO= 1.7604210526315789
[['A', ' N ', 152.13, 131.033, 101.518], ['A', ' CA ', 152.316, 131.404, 100.133], ['A', ' C ', 153.194, 130.375, 99.457], ['A', ' O ', 154.426, 130.497, 99.404], ['A', ' CB ', 152.93, 132.772, 99.976], ['A', ' CG ', 152.099, 133.869, 100.412], ['A', ' CD ', 150.946, 134.17, 99.599], ['A', ' OE1', 150.726, 133.609, 98.558], ['A', ' OE2', 150.24, 135.037, 100.024], ['A', ' H ', 152.659, 131.454, 102.268], ['A', ' HA ', 151.349, 131.401, 99.631], ['A', ' HB ', 153.823, 132.825, 100.536], ['A', ' HB ', 153.202, 132.941, 98.946], ['A', ' HG ', 151.726, 133.628, 101.352], ['A', ' HG ', 152.72, 134.748, 100.507]] AA_SCO= 2.055263157894737 CA_SCO= 1.765
[['A', ' N ', 152.5, 129.321, 99.052], ['A', ' CA ', 152.935, 128.12, 98.354], ['A', ' C ', 153.33, 128.527, 96.937], ['A', ' O ', 152.829, 129.531, 96.428], ['A', ' CB ', 151.796, 127.097, 98.364], ['A', ' H ', 151.518, 129.395, 99.327], ['A', ' HA ', 153.802, 127.719, 98.872], ['A', ' HB ', 152.026, 126.175, 97.889], ['A', ' HB ', 151.523, 126.895, 99.379], ['A', ' HB ', 150.962, 127.491, 97.879]] AA_SCO= 2.182105263157895 CA_SCO= 1.7888421052631578
[['A', ' N ', 154.162, 127.777, 96.215], ['A', ' CA ', 154.606, 128.107, 94.875], ['A', ' C ', 153.478, 128.153, 93.857], ['A', ' O ', 153.645, 128.678, 92.76], ['A', ' CB ', 155.579, 126.992, 94.569], ['A', ' CG ', 155.172, 125.865, 95.463], ['A', ' CD ', 154.654, 126.495, 96.702], ['A', ' HA ', 155.134, 129.074, 94.905], ['A', ' HB ', 155.517, 126.729, 93.5], ['A', ' HB ', 156.587, 127.345, 94.739], ['A', ' HG ', 154.436, 125.217, 94.966], ['A', ' HG ', 156.04, 125.226, 95.682], ['A', ' HD ', 153.881, 125.845, 97.028], ['A', ' HD ', 155.427, 126.61, 97.45]] AA_SCO= 2.1978947368421053 CA_SCO= 1.8042105263157895
[['A', ' N ', 152.338, 127.569, 94.184], ['A', ' CA ', 151.234, 127.571, 93.258], ['A', ' C ', 150.171, 128.572, 93.673], ['A', ' O ', 149.135, 128.649, 93.022], ['A', ' CB ', 150.586, 126.197, 93.204], ['A', ' CG ', 151.509, 125.021, 92.912], ['A', ' CD ', 152.247, 125.165, 91.668], ['A', ' NE ', 153.085, 124.018, 91.391], ['A', ' CZ ', 152.756, 122.928, 90.667], ['A', ' NH1', 151.593, 122.78, 90.102], ['A', ' NH2', 153.657, 122.006, 90.489], ['A', ' H ', 152.214, 127.133, 95.084], ['A', ' HA ', 151.591, 127.847, 92.267], ['A', ' HB ', 150.118, 125.991, 94.159], ['A', ' HB ', 149.799, 126.192, 92.447], ['A', ' HG ', 152.232, 124.918, 93.717], ['A', ' HG ', 150.911, 124.115, 92.845], ['A', ' HD ', 151.579, 125.319, 90.85], ['A', ' HD ', 152.907, 126.022, 91.741], ['A', ' HE ', 154.02, 124.045, 91.76], ['A', ' HH1', 150.89, 123.516, 90.151], ['A', ' HH1', 151.416, 121.961, 89.538], ['A', ' HH2', 154.585, 122.133, 90.865], ['A', ' HH2', 153.447, 121.202, 89.919]] AA_SCO= 2.196842105263158 CA_SCO= 1.809736842105263
[['A', ' N ', 150.416, 129.341, 94.737], ['A', ' CA ', 149.431, 130.296, 95.248], ['A', ' C ', 149.095, 130.061, 96.719], ['A', ' O ', 149.503, 129.072, 97.299], ['A', ' H ', 151.321, 129.276, 95.202], ['A', ' HA ', 149.826, 131.306, 95.134], ['A', ' HA ', 148.536, 130.24, 94.644]] AA_SCO= 2.066315789473684 CA_SCO= 1.8145263157894735
[['A', ' N ', 148.343, 130.961, 97.34], ['A', ' CA ', 148.067, 130.872, 98.767], ['A', ' C ', 147.3, 129.63, 99.204], ['A', ' O ', 146.169, 129.394, 98.791], ['A', ' CB ', 147.23, 132.094, 99.151], ['A', ' CG ', 146.917, 132.306, 100.619], ['A', ' CD1', 148.198, 132.656, 101.376], ['A', ' CD2', 145.872, 133.411, 100.742], ['A', ' H ', 148.001, 131.76, 96.832], ['A', ' HA ', 149.023, 130.888, 99.283], ['A', ' HB ', 147.755, 132.986, 98.799], ['A', ' HB ', 146.278, 132.035, 98.622], ['A', ' HG ', 146.532, 131.398, 101.044], ['A', ' HD1', 147.982, 132.827, 102.418], ['A', ' HD1', 148.925, 131.866, 101.294], ['A', ' HD1', 148.599, 133.556, 100.962], ['A', ' HD2', 145.636, 133.562, 101.794], ['A', ' HD2', 146.26, 134.34, 100.316], ['A', ' HD2', 144.967, 133.115, 100.21]] AA_SCO= 2.0236842105263158 CA_SCO= 1.7979473684210527
[['A', ' N ', 147.915, 128.893, 100.122], ['A', ' CA ', 147.451, 127.647, 100.728], ['A', ' C ', 146.854, 127.913, 102.107], ['A', ' O ', 147.602, 128.121, 103.061], ['A', ' CB ', 148.67, 126.686, 100.785], ['A', ' CG ', 148.428, 125.285, 101.328], ['A', ' OD1', 147.451, 125.097, 101.932], ['A', ' OD2', 149.185, 124.385, 101.069], ['A', ' H ', 148.846, 129.204, 100.378], ['A', ' HA ', 146.684, 127.222, 100.106], ['A', ' HB ', 149.062, 126.583, 99.77], ['A', ' HB ', 149.459, 127.148, 101.373]] AA_SCO= 2.1142105263157895 CA_SCO= 1.8024736842105267
[['A', ' N ', 145.522, 127.973, 102.221], ['A', ' CA ', 144.889, 128.359, 103.485], ['A', ' C ', 144.225, 127.197, 104.204], ['A', ' O ', 143.281, 126.594, 103.698], ['A', ' CB ', 143.763, 129.375, 103.225], ['A', ' CG1', 143.12, 129.803, 104.553], ['A', ' CG2', 144.264, 130.533, 102.425], ['A', ' H ', 144.932, 127.778, 101.409], ['A', ' HA ', 145.641, 128.787, 104.14], ['A', ' HB ', 143.0, 128.889, 102.661], ['A', ' HG1', 142.316, 130.48, 104.352], ['A', ' HG1', 142.723, 128.946, 105.089], ['A', ' HG1', 143.864, 130.299, 105.174], ['A', ' HG2', 143.448, 131.215, 102.22], ['A', ' HG2', 145.025, 131.05, 102.962], ['A', ' HG2', 144.663, 130.168, 101.48]] AA_SCO= 1.9547368421052629 CA_SCO= 1.814789473684211
