Please use a sequence file with fasta format. If the target protein has multiple chains, please put all sequences. Each chain must have a ID line (begin with a carat (">")) and a SEQUENCE line.
For ID line, please only include the chain id without any other information. If multiple chains include the identical sequences, please use comma "," to split different chains.
Example Sequence ID line
>A,B,C,D
MATPAGRRASETERLLTPNPGYGTQVGTSPAPTTPTEEEDLRR
>E,F
VVTFREENTIAFRHLFLLGYSDGSDDTFAAYTQEQLYQ
which indicates 6 chains with A,B,C,D share the identical sequences and E,F share another identical sequences.