[['A', ' N ', 144.648, 126.901, 105.42], ['A', ' CA ', 144.019, 125.799, 106.13], ['A', ' C ', 143.34, 126.333, 107.359], ['A', ' O ', 143.856, 127.209, 108.06], ['A', ' CB ', 144.983, 124.711, 106.598], ['A', ' CG ', 145.729, 123.983, 105.553], ['A', ' ND1', 146.348, 122.777, 105.792], ['A', ' CD2', 146.024, 124.297, 104.294], ['A', ' CE1', 146.983, 122.401, 104.694], ['A', ' NE2', 146.794, 123.322, 103.797], ['A', ' H ', 145.406, 127.445, 105.837], ['A', ' HA ', 143.257, 125.327, 105.518], ['A', ' HB ', 145.703, 125.155, 107.263], ['A', ' HB ', 144.423, 123.982, 107.181], ['A', ' HD2', 145.761, 125.163, 103.731], ['A', ' HE1', 147.584, 121.497, 104.571], ['A', ' HE2', 147.173, 123.406, 102.846]] AA_SCO= 1.95578947368421 CA_SCO= 1.8494210526315795
[['A', ' N ', 142.188, 125.779, 107.645], ['A', ' CA ', 141.458, 126.119, 108.841], ['A', ' C ', 141.332, 124.904, 109.728], ['A', ' O ', 141.084, 123.798, 109.245], ['A', ' CB ', 140.1, 126.702, 108.496], ['A', ' CG ', 139.221, 127.01, 109.717], ['A', ' SD ', 137.666, 127.756, 109.284], ['A', ' CE ', 138.152, 129.43, 109.256], ['A', ' H ', 141.813, 125.076, 107.001], ['A', ' HA ', 142.018, 126.868, 109.38], ['A', ' HB ', 140.245, 127.62, 107.934], ['A', ' HB ', 139.565, 126.004, 107.847], ['A', ' HG ', 139.011, 126.105, 110.281], ['A', ' HG ', 139.761, 127.7, 110.377], ['A', ' HE ', 137.305, 130.061, 108.986], ['A', ' HE ', 138.529, 129.725, 110.24], ['A', ' HE ', 138.922, 129.538, 108.546]] AA_SCO= 1.9784210526315789 CA_SCO= 1.8890000000000002
[['A', ' N ', 141.462, 125.097, 111.035], ['A', ' CA ', 141.312, 123.964, 111.928], ['A', ' C ', 140.691, 124.327, 113.264], ['A', ' O ', 140.922, 125.39, 113.85], ['A', ' CB ', 142.67, 123.337, 112.187], ['A', ' H ', 141.691, 126.036, 111.382], ['A', ' HA ', 140.666, 123.24, 111.442], ['A', ' HB ', 142.553, 122.46, 112.828], ['A', ' HB ', 143.122, 123.043, 111.251], ['A', ' HB ', 143.318, 124.066, 112.681]] AA_SCO= 2.037894736842105 CA_SCO= 1.8896842105263163
[['A', ' N ', 139.93, 123.402, 113.797], ['A', ' CA ', 139.371, 123.586, 115.113], ['A', ' C ', 139.688, 122.378, 115.94], ['A', ' O ', 139.297, 121.262, 115.594], ['A', ' CB ', 137.865, 123.781, 115.058], ['A', ' CG ', 137.233, 124.084, 116.358], ['A', ' CD ', 135.765, 124.5, 116.232], ['A', ' CE ', 134.839, 123.309, 116.026], ['A', ' NZ ', 133.4, 123.715, 116.059], ['A', ' H ', 139.759, 122.546, 113.262], ['A', ' HA ', 139.836, 124.447, 115.588], ['A', ' HB ', 137.623, 124.536, 114.367], ['A', ' HB ', 137.422, 122.86, 114.737], ['A', ' HG ', 137.305, 123.22, 117.02], ['A', ' HG ', 137.767, 124.895, 116.789], ['A', ' HD ', 135.463, 125.012, 117.152], ['A', ' HD ', 135.646, 125.189, 115.398], ['A', ' HE ', 135.049, 122.841, 115.066], ['A', ' HE ', 135.016, 122.583, 116.82], ['A', ' HZ ', 132.82, 122.899, 115.93], ['A', ' HZ ', 133.177, 124.145, 116.955], ['A', ' HZ ', 133.219, 124.378, 115.321]] AA_SCO= 2.006842105263158 CA_SCO= 1.888684210526316
[['A', ' N ', 140.346, 122.606, 117.056], ['A', ' CA ', 140.729, 121.543, 117.954], ['A', ' C ', 140.027, 121.704, 119.271], ['A', ' O ', 140.095, 122.765, 119.89], ['A', ' CB ', 142.243, 121.553, 118.18], ['A', ' CG1', 142.632, 120.463, 119.182], ['A', ' CG2', 142.945, 121.329, 116.851], ['A', ' H ', 140.602, 123.554, 117.28], ['A', ' HA ', 140.435, 120.593, 117.522], ['A', ' HB ', 142.543, 122.516, 118.599], ['A', ' HG1', 143.702, 120.485, 119.339], ['A', ' HG1', 142.142, 120.627, 120.137], ['A', ' HG1', 142.344, 119.488, 118.796], ['A', ' HG2', 144.026, 121.342, 117.0], ['A', ' HG2', 142.642, 120.37, 116.461], ['A', ' HG2', 142.67, 122.106, 116.147]] AA_SCO= 1.9815789473684209 CA_SCO= 1.8996315789473686
[['A', ' N ', 139.351, 120.652, 119.687], ['A', ' CA ', 138.646, 120.652, 120.949], ['A', ' C ', 138.948, 119.376, 121.699], ['A', ' O ', 138.844, 118.277, 121.159], ['A', ' CB ', 137.133, 120.739, 120.759], ['A', ' CG ', 136.625, 121.998, 120.069], ['A', ' CD ', 135.104, 122.024, 119.881], ['A', ' OE1', 134.48, 121.029, 120.16], ['A', ' OE2', 134.574, 123.032, 119.466], ['A', ' H ', 139.395, 119.809, 119.11], ['A', ' HA ', 138.976, 121.498, 121.541], ['A', ' HB ', 136.789, 119.87, 120.23], ['A', ' HB ', 136.661, 120.713, 121.741], ['A', ' HG ', 136.916, 122.841, 120.669], ['A', ' HG ', 137.107, 122.089, 119.103]] AA_SCO= 2.02578947368421 CA_SCO= 1.8251052631578948
[['A', ' N ', 139.3, 119.505, 122.958], ['A', ' CA ', 139.521, 118.348, 123.815], ['A', ' C ', 140.551, 117.362, 123.264], ['A', ' O ', 140.411, 116.152, 123.427], ['A', ' CB ', 138.209, 117.623, 124.04], ['A', ' CG ', 137.203, 118.486, 124.684], ['A', ' OD1', 137.492, 119.209, 125.646], ['A', ' ND2', 136.003, 118.445, 124.169], ['A', ' H ', 139.415, 120.457, 123.331], ['A', ' HA ', 139.898, 118.705, 124.775], ['A', ' HB ', 137.806, 117.237, 123.107], ['A', ' HB ', 138.384, 116.766, 124.688], ['A', ' HD2', 135.272, 119.01, 124.552], ['A', ' HD2', 135.816, 117.852, 123.384]] AA_SCO= 1.9815789473684209 CA_SCO= 1.837421052631579
[['A', ' N ', 141.588, 117.87, 122.62], ['A', ' CA ', 142.663, 117.032, 122.108], ['A', ' C ', 142.387, 116.397, 120.748], ['A', ' O ', 143.182, 115.579, 120.28], ['A', ' H ', 141.645, 118.872, 122.519], ['A', ' HA ', 143.571, 117.634, 122.039], ['A', ' HA ', 142.872, 116.246, 122.831]] AA_SCO= 1.9221052631578945 CA_SCO= 1.8188421052631578
[['A', ' N ', 141.267, 116.73, 120.117], ['A', ' CA ', 140.936, 116.174, 118.812], ['A', ' C ', 140.564, 117.258, 117.832], ['A', ' O ', 140.01, 118.299, 118.19], ['A', ' CB ', 139.801, 115.162, 118.905], ['A', ' CG ', 140.074, 113.927, 119.758], ['A', ' CD ', 141.122, 113.011, 119.114], ['A', ' CE ', 141.25, 111.679, 119.84], ['A', ' NZ ', 141.747, 111.834, 121.243], ['A', ' H ', 140.595, 117.355, 120.57], ['A', ' HA ', 141.799, 115.675, 118.408], ['A', ' HB ', 138.939, 115.654, 119.341], ['A', ' HB ', 139.524, 114.838, 117.897], ['A', ' HG ', 140.419, 114.248, 120.741], ['A', ' HG ', 139.147, 113.374, 119.884], ['A', ' HD ', 140.866, 112.83, 118.067], ['A', ' HD ', 142.089, 113.491, 119.152], ['A', ' HE ', 140.279, 111.188, 119.861], ['A', ' HE ', 141.951, 111.053, 119.289], ['A', ' HZ ', 141.82, 110.924, 121.673], ['A', ' HZ ', 142.657, 112.279, 121.247], ['A', ' HZ ', 141.1, 112.399, 121.772]] AA_SCO= 1.8689473684210525 CA_SCO= 1.7499473684210525
[['A', ' N ', 140.828, 117.012, 116.58], ['A', ' CA ', 140.415, 117.936, 115.567], ['A', ' C ', 138.923, 117.707, 115.39], ['A', ' O ', 138.446, 116.579, 115.419], ['A', ' CB ', 141.204, 117.699, 114.274], ['A', ' CG1', 142.698, 117.951, 114.546], ['A', ' CG2', 140.697, 118.629, 113.181], ['A', ' CD1', 143.609, 117.461, 113.467], ['A', ' H ', 141.299, 116.148, 116.303], ['A', ' HA ', 140.578, 118.956, 115.899], ['A', ' HB ', 141.094, 116.66, 113.96], ['A', ' HG1', 142.863, 119.01, 114.667], ['A', ' HG1', 142.978, 117.444, 115.469], ['A', ' HG2', 141.247, 118.46, 112.279], ['A', ' HG2', 139.648, 118.436, 112.989], ['A', ' HG2', 140.818, 119.667, 113.496], ['A', ' HD1', 144.637, 117.661, 113.744], ['A', ' HD1', 143.474, 116.375, 113.348], ['A', ' HD1', 143.398, 117.951, 112.53]] AA_SCO= 1.8684210526315794 CA_SCO= 1.7100526315789473
[['A', ' N ', 138.159, 118.775, 115.382], ['A', ' CA ', 136.726, 118.671, 115.195], ['A', ' C ', 136.395, 119.135, 113.82], ['A', ' O ', 135.421, 118.705, 113.204], ['A', ' CB ', 135.99, 119.514, 116.207], ['A', ' CG ', 136.242, 119.104, 117.586], ['A', ' CD ', 135.797, 117.718, 117.836], ['A', ' OE1', 134.636, 117.38, 117.602], ['A', ' NE2', 136.697, 116.885, 118.293], ['A', ' H ', 138.604, 119.678, 115.435], ['A', ' HA ', 136.42, 117.63, 115.283], ['A', ' HB ', 136.315, 120.549, 116.111], ['A', ' HB ', 134.92, 119.479, 116.017], ['A', ' HG ', 137.308, 119.184, 117.809], ['A', ' HG ', 135.669, 119.754, 118.227], ['A', ' HE2', 136.457, 115.931, 118.467], ['A', ' HE2', 137.638, 117.204, 118.455]] AA_SCO= 1.926842105263158 CA_SCO= 1.6936315789473682
[['A', ' N ', 137.227, 120.031, 113.345], ['A', ' CA ', 137.061, 120.595, 112.031], ['A', ' C ', 138.38, 120.816, 111.366], ['A', ' O ', 139.328, 121.301, 111.988], ['A', ' CB ', 136.364, 121.939, 112.092], ['A', ' CG ', 136.221, 122.558, 110.799], ['A', ' CD1', 135.166, 122.249, 110.004], ['A', ' CD2', 137.168, 123.456, 110.344], ['A', ' CE1', 135.039, 122.82, 108.785], ['A', ' CE2', 137.038, 124.016, 109.123], ['A', ' CZ ', 135.971, 123.702, 108.348], ['A', ' H ', 137.972, 120.355, 113.965], ['A', ' HA ', 136.478, 119.905, 111.419], ['A', ' HB ', 135.384, 121.833, 112.544], ['A', ' HB ', 136.931, 122.603, 112.682], ['A', ' HD1', 134.418, 121.537, 110.356], ['A', ' HD2', 138.03, 123.708, 110.969], ['A', ' HE1', 134.188, 122.57, 108.152], ['A', ' HE2', 137.779, 124.712, 108.753], ['A', ' HZ ', 135.866, 124.155, 107.37]] AA_SCO= 2.0226315789473683 CA_SCO= 1.6947368421052633
[['A', ' N ', 138.44, 120.482, 110.105], ['A', ' CA ', 139.591, 120.779, 109.302], ['A', ' C ', 139.192, 120.865, 107.857], ['A', ' O ', 138.457, 120.011, 107.358], ['A', ' CB ', 140.69, 119.749, 109.501], ['A', ' CG ', 141.82, 119.964, 108.589], ['A', ' CD1', 142.793, 120.886, 108.863], ['A', ' CD2', 141.859, 119.243, 107.45], ['A', ' CE1', 143.806, 121.086, 107.97], ['A', ' CE2', 142.855, 119.429, 106.557], ['A', ' CZ ', 143.821, 120.347, 106.803], ['A', ' OH ', 144.801, 120.517, 105.88], ['A', ' H ', 137.645, 120.036, 109.664], ['A', ' HA ', 139.969, 121.75, 109.593], ['A', ' HB ', 141.063, 119.824, 110.509], ['A', ' HB ', 140.306, 118.745, 109.355], ['A', ' HD1', 142.747, 121.458, 109.775], ['A', ' HD2', 141.073, 118.519, 107.258], ['A', ' HE1', 144.582, 121.823, 108.172], ['A', ' HE2', 142.879, 118.848, 105.634], ['A', ' HH ', 145.332, 121.306, 106.085]] AA_SCO= 2.0457894736842106 CA_SCO= 1.6949473684210523
[['A', ' N ', 139.675, 121.896, 107.186], ['A', ' CA ', 139.443, 122.056, 105.758], ['A', ' C ', 140.502, 122.939, 105.156], ['A', ' O ', 141.187, 123.671, 105.88], ['A', ' CB ', 138.093, 122.661, 105.476], ['A', ' OG ', 138.043, 123.989, 105.902], ['A', ' H ', 140.226, 122.591, 107.702], ['A', ' HA ', 139.495, 121.081, 105.288], ['A', ' HB ', 137.893, 122.607, 104.405], ['A', ' HB ', 137.322, 122.081, 105.981], ['A', ' HG ', 137.192, 124.321, 105.617]] AA_SCO= 2.0805263157894736 CA_SCO= 1.6716315789473681
[['A', ' N ', 140.626, 122.942, 103.831], ['A', ' CA ', 141.593, 123.854, 103.259], ['A', ' C ', 141.172, 124.41, 101.894], ['A', ' O ', 140.51, 123.746, 101.103], ['A', ' CB ', 142.919, 123.138, 103.174], ['A', ' H ', 140.075, 122.3, 103.246], ['A', ' HA ', 141.686, 124.703, 103.928], ['A', ' HB ', 143.654, 123.823, 102.818], ['A', ' HB ', 143.21, 122.787, 104.166], ['A', ' HB ', 142.837, 122.289, 102.5]] AA_SCO= 2.1257894736842107 CA_SCO= 1.671421052631579
[['A', ' N ', 141.579, 125.659, 101.651], ['A', ' CA ', 141.384, 126.395, 100.404], ['A', ' C ', 142.757, 126.607, 99.851], ['A', ' O ', 143.483, 127.495, 100.304], ['A', ' CB ', 140.792, 127.763, 100.697], ['A', ' CG ', 139.575, 127.787, 101.541], ['A', ' CD1', 139.258, 129.244, 101.857], ['A', ' CD2', 138.451, 127.081, 100.824], ['A', ' H ', 142.113, 126.11, 102.392], ['A', ' HA ', 140.797, 125.811, 99.693], ['A', ' HB ', 141.529, 128.385, 101.152], ['A', ' HB ', 140.523, 128.211, 99.741], ['A', ' HG ', 139.764, 127.277, 102.486], ['A', ' HD1', 138.38, 129.295, 102.49], ['A', ' HD1', 140.103, 129.694, 102.379], ['A', ' HD1', 139.078, 129.78, 100.937], ['A', ' HD2', 137.552, 127.1, 101.44], ['A', ' HD2', 138.252, 127.569, 99.887], ['A', ' HD2', 138.715, 126.043, 100.632]] AA_SCO= 2.276842105263158 CA_SCO= 1.6705263157894736
[['A', ' N ', 143.12, 125.81, 98.902], ['A', ' CA ', 144.485, 125.757, 98.468], ['A', ' C ', 144.493, 126.153, 96.947], ['A', ' O ', 143.415, 126.274, 96.349], ['A', ' CB ', 144.962, 124.355, 98.958], ['A', ' CG1', 146.304, 124.095, 98.729], ['A', ' CG2', 144.705, 124.189, 100.391], ['A', ' H ', 142.424, 125.158, 98.524], ['A', ' HA ', 145.037, 126.506, 99.007], ['A', ' HB ', 144.417, 123.657, 98.472], ['A', ' HG1', 146.521, 123.096, 99.071], ['A', ' HG1', 146.499, 124.192, 97.713], ['A', ' HG1', 146.888, 124.778, 99.275], ['A', ' HG2', 145.015, 123.197, 100.7], ['A', ' HG2', 145.261, 124.933, 100.959], ['A', ' HG2', 143.677, 124.284, 100.586]] AA_SCO= 2.289473684210526 CA_SCO= 1.687421052631579
[['A', ' N ', 145.615, 126.617, 96.343], ['A', ' CA ', 145.691, 127.116, 94.991], ['A', ' C ', 145.193, 126.339, 93.816], ['A', ' O ', 144.802, 126.952, 92.818], ['A', ' CB ', 147.183, 127.302, 94.832], ['A', ' CG ', 147.795, 126.556, 95.942], ['A', ' CD ', 146.864, 126.833, 97.011], ['A', ' HA ', 145.224, 128.089, 94.982], ['A', ' HB ', 147.5, 126.932, 93.846], ['A', ' HB ', 147.402, 128.351, 94.855], ['A', ' HG ', 147.905, 125.495, 95.705], ['A', ' HG ', 148.804, 126.941, 96.145], ['A', ' HD ', 147.062, 126.327, 97.867], ['A', ' HD ', 146.949, 127.887, 97.174]] AA_SCO= 2.289473684210526 CA_SCO= 1.6868947368421054
[['A', ' N ', 145.176, 125.035, 93.844], ['A', ' CA ', 144.67, 124.464, 92.622], ['A', ' C ', 143.204, 124.766, 92.432], ['A', ' O ', 142.798, 125.084, 91.309], ['A', ' CB ', 144.923, 122.978, 92.505], ['A', ' OG1', 146.349, 122.742, 92.46], ['A', ' CG2', 144.265, 122.441, 91.253], ['A', ' H ', 145.456, 124.457, 94.649], ['A', ' HA ', 145.203, 124.927, 91.792], ['A', ' HB ', 144.508, 122.485, 93.372], ['A', ' HG1', 146.747, 123.009, 93.321], ['A', ' HG2', 144.435, 121.401, 91.178], ['A', ' HG2', 143.202, 122.603, 91.293], ['A', ' HG2', 144.669, 122.941, 90.388]] AA_SCO= 2.4431578947368418 CA_SCO= 1.6863684210526315
[['A', ' N ', 142.386, 124.675, 93.484], ['A', ' CA ', 140.987, 124.885, 93.212], ['A', ' C ', 140.676, 126.349, 93.208], ['A', ' O ', 139.683, 126.753, 92.613], ['A', ' CB ', 140.057, 124.177, 94.177], ['A', ' OG1', 140.169, 124.726, 95.471], ['A', ' CG2', 140.371, 122.703, 94.202], ['A', ' H ', 142.706, 124.436, 94.431], ['A', ' HA ', 140.765, 124.498, 92.22], ['A', ' HB ', 139.049, 124.314, 93.84], ['A', ' HG1', 141.067, 124.594, 95.817], ['A', ' HG2', 139.689, 122.213, 94.89], ['A', ' HG2', 140.258, 122.305, 93.201], ['A', ' HG2', 141.385, 122.537, 94.524]] AA_SCO= 2.4584210526315786 CA_SCO= 1.641473684210526
[['A', ' N ', 141.542, 127.185, 93.782], ['A', ' CA ', 141.276, 128.603, 93.635], ['A', ' C ', 141.335, 128.925, 92.139], ['A', ' O ', 140.512, 129.688, 91.638], ['A', ' CB ', 142.322, 129.479, 94.323], ['A', ' CG ', 142.219, 129.702, 95.812], ['A', ' CD1', 143.054, 129.257, 96.764], ['A', ' CD2', 141.259, 130.478, 96.493], ['A', ' NE1', 142.658, 129.671, 97.978], ['A', ' CE2', 141.571, 130.414, 97.844], ['A', ' CE3', 140.186, 131.209, 96.09], ['A', ' CZ2', 140.842, 131.051, 98.779], ['A', ' CZ3', 139.447, 131.843, 97.035], ['A', ' CH2', 139.77, 131.77, 98.349], ['A', ' H ', 142.317, 126.832, 94.356], ['A', ' HA ', 140.284, 128.833, 94.021], ['A', ' HB ', 143.262, 129.008, 94.142], ['A', ' HB ', 142.352, 130.456, 93.832], ['A', ' HD1', 143.907, 128.672, 96.6], ['A', ' HE1', 143.132, 129.455, 98.868], ['A', ' HE3', 139.919, 131.272, 95.034], ['A', ' HZ2', 141.097, 131.0, 99.836], ['A', ' HZ3', 138.593, 132.401, 96.698], ['A', ' HH2', 139.175, 132.292, 99.072]] AA_SCO= 2.537894736842105 CA_SCO= 1.632315789473684
[['A', ' N ', 142.309, 128.332, 91.43], ['A', ' CA ', 142.482, 128.573, 90.004], ['A', ' C ', 141.578, 127.8, 89.037], ['A', ' O ', 141.227, 128.342, 87.988], ['A', ' CB ', 143.926, 128.378, 89.636], ['A', ' CG ', 144.755, 129.504, 90.121], ['A', ' OD1', 144.266, 130.634, 90.257], ['A', ' ND2', 145.984, 129.255, 90.384], ['A', ' H ', 142.995, 127.749, 91.924], ['A', ' HA ', 142.252, 129.625, 89.838], ['A', ' HB ', 144.289, 127.448, 90.085], ['A', ' HB ', 144.032, 128.291, 88.557], ['A', ' HD2', 146.586, 130.006, 90.706], ['A', ' HD2', 146.363, 128.336, 90.28]] AA_SCO= 2.50578947368421 CA_SCO= 1.6323684210526312
[['A', ' N ', 141.115, 126.598, 89.365], ['A', ' CA ', 140.293, 125.877, 88.382], ['A', ' C ', 139.12, 126.669, 87.784], ['A', ' O ', 138.948, 126.627, 86.56], ['A', ' CB ', 139.848, 124.48, 88.875], ['A', ' CG1', 141.06, 123.537, 88.919], ['A', ' CG2', 138.76, 123.946, 87.988], ['A', ' CD1', 140.829, 122.234, 89.665], ['A', ' H ', 141.437, 126.15, 90.23], ['A', ' HA ', 140.918, 125.669, 87.543], ['A', ' HB ', 139.484, 124.534, 89.887], ['A', ' HG1', 141.339, 123.289, 87.9], ['A', ' HG1', 141.884, 124.054, 89.375], ['A', ' HG2', 138.45, 122.986, 88.337], ['A', ' HG2', 137.886, 124.593, 87.988], ['A', ' HG2', 139.135, 123.862, 86.975], ['A', ' HD1', 141.736, 121.64, 89.637], ['A', ' HD1', 140.573, 122.45, 90.699], ['A', ' HD1', 140.031, 121.667, 89.206]] AA_SCO= 2.438421052631579 CA_SCO= 1.6357368421052627
[['A', ' N ', 138.294, 127.373, 88.564], ['A', ' CA ', 137.174, 128.181, 88.128], ['A', ' C ', 137.584, 129.348, 87.226], ['A', ' O ', 136.739, 129.951, 86.569], ['A', ' CB ', 136.634, 128.712, 89.446], ['A', ' CG ', 137.13, 127.762, 90.455], ['A', ' CD ', 138.432, 127.35, 90.0], ['A', ' HA ', 136.435, 127.538, 87.627], ['A', ' HB ', 136.994, 129.724, 89.613], ['A', ' HB ', 135.539, 128.754, 89.424], ['A', ' HG ', 137.227, 128.249, 91.435], ['A', ' HG ', 136.446, 126.933, 90.563], ['A', ' HD ', 139.154, 128.085, 90.344], ['A', ' HD ', 138.609, 126.382, 90.405]] AA_SCO= 2.436315789473684 CA_SCO= 1.63978947368421
[['A', ' N ', 138.87, 129.691, 87.218], ['A', ' CA ', 139.376, 130.783, 86.414], ['A', ' C ', 140.068, 130.236, 85.185], ['A', ' O ', 140.11, 130.89, 84.141], ['A', ' CB ', 140.378, 131.639, 87.222], ['A', ' OG1', 139.735, 132.142, 88.387], ['A', ' CG2', 140.872, 132.814, 86.406], ['A', ' H ', 139.556, 129.173, 87.755], ['A', ' HA ', 138.542, 131.404, 86.093], ['A', ' HB ', 141.229, 131.023, 87.525], ['A', ' HG1', 139.688, 131.434, 89.042], ['A', ' HG2', 141.551, 133.395, 87.01], ['A', ' HG2', 141.396, 132.473, 85.519], ['A', ' HG2', 140.03, 133.437, 86.113]] AA_SCO= 2.4368421052631577 CA_SCO= 1.7122631578947365
[['A', ' N ', 140.627, 129.031, 85.293], ['A', ' CA ', 141.349, 128.453, 84.175], ['A', ' C ', 140.46, 128.05, 83.024], ['A', ' O ', 140.795, 128.292, 81.88], ['A', ' CB ', 142.127, 127.232, 84.611], ['A', ' CG ', 143.277, 127.54, 85.451], ['A', ' SD ', 144.355, 126.152, 85.708], ['A', ' CE ', 143.479, 125.214, 86.879], ['A', ' H ', 140.583, 128.54, 86.185], ['A', ' HA ', 142.049, 129.2, 83.806], ['A', ' HB ', 141.456, 126.58, 85.168], ['A', ' HB ', 142.467, 126.689, 83.759], ['A', ' HG ', 143.803, 128.309, 84.987], ['A', ' HG ', 142.952, 127.902, 86.399], ['A', ' HE ', 144.004, 124.322, 87.111], ['A', ' HE ', 143.337, 125.792, 87.781], ['A', ' HE ', 142.554, 124.948, 86.463]] AA_SCO= 2.476842105263158 CA_SCO= 1.7305789473684208
[['A', ' N ', 139.298, 127.484, 83.299], ['A', ' CA ', 138.44, 127.04, 82.194], ['A', ' C ', 138.231, 128.128, 81.141], ['A', ' O ', 138.649, 127.971, 79.99], ['A', ' H ', 139.057, 127.299, 84.281], ['A', ' HA ', 138.909, 126.192, 81.708], ['A', ' HA ', 137.493, 126.683, 82.578]] AA_SCO= 2.512631578947368 CA_SCO= 1.7421052631578948
[['A', ' N ', 137.642, 129.261, 81.52], ['A', ' CA ', 137.328, 130.407, 80.697], ['A', ' C ', 138.555, 131.097, 80.116], ['A', ' O ', 138.441, 131.946, 79.239], ['A', ' CB ', 136.625, 131.342, 81.674], ['A', ' CG ', 136.121, 130.457, 82.764], ['A', ' CD ', 137.148, 129.403, 82.901], ['A', ' HA ', 136.643, 130.086, 79.9], ['A', ' HB ', 137.332, 132.086, 82.043], ['A', ' HB ', 135.822, 131.886, 81.148], ['A', ' HG ', 135.99, 131.029, 83.699], ['A', ' HG ', 135.133, 130.05, 82.495], ['A', ' HD ', 137.924, 129.756, 83.561], ['A', ' HD ', 136.649, 128.516, 83.282]] AA_SCO= 2.641578947368421 CA_SCO= 1.8107894736842105
[['A', ' N ', 139.739, 130.766, 80.599], ['A', ' CA ', 140.951, 131.423, 80.166], ['A', ' C ', 141.306, 131.071, 78.744], ['A', ' O ', 142.155, 131.724, 78.13], ['A', ' CB ', 142.081, 131.039, 81.092], ['A', ' H ', 139.863, 129.995, 81.253], ['A', ' HA ', 140.782, 132.495, 80.219], ['A', ' HB ', 142.977, 131.571, 80.804], ['A', ' HB ', 141.831, 131.278, 82.107], ['A', ' HB ', 142.244, 129.979, 81.026]] AA_SCO= 2.662631578947368 CA_SCO= 1.8323157894736841
[['A', ' N ', 140.694, 130.02, 78.218], ['A', ' CA ', 140.997, 129.578, 76.876], ['A', ' C ', 140.088, 130.267, 75.841], ['A', ' O ', 140.306, 130.141, 74.63], ['A', ' CB ', 140.844, 128.056, 76.784], ['A', ' OG1', 139.48, 127.688, 76.959], ['A', ' CG2', 141.654, 127.413, 77.935], ['A', ' H ', 140.005, 129.488, 78.77], ['A', ' HA ', 142.031, 129.837, 76.65], ['A', ' HB ', 141.198, 127.705, 75.815], ['A', ' HG1', 139.361, 126.771, 76.694], ['A', ' HG2', 141.562, 126.333, 77.888], ['A', ' HG2', 142.688, 127.687, 77.842], ['A', ' HG2', 141.282, 127.759, 78.901]] AA_SCO= 2.6810526315789467 CA_SCO= 1.8156315789473685
[['A', ' N ', 139.067, 130.973, 76.315], ['A', ' CA ', 138.076, 131.556, 75.428], ['A', ' C ', 138.674, 132.694, 74.611], ['A', ' O ', 139.464, 133.501, 75.1], ['A', ' CB ', 136.881, 132.029, 76.256], ['A', ' CG ', 136.115, 130.873, 76.925], ['A', ' CD ', 134.99, 131.316, 77.862], ['A', ' OE1', 134.795, 132.494, 78.001], ['A', ' OE2', 134.333, 130.455, 78.459], ['A', ' H ', 138.963, 131.119, 77.323], ['A', ' HA ', 137.734, 130.789, 74.736], ['A', ' HB ', 137.22, 132.713, 77.034], ['A', ' HB ', 136.184, 132.568, 75.615], ['A', ' HG ', 135.696, 130.27, 76.135], ['A', ' HG ', 136.818, 130.25, 77.471]] AA_SCO= 2.5984210526315783 CA_SCO= 1.8155789473684212
[['A', ' N ', 138.263, 132.764, 73.352], ['A', ' CA ', 138.678, 133.785, 72.405], ['A', ' C ', 139.847, 133.338, 71.539], ['A', ' O ', 140.197, 134.006, 70.567], ['A', ' H ', 137.609, 132.06, 73.025], ['A', ' HA ', 137.833, 134.042, 71.766], ['A', ' HA ', 138.955, 134.686, 72.947]] AA_SCO= 2.5568421052631574 CA_SCO= 1.7602631578947368
[['A', ' N ', 140.436, 132.196, 71.866], ['A', ' CA ', 141.581, 131.687, 71.134], ['A', ' C ', 141.386, 130.32, 70.537], ['A', ' O ', 140.519, 129.553, 70.95], ['A', ' CB ', 142.8, 131.715, 72.031], ['A', ' CG ', 143.207, 133.097, 72.321], ['A', ' CD1', 142.658, 133.809, 73.369], ['A', ' CD2', 144.149, 133.707, 71.524], ['A', ' CE1', 143.039, 135.098, 73.59], ['A', ' CE2', 144.528, 134.99, 71.757], ['A', ' CZ ', 143.974, 135.684, 72.778], ['A', ' H ', 140.118, 131.671, 72.689], ['A', ' HA ', 141.777, 132.369, 70.308], ['A', ' HB ', 142.568, 131.215, 72.976], ['A', ' HB ', 143.629, 131.183, 71.567], ['A', ' HD1', 141.906, 133.344, 74.017], ['A', ' HD2', 144.592, 133.155, 70.695], ['A', ' HE1', 142.6, 135.668, 74.417], ['A', ' HE2', 145.264, 135.477, 71.125], ['A', ' HZ ', 144.284, 136.717, 72.947]] AA_SCO= 2.5747368421052634 CA_SCO= 1.782842105263158
[['A', ' N ', 142.19, 130.012, 69.529], ['A', ' CA ', 142.121, 128.703, 68.909], ['A', ' C ', 142.359, 127.676, 69.99], ['A', ' O ', 143.259, 127.842, 70.818], ['A', ' CB ', 143.148, 128.567, 67.8], ['A', ' CG ', 142.968, 127.357, 66.981], ['A', ' ND1', 143.318, 126.099, 67.413], ['A', ' CD2', 142.489, 127.207, 65.731], ['A', ' CE1', 143.059, 125.227, 66.464], ['A', ' NE2', 142.558, 125.871, 65.429], ['A', ' H ', 142.864, 130.687, 69.198], ['A', ' HA ', 141.152, 128.519, 68.48], ['A', ' HB ', 143.092, 129.434, 67.144], ['A', ' HB ', 144.147, 128.541, 68.224], ['A', ' HD2', 142.122, 128.001, 65.079], ['A', ' HE1', 143.24, 124.155, 66.522], ['A', ' HE2', 142.273, 125.452, 64.551]] AA_SCO= 2.5500000000000003 CA_SCO= 1.7826842105263163
[['A', ' N ', 141.592, 126.593, 69.96], ['A', ' CA ', 141.65, 125.558, 70.978], ['A', ' C ', 143.027, 124.973, 71.181], ['A', ' O ', 143.333, 124.527, 72.287], ['A', ' CB ', 140.673, 124.421, 70.701], ['A', ' CG ', 141.019, 123.555, 69.58], ['A', ' ND1', 141.83, 122.453, 69.727], ['A', ' CD2', 140.629, 123.565, 68.295], ['A', ' CE1', 141.939, 121.837, 68.574], ['A', ' NE2', 141.217, 122.488, 67.686], ['A', ' H ', 140.883, 126.516, 69.237], ['A', ' HA ', 141.358, 125.998, 71.928], ['A', ' HB ', 140.574, 123.806, 71.58], ['A', ' HB ', 139.7, 124.846, 70.499], ['A', ' HD2', 139.967, 124.282, 67.828], ['A', ' HE1', 142.52, 120.934, 68.387], ['A', ' HE2', 141.107, 122.234, 66.714]] AA_SCO= 2.5563157894736843 CA_SCO= 1.7850000000000004
[['A', ' N ', 143.909, 125.031, 70.183], ['A', ' CA ', 145.248, 124.479, 70.344], ['A', ' C ', 146.019, 125.189, 71.449], ['A', ' O ', 147.017, 124.668, 71.942], ['A', ' CB ', 146.06, 124.575, 69.057], ['A', ' CG ', 146.488, 125.989, 68.653], ['A', ' CD ', 147.19, 125.997, 67.33], ['A', ' OE1', 147.626, 124.946, 66.918], ['A', ' OE2', 147.271, 127.027, 66.708], ['A', ' H ', 143.643, 125.407, 69.265], ['A', ' HA ', 145.15, 123.427, 70.614], ['A', ' HB ', 146.963, 123.974, 69.157], ['A', ' HB ', 145.48, 124.158, 68.236], ['A', ' HG ', 145.636, 126.65, 68.624], ['A', ' HG ', 147.176, 126.378, 69.402]] AA_SCO= 2.5868421052631576 CA_SCO= 1.785421052631579
[['A', ' N ', 145.586, 126.388, 71.831], ['A', ' CA ', 146.248, 127.135, 72.872], ['A', ' C ', 145.666, 126.844, 74.233], ['A', ' O ', 146.263, 127.179, 75.258], ['A', ' CB ', 146.148, 128.618, 72.616], ['A', ' CG ', 146.903, 129.066, 71.457], ['A', ' CD1', 146.245, 129.446, 70.325], ['A', ' CD2', 148.272, 129.084, 71.513], ['A', ' CE1', 146.959, 129.854, 69.236], ['A', ' CE2', 148.988, 129.485, 70.43], ['A', ' CZ ', 148.34, 129.87, 69.293], ['A', ' OH ', 149.067, 130.279, 68.201], ['A', ' H ', 144.753, 126.787, 71.39], ['A', ' HA ', 147.282, 126.844, 72.883], ['A', ' HB ', 145.1, 128.893, 72.474], ['A', ' HB ', 146.499, 129.13, 73.468], ['A', ' HD1', 145.159, 129.424, 70.289], ['A', ' HD2', 148.782, 128.776, 72.423], ['A', ' HE1', 146.442, 130.157, 68.327], ['A', ' HE2', 150.075, 129.503, 70.462], ['A', ' HH ', 150.006, 130.216, 68.395]] AA_SCO= 2.420526315789474 CA_SCO= 1.7762631578947365
[['A', ' N ', 144.526, 126.182, 74.266], ['A', ' CA ', 143.836, 125.89, 75.499], ['A', ' C ', 144.789, 125.276, 76.506], ['A', ' O ', 144.854, 125.726, 77.655], ['A', ' H ', 144.121, 125.829, 73.401], ['A', ' HA ', 143.444, 126.82, 75.89], ['A', ' HA ', 142.987, 125.238, 75.312]] AA_SCO= 2.4121052631578945 CA_SCO= 1.7666842105263159
[['A', ' N ', 145.453, 124.169, 76.152], ['A', ' CA ', 146.412, 123.475, 76.964], ['A', ' C ', 147.607, 124.328, 77.388], ['A', ' O ', 148.254, 124.006, 78.376], ['A', ' CB ', 146.841, 122.328, 76.054], ['A', ' CG ', 145.674, 122.114, 75.138], ['A', ' CD ', 145.148, 123.475, 74.881], ['A', ' HA ', 145.901, 123.062, 77.837], ['A', ' HB ', 147.757, 122.611, 75.512], ['A', ' HB ', 147.079, 121.441, 76.657], ['A', ' HG ', 146.0, 121.607, 74.216], ['A', ' HG ', 144.932, 121.461, 75.617], ['A', ' HD ', 145.714, 123.895, 74.044], ['A', ' HD ', 144.074, 123.415, 74.674]] AA_SCO= 2.450526315789473 CA_SCO= 1.8112631578947365
[['A', ' N ', 147.939, 125.406, 76.667], ['A', ' CA ', 149.065, 126.219, 77.092], ['A', ' C ', 148.61, 127.097, 78.217], ['A', ' O ', 149.369, 127.406, 79.139], ['A', ' CB ', 149.604, 127.125, 75.983], ['A', ' CG ', 150.424, 126.465, 74.943], ['A', ' ND1', 151.679, 125.976, 75.206], ['A', ' CD2', 150.204, 126.233, 73.638], ['A', ' CE1', 152.19, 125.471, 74.105], ['A', ' NE2', 151.314, 125.612, 73.142], ['A', ' H ', 147.417, 125.725, 75.858], ['A', ' HA ', 149.875, 125.587, 77.45], ['A', ' HB ', 148.769, 127.621, 75.486], ['A', ' HB ', 150.205, 127.901, 76.443], ['A', ' HD2', 149.34, 126.482, 73.069], ['A', ' HE1', 153.169, 125.011, 74.007], ['A', ' HE2', 151.431, 125.316, 72.181]] AA_SCO= 2.458947368421052 CA_SCO= 1.791736842105263
[['A', ' N ', 147.35, 127.484, 78.156], ['A', ' CA ', 146.82, 128.367, 79.157], ['A', ' C ', 146.685, 127.668, 80.478], ['A', ' O ', 147.157, 128.176, 81.497], ['A', ' CB ', 145.444, 128.876, 78.725], ['A', ' CG1', 144.816, 129.645, 79.785], ['A', ' CG2', 145.546, 129.734, 77.512], ['A', ' H ', 146.775, 127.185, 77.36], ['A', ' HA ', 147.501, 129.184, 79.288], ['A', ' HB ', 144.821, 128.029, 78.508], ['A', ' HG1', 143.87, 129.948, 79.397], ['A', ' HG1', 144.671, 129.05, 80.684], ['A', ' HG1', 145.423, 130.518, 80.023], ['A', ' HG2', 144.55, 130.063, 77.216], ['A', ' HG2', 146.134, 130.583, 77.736], ['A', ' HG2', 145.995, 129.18, 76.702]] AA_SCO= 2.318421052631579 CA_SCO= 1.4710000000000005
[['A', ' N ', 146.085, 126.487, 80.473], ['A', ' CA ', 145.917, 125.827, 81.751], ['A', ' C ', 147.268, 125.387, 82.292], ['A', ' O ', 147.489, 125.404, 83.497], ['A', ' CB ', 144.905, 124.659, 81.681], ['A', ' CG1', 145.411, 123.551, 80.75], ['A', ' CG2', 143.541, 125.206, 81.184], ['A', ' CD1', 144.636, 122.272, 80.783], ['A', ' H ', 145.723, 126.111, 79.589], ['A', ' HA ', 145.501, 126.549, 82.452], ['A', ' HB ', 144.781, 124.234, 82.681], ['A', ' HG1', 145.382, 123.943, 79.754], ['A', ' HG1', 146.423, 123.28, 80.993], ['A', ' HG2', 142.803, 124.42, 81.161], ['A', ' HG2', 143.205, 125.978, 81.846], ['A', ' HG2', 143.652, 125.625, 80.182], ['A', ' HD1', 145.074, 121.569, 80.075], ['A', ' HD1', 144.695, 121.856, 81.784], ['A', ' HD1', 143.608, 122.434, 80.523]] AA_SCO= 2.371052631578947 CA_SCO= 1.4332105263157893
[['A', ' N ', 148.197, 125.06, 81.405], ['A', ' CA ', 149.525, 124.658, 81.79], ['A', ' C ', 150.3, 125.806, 82.427], ['A', ' O ', 150.974, 125.613, 83.432], ['A', ' CB ', 150.209, 124.132, 80.568], ['A', ' CG ', 151.511, 123.548, 80.712], ['A', ' CD ', 152.036, 123.214, 79.361], ['A', ' NE ', 151.146, 122.3, 78.634], ['A', ' CZ ', 150.966, 122.287, 77.289], ['A', ' NH1', 151.599, 123.139, 76.515], ['A', ' NH2', 150.142, 121.403, 76.751], ['A', ' H ', 147.981, 125.04, 80.407], ['A', ' HA ', 149.434, 123.857, 82.514], ['A', ' HB ', 149.586, 123.337, 80.195], ['A', ' HB ', 150.258, 124.908, 79.808], ['A', ' HG ', 152.141, 124.275, 81.186], ['A', ' HG ', 151.465, 122.644, 81.312], ['A', ' HD ', 152.142, 124.134, 78.793], ['A', ' HD ', 153.012, 122.727, 79.45], ['A', ' HE ', 150.632, 121.623, 79.174], ['A', ' HH1', 152.239, 123.818, 76.918], ['A', ' HH1', 151.473, 123.108, 75.517], ['A', ' HH2', 149.639, 120.757, 77.34], ['A', ' HH2', 150.012, 121.379, 75.75]] AA_SCO= 2.373157894736842 CA_SCO= 0.737
[['A', ' N ', 150.154, 127.026, 81.902], ['A', ' CA ', 150.843, 128.206, 82.434], ['A', ' C ', 150.504, 128.443, 83.9], ['A', ' O ', 151.366, 128.878, 84.674], ['A', ' CB ', 150.47, 129.431, 81.624], ['A', ' H ', 149.621, 127.136, 81.036], ['A', ' HA ', 151.914, 128.037, 82.354], ['A', ' HB ', 151.002, 130.301, 81.997], ['A', ' HB ', 150.736, 129.259, 80.584], ['A', ' HB ', 149.395, 129.601, 81.701]] AA_SCO= 2.2431578947368425 CA_SCO= 0.6254736842105263
[['A', ' N ', 149.278, 128.114, 84.289], ['A', ' CA ', 148.84, 128.271, 85.669], ['A', ' C ', 149.501, 127.27, 86.603], ['A', ' O ', 149.57, 127.493, 87.816], ['A', ' CB ', 147.337, 128.135, 85.782], ['A', ' CG ', 146.569, 129.321, 85.381], ['A', ' CD1', 145.99, 129.383, 84.153], ['A', ' CD2', 146.414, 130.344, 86.267], ['A', ' CE1', 145.245, 130.473, 83.791], ['A', ' CE2', 145.684, 131.432, 85.921], ['A', ' CZ ', 145.093, 131.507, 84.693], ['A', ' OH ', 144.371, 132.622, 84.346], ['A', ' H ', 148.606, 127.813, 83.57], ['A', ' HA ', 149.12, 129.273, 85.995], ['A', ' HB ', 147.028, 127.32, 85.141], ['A', ' HB ', 147.062, 127.876, 86.804], ['A', ' HD1', 146.112, 128.565, 83.478], ['A', ' HD2', 146.877, 130.292, 87.253], ['A', ' HE1', 144.781, 130.516, 82.808], ['A', ' HE2', 145.572, 132.244, 86.626], ['A', ' HH ', 144.531, 133.348, 84.998]] AA_SCO= 1.9942105263157894 CA_SCO= 0.37521052631578955
[['A', ' N ', 149.973, 126.168, 86.052], ['A', ' CA ', 150.602, 125.065, 86.754], ['A', ' C ', 149.772, 124.526, 87.918], ['A', ' O ', 150.145, 124.725, 89.072], ['A', ' CB ', 151.95, 125.495, 87.297], ['A', ' CG ', 152.951, 124.361, 87.533], ['A', ' OD1', 153.004, 123.414, 86.743], ['A', ' OD2', 153.751, 124.489, 88.43], ['A', ' H ', 149.97, 126.092, 85.035], ['A', ' HA ', 150.77, 124.268, 86.041], ['A', ' HB ', 152.383, 126.199, 86.607], ['A', ' HB ', 151.81, 126.008, 88.237]] AA_SCO= 2.0011111111111113 CA_SCO= 0.29455555555555574
[['A', ' N ', 148.552, 124.054, 87.711], ['A', ' CA ', 147.742, 123.436, 88.725], ['A', ' C ', 148.271, 122.068, 89.079], ['A', ' O ', 148.939, 121.445, 88.267], ['A', ' CB ', 146.409, 123.36, 88.049], ['A', ' CG ', 146.753, 123.3, 86.576], ['A', ' CD ', 147.853, 124.259, 86.452], ['A', ' HA ', 147.702, 124.086, 89.615], ['A', ' HB ', 145.858, 122.539, 88.435], ['A', ' HB ', 145.853, 124.26, 88.316], ['A', ' HG ', 147.102, 122.296, 86.306], ['A', ' HG ', 145.9, 123.525, 85.928], ['A', ' HD ', 148.43, 124.085, 85.588], ['A', ' HD ', 147.416, 125.256, 86.43]] AA_SCO= 1.9294117647058826 CA_SCO= 0.19905882352941198
[['A', ' N ', 147.959, 121.585, 90.273], ['A', ' CA ', 148.344, 120.24, 90.668], ['A', ' C ', 147.335, 119.179, 90.244], ['A', ' O ', 147.684, 118.034, 89.972], ['A', ' CB ', 148.573, 120.253, 92.13], ['A', ' SG ', 150.024, 121.162, 92.556], ['A', ' H ', 147.432, 122.145, 90.94], ['A', ' HA ', 149.294, 120.006, 90.19], ['A', ' HB ', 147.739, 120.701, 92.619], ['A', ' HB ', 148.637, 119.31, 92.486], ['A', ' HG ', 150.137, 120.684, 93.806]] AA_SCO= 1.8725000000000003 CA_SCO= 0.11300000000000021
[['A', ' N ', 146.076, 119.567, 90.199], ['A', ' CA ', 144.946, 118.781, 89.697], ['A', ' C ', 144.767, 117.401, 90.299], ['A', ' O ', 143.859, 117.153, 91.097], ['A', ' CB ', 145.187, 118.616, 88.21], ['A', ' CG ', 145.326, 119.897, 87.458], ['A', ' CD1', 145.766, 119.575, 86.076], ['A', ' CD2', 144.036, 120.719, 87.502], ['A', ' H ', 145.899, 120.511, 90.494], ['A', ' HA ', 144.03, 119.331, 89.886], ['A', ' HB ', 146.099, 118.059, 88.035], ['A', ' HB ', 144.37, 118.038, 87.782], ['A', ' HG ', 146.122, 120.456, 87.893], ['A', ' HD1', 145.942, 120.472, 85.509], ['A', ' HD1', 146.691, 119.009, 86.121], ['A', ' HD1', 145.033, 118.999, 85.609], ['A', ' HD2', 144.213, 121.623, 86.967], ['A', ' HD2', 143.22, 120.184, 87.052], ['A', ' HD2', 143.771, 120.973, 88.512]] AA_SCO= 1.802 CA_SCO= 0.03193333333333343
[['A', ' N ', 145.674, 116.494, 89.952], ['A', ' CA ', 145.615, 115.122, 90.486], ['A', ' C ', 145.794, 115.093, 91.987], ['A', ' O ', 145.161, 114.296, 92.692], ['A', ' CB ', 146.721, 114.28, 89.917], ['A', ' OG ', 147.944, 114.716, 90.435], ['A', ' H ', 146.437, 116.784, 89.347], ['A', ' HA ', 144.662, 114.687, 90.245], ['A', ' HB ', 146.546, 113.244, 90.188], ['A', ' HB ', 146.734, 114.341, 88.858], ['A', ' HG ', 148.629, 114.201, 90.001]] AA_SCO= 1.7035714285714287 CA_SCO= -0.1062142857142857
[['A', ' N ', 146.585, 116.052, 92.466], ['A', ' CA ', 146.938, 116.347, 93.8], ['A', ' C ', 146.474, 117.742, 93.935], ['A', ' O ', 147.183, 118.611, 94.441], ['A', ' CB ', 148.44, 116.089, 94.035], ['A', ' SG ', 149.745, 117.04, 93.045], ['A', ' H ', 147.061, 116.592, 91.72], ['A', ' HA ', 146.371, 115.724, 94.498], ['A', ' HB ', 148.58, 116.274, 94.995], ['A', ' HB ', 148.648, 115.023, 93.902]] AA_SCO= 1.6515384615384614 CA_SCO= -0.18507692307692308
[['A', ' N ', 145.254, 117.997, 93.428], ['A', ' CA ', 144.808, 119.338, 93.503], ['A', ' C ', 145.069, 119.716, 94.878], ['A', ' O ', 144.567, 119.135, 95.845], ['A', ' CB ', 143.331, 119.501, 93.185], ['A', ' H ', 144.68, 117.281, 92.98], ['A', ' HA ', 145.413, 119.955, 92.851], ['A', ' HB ', 143.045, 120.54, 93.315], ['A', ' HB ', 143.128, 119.205, 92.171], ['A', ' HB ', 142.751, 118.88, 93.862]] AA_SCO= 1.6116666666666666 CA_SCO= -0.36341666666666655
[['A', ' N ', 145.815, 120.75, 94.97], ['A', ' CA ', 146.169, 121.297, 96.208], ['A', ' C ', 144.94, 122.081, 96.527], ['A', ' O ', 144.927, 123.27, 96.193], ['A', ' CB ', 147.397, 122.179, 96.036], ['A', ' OG1', 147.117, 123.163, 95.003], ['A', ' CG2', 148.553, 121.352, 95.686], ['A', ' H ', 146.197, 121.161, 94.135], ['A', ' HA ', 146.358, 120.515, 96.943], ['A', ' HB ', 147.646, 122.655, 96.914], ['A', ' HG1', 146.34, 123.718, 95.298], ['A', ' HG2', 149.397, 121.984, 95.566], ['A', ' HG2', 148.73, 120.643, 96.473], ['A', ' HG2', 148.354, 120.829, 94.802]] AA_SCO= 1.4954545454545454 CA_SCO= -0.5746363636363636
[['A', ' N ', 143.889, 121.364, 97.052], ['A', ' CA ', 142.487, 121.735, 97.354], ['A', ' C ', 142.158, 123.233, 97.22], ['A', ' O ', 142.44, 123.842, 96.187], ['A', ' OXT', 141.379, 123.775, 97.997], ['A', ' CB ', 142.072, 121.169, 98.769], ['A', ' CG ', 142.089, 119.613, 98.853], ['A', ' ND1', 141.222, 118.823, 98.127], ['A', ' CD2', 142.871, 118.758, 99.563], ['A', ' CE1', 141.478, 117.548, 98.386], ['A', ' NE2', 142.472, 117.485, 99.255], ['A', ' H ', 144.122, 120.38, 97.205], ['A', ' HA ', 141.858, 121.237, 96.623], ['A', ' HB ', 142.734, 121.579, 99.544], ['A', ' HB ', 141.056, 121.498, 99.029], ['A', ' HD2', 143.666, 119.031, 100.247], ['A', ' HE1', 140.956, 116.694, 97.954], ['A', ' HE2', 142.876, 116.647, 99.627]] AA_SCO= 1.3719999999999999 CA_SCO= -0.8291000000000001
INFO : DeepMainmast Computation Done with FullAtom Model
INFO : DeepMainMast Done

af2_structure :

contour_level :

cryo_em_map :

email :

fasta :

homo :

rosetta :

If the output looks wrong or the job has failed. You can submit it for review here.

Kiharalab EMSuite Server

DeepMainMast

Job ID : 3d83f65e81bc6c3fac4780f90df9395a